4A7XA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
b'NKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIRGVSAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7xA00
2W21A 3S6KA 4KZTA 2BRIA 1GS5A 3QUOA 3ZZGA 4OLCA 3QVFA 3S6HA 2J5VA 4AXSA 3QUNA 2WE5A 2R98A 4JZ8A 1OHAA 2WXBA 3AAWA 3ZZIA 4NDPB 4F6TA 2BMUA 1GSJA 3QVHA 4JZ9A 3C1MA 2AKOA 2OGXB 3EK6A 3NWYA 3C20A 3AB2A 4F6TB 3WWMA 3KZFA 3TVIA 2E9YA 3K4OA 3C1NA 4Q1TA 2J5TA 2R8VA 2HMFA 2VA1A 4I49A 3LL5A 1Z9DA 2V5HA 2JI5A 3D40A 3K56A 3U6UA 3D2MA 2J4KA 2X2WA 2J4LA 2AP9A 3K52A 2J4JA 3ZZFA 3B8GA 4A7WA 1OH9A 4A7XA 2BTYA 4JZ7A 2A1FA 3L76A 3EK5A 2BNEA 3AB4A 2BUFA 4NDRA 3T7BA 2BRXA 4NDOA 3ZZHA 2CDQA 4USJA 4NDQA 2BNFA 2JJ4A 4NDRB 1E19A 4NDPA 4NDOB 3QURA 2IJ9A 2J0WA 4NDQB 1YBDA 2JJXA 2OGXA 2J0XA 3D2PA 1B7BA 4AB7A 1OHBA 3K4YA 3WWNA 3S6GA 3LKKA 3L86A 3LL9A 2WE4A 2BNDA 3D41A 2V4YA 2RD5A
chains in the Genus database with same CATH superfamily
2W21A 3S6KA 4KZTA 2BRIA 1GS5A 3QUOA 3ZZGA 4OLCA 3QVFA 3S6HA 2J5VA 4AXSA 3QUNA 2WE5A 2R98A 4JZ8A 1OHAA 2WXBA 3AAWA 3ZZIA 4NDPB 4F6TA 2BMUA 1GSJA 3QVHA 4JZ9A 3C1MA 2AKOA 2OGXB 3EK6A 3NWYA 3C20A 3AB2A 4F6TB 3WWMA 3KZFA 3TVIA 2E9YA 3K4OA 3C1NA 4Q1TA 2J5TA 2R8VA 2HMFA 2VA1A 4I49A 3LL5A 1Z9DA 2V5HA 2JI5A 3D40A 3K56A 3U6UA 3D2MA 2J4KA 2X2WA 2J4LA 2AP9A 3K52A 2J4JA 3ZZFA 3B8GA 4A7WA 1OH9A 4A7XA 2BTYA 4JZ7A 2A1FA 3L76A 3EK5A 2BNEA 3AB4A 2BUFA 4NDRA 3T7BA 2BRXA 4NDOA 3ZZHA 2CDQA 4USJA 4NDQA 2BNFA 2JJ4A 4NDRB 1E19A 4NDPA 4NDOB 3QURA 2IJ9A 2J0WA 4NDQB 1YBDA 2JJXA 2OGXA 2J0XA 3D2PA 1B7BA 4AB7A 1OHBA 3K4YA 3WWNA 3S6GA 3LKKA 3L86A 3LL9A 2WE4A 2BNDA 3D41A 2V4YA 2RD5A
chains in the Genus database with same CATH topology
2W21A 3S6KA 4KZTA 2BRIA 1GS5A 3QUOA 3ZZGA 4OLCA 3QVFA 3S6HA 2J5VA 4AXSA 3QUNA 2WE5A 2R98A 4JZ8A 1OHAA 2WXBA 3AAWA 3ZZIA 4NDPB 4F6TA 2BMUA 1GSJA 3QVHA 4JZ9A 3C1MA 2AKOA 2OGXB 3EK6A 3NWYA 3C20A 3AB2A 4F6TB 3WWMA 3KZFA 3TVIA 2E9YA 3K4OA 3C1NA 4Q1TA 2J5TA 2R8VA 2HMFA 2VA1A 4I49A 3LL5A 1Z9DA 2V5HA 2JI5A 3D40A 3K56A 3U6UA 3D2MA 2J4KA 2X2WA 2J4LA 2AP9A 3K52A 2J4JA 3ZZFA 3B8GA 4A7WA 1OH9A 4A7XA 2BTYA 4JZ7A 2A1FA 3L76A 3EK5A 2BNEA 3AB4A 2BUFA 4NDRA 3T7BA 2BRXA 4NDOA 3ZZHA 2CDQA 4USJA 4NDQA 2BNFA 2JJ4A 4NDRB 1E19A 4NDPA 4NDOB 3QURA 2IJ9A 2J0WA 4NDQB 1YBDA 2JJXA 2OGXA 2J0XA 3D2PA 1B7BA 4AB7A 1OHBA 3K4YA 3WWNA 3S6GA 3LKKA 3L86A 3LL9A 2WE4A 2BNDA 3D41A 2V4YA 2RD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W21 A;  3S6K A;  4KZT A;  2BRI A;  1GS5 A;  3QUO A;  3ZZG A;  4OLC A;  3QVF A;  3S6H A;  2J5V A;  4AXS A;  3QUN A;  2WE5 A;  2R98 A;  4JZ8 A;  1OHA A;  2WXB A;  3AAW A;  3ZZI A;  4NDP B;  4F6T A;  2BMU A;  1GSJ A;  3QVH A;  4JZ9 A;  3C1M A;  2AKO A;  2OGX B;  3EK6 A;  3NWY A;  3C20 A;  3AB2 A;  4F6T B;  3WWM A;  3KZF A;  3TVI A;  2E9Y A;  3K4O A;  3C1N A;  4Q1T A;  2J5T A;  2R8V A;  2HMF A;  2VA1 A;  4I49 A;  3LL5 A;  1Z9D A;  2V5H A;  2JI5 A;  3D40 A;  3K56 A;  3U6U A;  3D2M A;  2J4K A;  2X2W A;  2J4L A;  2AP9 A;  3K52 A;  2J4J A;  3ZZF A;  3B8G A;  4A7W A;  1OH9 A;  4A7X A;  2BTY A;  4JZ7 A;  2A1F A;  3L76 A;  3EK5 A;  2BNE A;  3AB4 A;  2BUF A;  4NDR A;  3T7B A;  2BRX A;  4NDO A;  3ZZH A;  2CDQ A;  4USJ A;  4NDQ A;  2BNF A;  2JJ4 A;  4NDR B;  1E19 A;  4NDP A;  4NDO B;  3QUR A;  2IJ9 A;  2J0W A;  4NDQ B;  1YBD A;  2JJX A;  2OGX A;  2J0X A;  3D2P A;  1B7B A;  4AB7 A;  1OHB A;  3K4Y A;  3WWN A;  3S6G A;  3LKK A;  3L86 A;  3LL9 A;  2WE4 A;  2BND A;  3D41 A;  2V4Y A;  2RD5 A; 
#chains in the Genus database with same CATH topology
 2W21 A;  3S6K A;  4KZT A;  2BRI A;  1GS5 A;  3QUO A;  3ZZG A;  4OLC A;  3QVF A;  3S6H A;  2J5V A;  4AXS A;  3QUN A;  2WE5 A;  2R98 A;  4JZ8 A;  1OHA A;  2WXB A;  3AAW A;  3ZZI A;  4NDP B;  4F6T A;  2BMU A;  1GSJ A;  3QVH A;  4JZ9 A;  3C1M A;  2AKO A;  2OGX B;  3EK6 A;  3NWY A;  3C20 A;  3AB2 A;  4F6T B;  3WWM A;  3KZF A;  3TVI A;  2E9Y A;  3K4O A;  3C1N A;  4Q1T A;  2J5T A;  2R8V A;  2HMF A;  2VA1 A;  4I49 A;  3LL5 A;  1Z9D A;  2V5H A;  2JI5 A;  3D40 A;  3K56 A;  3U6U A;  3D2M A;  2J4K A;  2X2W A;  2J4L A;  2AP9 A;  3K52 A;  2J4J A;  3ZZF A;  3B8G A;  4A7W A;  1OH9 A;  4A7X A;  2BTY A;  4JZ7 A;  2A1F A;  3L76 A;  3EK5 A;  2BNE A;  3AB4 A;  2BUF A;  4NDR A;  3T7B A;  2BRX A;  4NDO A;  3ZZH A;  2CDQ A;  4USJ A;  4NDQ A;  2BNF A;  2JJ4 A;  4NDR B;  1E19 A;  4NDP A;  4NDO B;  3QUR A;  2IJ9 A;  2J0W A;  4NDQ B;  1YBD A;  2JJX A;  2OGX A;  2J0X A;  3D2P A;  1B7B A;  4AB7 A;  1OHB A;  3K4Y A;  3WWN A;  3S6G A;  3LKK A;  3L86 A;  3LL9 A;  2WE4 A;  2BND A;  3D41 A;  2V4Y A;  2RD5 A; 
#chains in the Genus database with same CATH homology
 2W21 A;  3S6K A;  4KZT A;  2BRI A;  1GS5 A;  3QUO A;  3ZZG A;  4OLC A;  3QVF A;  3S6H A;  2J5V A;  4AXS A;  3QUN A;  2WE5 A;  2R98 A;  4JZ8 A;  1OHA A;  2WXB A;  3AAW A;  3ZZI A;  4NDP B;  4F6T A;  2BMU A;  1GSJ A;  3QVH A;  4JZ9 A;  3C1M A;  2AKO A;  2OGX B;  3EK6 A;  3NWY A;  3C20 A;  3AB2 A;  4F6T B;  3WWM A;  3KZF A;  3TVI A;  2E9Y A;  3K4O A;  3C1N A;  4Q1T A;  2J5T A;  2R8V A;  2HMF A;  2VA1 A;  4I49 A;  3LL5 A;  1Z9D A;  2V5H A;  2JI5 A;  3D40 A;  3K56 A;  3U6U A;  3D2M A;  2J4K A;  2X2W A;  2J4L A;  2AP9 A;  3K52 A;  2J4J A;  3ZZF A;  3B8G A;  4A7W A;  1OH9 A;  4A7X A;  2BTY A;  4JZ7 A;  2A1F A;  3L76 A;  3EK5 A;  2BNE A;  3AB4 A;  2BUF A;  4NDR A;  3T7B A;  2BRX A;  4NDO A;  3ZZH A;  2CDQ A;  4USJ A;  4NDQ A;  2BNF A;  2JJ4 A;  4NDR B;  1E19 A;  4NDP A;  4NDO B;  3QUR A;  2IJ9 A;  2J0W A;  4NDQ B;  1YBD A;  2JJX A;  2OGX A;  2J0X A;  3D2P A;  1B7B A;  4AB7 A;  1OHB A;  3K4Y A;  3WWN A;  3S6G A;  3LKK A;  3L86 A;  3LL9 A;  2WE4 A;  2BND A;  3D41 A;  2V4Y A;  2RD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...