4A7XA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIRGVSAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7xA00
3EK5A 3L76A 2J5VA 2J0XA 3AB2A 4JZ8A 3S6HA 2J5TA 3L86A 3LL9A 3D40A 3T7BA 4NDPB 2R8VA 3AAWA 4JZ7A 2X2WA 2RD5A 2BNEA 4Q1TA 3ZZGA 3D41A 2OGXB 4JZ9A 3ZZHA 2AP9A 4AB7A 4F6TA 2WE4A 4NDQB 3EK6A 1Z9DA 2V4YA 2BUFA 3AB4A 1E19A 3B8GA 3WWMA 3K56A 3U6UA 2VA1A 2CDQA 2W21A 1B7BA 2JJ4A 4KZTA 2J4KA 3TVIA 4USJA 2E9YA 3K52A 2JI5A 3D2MA 2BNDA 3LKKA 3ZZFA 3K4YA 1GSJA 2AKOA 3NWYA 2J4JA 3QUNA 2BNFA 1YBDA 2WXBA 2R98A 3C20A 3S6GA 3S6KA 2WE5A 2J4LA 2BRXA 4NDPA 3C1MA 3KZFA 3QURA 2OGXA 4A7WA 3LL5A 4NDQA 2JJXA 3ZZIA 3C1NA 4F6TB 3K4OA 2IJ9A 4NDOB 2HMFA 1OHAA 3QVFA 4NDRB 1GS5A 3D2PA 2A1FA 2BRIA 4OLCA 3QVHA 3QUOA 1OHBA 2BTYA 2V5HA 1OH9A 4AXSA 2BMUA 3WWNA 4A7XA 4NDOA 2J0WA 4I49A 4NDRA
chains in the Genus database with same CATH superfamily
3EK5A 3L76A 2J5VA 2J0XA 3AB2A 4JZ8A 3S6HA 2J5TA 3L86A 3LL9A 3D40A 3T7BA 4NDPB 2R8VA 3AAWA 4JZ7A 2X2WA 2RD5A 2BNEA 4Q1TA 3ZZGA 3D41A 2OGXB 4JZ9A 3ZZHA 2AP9A 4AB7A 4F6TA 2WE4A 4NDQB 3EK6A 1Z9DA 2V4YA 2BUFA 3AB4A 1E19A 3B8GA 3WWMA 3K56A 3U6UA 2VA1A 2CDQA 2W21A 1B7BA 2JJ4A 4KZTA 2J4KA 3TVIA 4USJA 2E9YA 3K52A 2JI5A 3D2MA 2BNDA 3LKKA 3ZZFA 3K4YA 1GSJA 2AKOA 3NWYA 2J4JA 3QUNA 2BNFA 1YBDA 2WXBA 2R98A 3C20A 3S6GA 3S6KA 2WE5A 2J4LA 2BRXA 4NDPA 3C1MA 3KZFA 3QURA 2OGXA 4A7WA 3LL5A 4NDQA 2JJXA 3ZZIA 3C1NA 4F6TB 3K4OA 2IJ9A 4NDOB 2HMFA 1OHAA 3QVFA 4NDRB 1GS5A 3D2PA 2A1FA 2BRIA 4OLCA 3QVHA 3QUOA 1OHBA 2BTYA 2V5HA 1OH9A 4AXSA 2BMUA 3WWNA 4A7XA 4NDOA 2J0WA 4I49A 4NDRA
chains in the Genus database with same CATH topology
3EK5A 3L76A 2J5VA 2J0XA 3AB2A 4JZ8A 3S6HA 2J5TA 3L86A 3LL9A 3D40A 3T7BA 4NDPB 2R8VA 3AAWA 4JZ7A 2X2WA 2RD5A 2BNEA 4Q1TA 3ZZGA 3D41A 2OGXB 4JZ9A 3ZZHA 2AP9A 4AB7A 4F6TA 2WE4A 4NDQB 3EK6A 1Z9DA 2V4YA 2BUFA 3AB4A 1E19A 3B8GA 3WWMA 3K56A 3U6UA 2VA1A 2CDQA 2W21A 1B7BA 2JJ4A 4KZTA 2J4KA 3TVIA 4USJA 2E9YA 3K52A 2JI5A 3D2MA 2BNDA 3LKKA 3ZZFA 3K4YA 1GSJA 2AKOA 3NWYA 2J4JA 3QUNA 2BNFA 1YBDA 2WXBA 2R98A 3C20A 3S6GA 3S6KA 2WE5A 2J4LA 2BRXA 4NDPA 3C1MA 3KZFA 3QURA 2OGXA 4A7WA 3LL5A 4NDQA 2JJXA 3ZZIA 3C1NA 4F6TB 3K4OA 2IJ9A 4NDOB 2HMFA 1OHAA 3QVFA 4NDRB 1GS5A 3D2PA 2A1FA 2BRIA 4OLCA 3QVHA 3QUOA 1OHBA 2BTYA 2V5HA 1OH9A 4AXSA 2BMUA 3WWNA 4A7XA 4NDOA 2J0WA 4I49A 4NDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EK5 A;  3L76 A;  2J5V A;  2J0X A;  3AB2 A;  4JZ8 A;  3S6H A;  2J5T A;  3L86 A;  3LL9 A;  3D40 A;  3T7B A;  4NDP B;  2R8V A;  3AAW A;  4JZ7 A;  2X2W A;  2RD5 A;  2BNE A;  4Q1T A;  3ZZG A;  3D41 A;  2OGX B;  4JZ9 A;  3ZZH A;  2AP9 A;  4AB7 A;  4F6T A;  2WE4 A;  4NDQ B;  3EK6 A;  1Z9D A;  2V4Y A;  2BUF A;  3AB4 A;  1E19 A;  3B8G A;  3WWM A;  3K56 A;  3U6U A;  2VA1 A;  2CDQ A;  2W21 A;  1B7B A;  2JJ4 A;  4KZT A;  2J4K A;  3TVI A;  4USJ A;  2E9Y A;  3K52 A;  2JI5 A;  3D2M A;  2BND A;  3LKK A;  3ZZF A;  3K4Y A;  1GSJ A;  2AKO A;  3NWY A;  2J4J A;  3QUN A;  2BNF A;  1YBD A;  2WXB A;  2R98 A;  3C20 A;  3S6G A;  3S6K A;  2WE5 A;  2J4L A;  2BRX A;  4NDP A;  3C1M A;  3KZF A;  3QUR A;  2OGX A;  4A7W A;  3LL5 A;  4NDQ A;  2JJX A;  3ZZI A;  3C1N A;  4F6T B;  3K4O A;  2IJ9 A;  4NDO B;  2HMF A;  1OHA A;  3QVF A;  4NDR B;  1GS5 A;  3D2P A;  2A1F A;  2BRI A;  4OLC A;  3QVH A;  3QUO A;  1OHB A;  2BTY A;  2V5H A;  1OH9 A;  4AXS A;  2BMU A;  3WWN A;  4A7X A;  4NDO A;  2J0W A;  4I49 A;  4NDR A; 
#chains in the Genus database with same CATH topology
 3EK5 A;  3L76 A;  2J5V A;  2J0X A;  3AB2 A;  4JZ8 A;  3S6H A;  2J5T A;  3L86 A;  3LL9 A;  3D40 A;  3T7B A;  4NDP B;  2R8V A;  3AAW A;  4JZ7 A;  2X2W A;  2RD5 A;  2BNE A;  4Q1T A;  3ZZG A;  3D41 A;  2OGX B;  4JZ9 A;  3ZZH A;  2AP9 A;  4AB7 A;  4F6T A;  2WE4 A;  4NDQ B;  3EK6 A;  1Z9D A;  2V4Y A;  2BUF A;  3AB4 A;  1E19 A;  3B8G A;  3WWM A;  3K56 A;  3U6U A;  2VA1 A;  2CDQ A;  2W21 A;  1B7B A;  2JJ4 A;  4KZT A;  2J4K A;  3TVI A;  4USJ A;  2E9Y A;  3K52 A;  2JI5 A;  3D2M A;  2BND A;  3LKK A;  3ZZF A;  3K4Y A;  1GSJ A;  2AKO A;  3NWY A;  2J4J A;  3QUN A;  2BNF A;  1YBD A;  2WXB A;  2R98 A;  3C20 A;  3S6G A;  3S6K A;  2WE5 A;  2J4L A;  2BRX A;  4NDP A;  3C1M A;  3KZF A;  3QUR A;  2OGX A;  4A7W A;  3LL5 A;  4NDQ A;  2JJX A;  3ZZI A;  3C1N A;  4F6T B;  3K4O A;  2IJ9 A;  4NDO B;  2HMF A;  1OHA A;  3QVF A;  4NDR B;  1GS5 A;  3D2P A;  2A1F A;  2BRI A;  4OLC A;  3QVH A;  3QUO A;  1OHB A;  2BTY A;  2V5H A;  1OH9 A;  4AXS A;  2BMU A;  3WWN A;  4A7X A;  4NDO A;  2J0W A;  4I49 A;  4NDR A; 
#chains in the Genus database with same CATH homology
 3EK5 A;  3L76 A;  2J5V A;  2J0X A;  3AB2 A;  4JZ8 A;  3S6H A;  2J5T A;  3L86 A;  3LL9 A;  3D40 A;  3T7B A;  4NDP B;  2R8V A;  3AAW A;  4JZ7 A;  2X2W A;  2RD5 A;  2BNE A;  4Q1T A;  3ZZG A;  3D41 A;  2OGX B;  4JZ9 A;  3ZZH A;  2AP9 A;  4AB7 A;  4F6T A;  2WE4 A;  4NDQ B;  3EK6 A;  1Z9D A;  2V4Y A;  2BUF A;  3AB4 A;  1E19 A;  3B8G A;  3WWM A;  3K56 A;  3U6U A;  2VA1 A;  2CDQ A;  2W21 A;  1B7B A;  2JJ4 A;  4KZT A;  2J4K A;  3TVI A;  4USJ A;  2E9Y A;  3K52 A;  2JI5 A;  3D2M A;  2BND A;  3LKK A;  3ZZF A;  3K4Y A;  1GSJ A;  2AKO A;  3NWY A;  2J4J A;  3QUN A;  2BNF A;  1YBD A;  2WXB A;  2R98 A;  3C20 A;  3S6G A;  3S6K A;  2WE5 A;  2J4L A;  2BRX A;  4NDP A;  3C1M A;  3KZF A;  3QUR A;  2OGX A;  4A7W A;  3LL5 A;  4NDQ A;  2JJX A;  3ZZI A;  3C1N A;  4F6T B;  3K4O A;  2IJ9 A;  4NDO B;  2HMF A;  1OHA A;  3QVF A;  4NDR B;  1GS5 A;  3D2P A;  2A1F A;  2BRI A;  4OLC A;  3QVH A;  3QUO A;  1OHB A;  2BTY A;  2V5H A;  1OH9 A;  4AXS A;  2BMU A;  3WWN A;  4A7X A;  4NDO A;  2J0W A;  4I49 A;  4NDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...