3EK5A

Unique gtp-binding pocket and allostery of ump kinase from a gram-negative phytopathogen bacterium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
241
Chain Sequence
NAMSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGAGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique GTP-Binding Pocket and Allostery of Uridylate Kinase from a Gram-Negative Phytopathogenic Bacterium
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords Uridylate kinase
total genus 80
structure length 241
sequence length 241
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ek5A00
2J0XA 4NDPB 2J5VA 2BRXA 2BNDA 4JZ7A 4A7WA 3NWYA 2AP9A 4F6TB 2BRIA 3S6HA 3LL5A 3U6UA 2VA1A 3S6GA 3C20A 4NDQA 2R98A 3QURA 4OLCA 2BTYA 3L86A 1GSJA 3T7BA 3ZZGA 3QVHA 4I49A 3K4YA 2V4YA 4F6TA 2J4JA 1E19A 3D2MA 3ZZFA 2W21A 3D40A 4NDRA 3C1MA 3AAWA 4NDOA 3EK5A 3K56A 3EK6A 4A7XA 2OGXA 4KZTA 1OHAA 3WWNA 2V5HA 3S6KA 3D2PA 4NDRB 3TVIA 4USJA 2J4LA 3B8GA 3AB4A 3C1NA 1GS5A 3AB2A 3D41A 2OGXB 3K52A 4JZ9A 4AXSA 1OHBA 2WE4A 1B7BA 2RD5A 2CDQA 2E9YA 3LKKA 2A1FA 2IJ9A 2X2WA 2J4KA 4AB7A 2J0WA 3K4OA 3L76A 2HMFA 3LL9A 2WXBA 4JZ8A 3QUNA 4Q1TA 3QVFA 2WE5A 1OH9A 1Z9DA 3KZFA 3QUOA 2JI5A 3ZZHA 3ZZIA 4NDQB 2BNEA 4NDPA 2BUFA 2BMUA 2JJ4A 1YBDA 2J5TA 3WWMA 2JJXA 2AKOA 2R8VA 4NDOB 2BNFA
chains in the Genus database with same CATH superfamily
2J0XA 4NDPB 2J5VA 2BRXA 2BNDA 4JZ7A 4A7WA 3NWYA 2AP9A 4F6TB 2BRIA 3S6HA 3LL5A 3U6UA 2VA1A 3S6GA 3C20A 4NDQA 2R98A 3QURA 4OLCA 2BTYA 3L86A 1GSJA 3T7BA 3ZZGA 3QVHA 4I49A 3K4YA 2V4YA 4F6TA 2J4JA 1E19A 3D2MA 3ZZFA 2W21A 3D40A 4NDRA 3C1MA 3AAWA 4NDOA 3EK5A 3K56A 3EK6A 4A7XA 2OGXA 4KZTA 1OHAA 3WWNA 2V5HA 3S6KA 3D2PA 4NDRB 3TVIA 4USJA 2J4LA 3B8GA 3AB4A 3C1NA 1GS5A 3AB2A 3D41A 2OGXB 3K52A 4JZ9A 4AXSA 1OHBA 2WE4A 1B7BA 2RD5A 2CDQA 2E9YA 3LKKA 2A1FA 2IJ9A 2X2WA 2J4KA 4AB7A 2J0WA 3K4OA 3L76A 2HMFA 3LL9A 2WXBA 4JZ8A 3QUNA 4Q1TA 3QVFA 2WE5A 1OH9A 1Z9DA 3KZFA 3QUOA 2JI5A 3ZZHA 3ZZIA 4NDQB 2BNEA 4NDPA 2BUFA 2BMUA 2JJ4A 1YBDA 2J5TA 3WWMA 2JJXA 2AKOA 2R8VA 4NDOB 2BNFA
chains in the Genus database with same CATH topology
2J0XA 4NDPB 2J5VA 2BRXA 2BNDA 4JZ7A 4A7WA 3NWYA 2AP9A 4F6TB 2BRIA 3S6HA 3LL5A 3U6UA 2VA1A 3S6GA 3C20A 4NDQA 2R98A 3QURA 4OLCA 2BTYA 3L86A 1GSJA 3T7BA 3ZZGA 3QVHA 4I49A 3K4YA 2V4YA 4F6TA 2J4JA 1E19A 3D2MA 3ZZFA 2W21A 3D40A 4NDRA 3C1MA 3AAWA 4NDOA 3EK5A 3K56A 3EK6A 4A7XA 2OGXA 4KZTA 1OHAA 3WWNA 2V5HA 3S6KA 3D2PA 4NDRB 3TVIA 4USJA 2J4LA 3B8GA 3AB4A 3C1NA 1GS5A 3AB2A 3D41A 2OGXB 3K52A 4JZ9A 4AXSA 1OHBA 2WE4A 1B7BA 2RD5A 2CDQA 2E9YA 3LKKA 2A1FA 2IJ9A 2X2WA 2J4KA 4AB7A 2J0WA 3K4OA 3L76A 2HMFA 3LL9A 2WXBA 4JZ8A 3QUNA 4Q1TA 3QVFA 2WE5A 1OH9A 1Z9DA 3KZFA 3QUOA 2JI5A 3ZZHA 3ZZIA 4NDQB 2BNEA 4NDPA 2BUFA 2BMUA 2JJ4A 1YBDA 2J5TA 3WWMA 2JJXA 2AKOA 2R8VA 4NDOB 2BNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0X A;  4NDP B;  2J5V A;  2BRX A;  2BND A;  4JZ7 A;  4A7W A;  3NWY A;  2AP9 A;  4F6T B;  2BRI A;  3S6H A;  3LL5 A;  3U6U A;  2VA1 A;  3S6G A;  3C20 A;  4NDQ A;  2R98 A;  3QUR A;  4OLC A;  2BTY A;  3L86 A;  1GSJ A;  3T7B A;  3ZZG A;  3QVH A;  4I49 A;  3K4Y A;  2V4Y A;  4F6T A;  2J4J A;  1E19 A;  3D2M A;  3ZZF A;  2W21 A;  3D40 A;  4NDR A;  3C1M A;  3AAW A;  4NDO A;  3EK5 A;  3K56 A;  3EK6 A;  4A7X A;  2OGX A;  4KZT A;  1OHA A;  3WWN A;  2V5H A;  3S6K A;  3D2P A;  4NDR B;  3TVI A;  4USJ A;  2J4L A;  3B8G A;  3AB4 A;  3C1N A;  1GS5 A;  3AB2 A;  3D41 A;  2OGX B;  3K52 A;  4JZ9 A;  4AXS A;  1OHB A;  2WE4 A;  1B7B A;  2RD5 A;  2CDQ A;  2E9Y A;  3LKK A;  2A1F A;  2IJ9 A;  2X2W A;  2J4K A;  4AB7 A;  2J0W A;  3K4O A;  3L76 A;  2HMF A;  3LL9 A;  2WXB A;  4JZ8 A;  3QUN A;  4Q1T A;  3QVF A;  2WE5 A;  1OH9 A;  1Z9D A;  3KZF A;  3QUO A;  2JI5 A;  3ZZH A;  3ZZI A;  4NDQ B;  2BNE A;  4NDP A;  2BUF A;  2BMU A;  2JJ4 A;  1YBD A;  2J5T A;  3WWM A;  2JJX A;  2AKO A;  2R8V A;  4NDO B;  2BNF A; 
#chains in the Genus database with same CATH topology
 2J0X A;  4NDP B;  2J5V A;  2BRX A;  2BND A;  4JZ7 A;  4A7W A;  3NWY A;  2AP9 A;  4F6T B;  2BRI A;  3S6H A;  3LL5 A;  3U6U A;  2VA1 A;  3S6G A;  3C20 A;  4NDQ A;  2R98 A;  3QUR A;  4OLC A;  2BTY A;  3L86 A;  1GSJ A;  3T7B A;  3ZZG A;  3QVH A;  4I49 A;  3K4Y A;  2V4Y A;  4F6T A;  2J4J A;  1E19 A;  3D2M A;  3ZZF A;  2W21 A;  3D40 A;  4NDR A;  3C1M A;  3AAW A;  4NDO A;  3EK5 A;  3K56 A;  3EK6 A;  4A7X A;  2OGX A;  4KZT A;  1OHA A;  3WWN A;  2V5H A;  3S6K A;  3D2P A;  4NDR B;  3TVI A;  4USJ A;  2J4L A;  3B8G A;  3AB4 A;  3C1N A;  1GS5 A;  3AB2 A;  3D41 A;  2OGX B;  3K52 A;  4JZ9 A;  4AXS A;  1OHB A;  2WE4 A;  1B7B A;  2RD5 A;  2CDQ A;  2E9Y A;  3LKK A;  2A1F A;  2IJ9 A;  2X2W A;  2J4K A;  4AB7 A;  2J0W A;  3K4O A;  3L76 A;  2HMF A;  3LL9 A;  2WXB A;  4JZ8 A;  3QUN A;  4Q1T A;  3QVF A;  2WE5 A;  1OH9 A;  1Z9D A;  3KZF A;  3QUO A;  2JI5 A;  3ZZH A;  3ZZI A;  4NDQ B;  2BNE A;  4NDP A;  2BUF A;  2BMU A;  2JJ4 A;  1YBD A;  2J5T A;  3WWM A;  2JJX A;  2AKO A;  2R8V A;  4NDO B;  2BNF A; 
#chains in the Genus database with same CATH homology
 2J0X A;  4NDP B;  2J5V A;  2BRX A;  2BND A;  4JZ7 A;  4A7W A;  3NWY A;  2AP9 A;  4F6T B;  2BRI A;  3S6H A;  3LL5 A;  3U6U A;  2VA1 A;  3S6G A;  3C20 A;  4NDQ A;  2R98 A;  3QUR A;  4OLC A;  2BTY A;  3L86 A;  1GSJ A;  3T7B A;  3ZZG A;  3QVH A;  4I49 A;  3K4Y A;  2V4Y A;  4F6T A;  2J4J A;  1E19 A;  3D2M A;  3ZZF A;  2W21 A;  3D40 A;  4NDR A;  3C1M A;  3AAW A;  4NDO A;  3EK5 A;  3K56 A;  3EK6 A;  4A7X A;  2OGX A;  4KZT A;  1OHA A;  3WWN A;  2V5H A;  3S6K A;  3D2P A;  4NDR B;  3TVI A;  4USJ A;  2J4L A;  3B8G A;  3AB4 A;  3C1N A;  1GS5 A;  3AB2 A;  3D41 A;  2OGX B;  3K52 A;  4JZ9 A;  4AXS A;  1OHB A;  2WE4 A;  1B7B A;  2RD5 A;  2CDQ A;  2E9Y A;  3LKK A;  2A1F A;  2IJ9 A;  2X2W A;  2J4K A;  4AB7 A;  2J0W A;  3K4O A;  3L76 A;  2HMF A;  3LL9 A;  2WXB A;  4JZ8 A;  3QUN A;  4Q1T A;  3QVF A;  2WE5 A;  1OH9 A;  1Z9D A;  3KZF A;  3QUO A;  2JI5 A;  3ZZH A;  3ZZI A;  4NDQ B;  2BNE A;  4NDP A;  2BUF A;  2BMU A;  2JJ4 A;  1YBD A;  2J5T A;  3WWM A;  2JJX A;  2AKO A;  2R8V A;  4NDO B;  2BNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...