4A7XA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIRGVSAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7xA00
3ZZGA 4JZ9A 3S6GA 2J4LA 4USJA 2BRIA 2J0XA 2CDQA 2JJXA 3C1MA 2X2WA 2RD5A 3AB2A 1OH9A 4Q1TA 3ZZIA 1Z9DA 3K4YA 3S6KA 4F6TA 4F6TB 4NDRA 3ZZHA 2AKOA 4I49A 4OLCA 2J0WA 3QUOA 2V5HA 2JJ4A 4A7WA 3K4OA 4NDOB 4NDQA 2BMUA 1GS5A 2HMFA 3K56A 3LKKA 2R98A 4JZ8A 2J5VA 3T7BA 1B7BA 2JI5A 1GSJA 2BNDA 3QVFA 3C20A 2BUFA 3K52A 3QVHA 3S6HA 3WWNA 2E9YA 3C1NA 1E19A 3QURA 3TVIA 3B8GA 3L76A 3WWMA 2J4JA 3EK6A 4NDPA 3ZZFA 3U6UA 4AB7A 1OHAA 3KZFA 4AXSA 4NDRB 3LL5A 1YBDA 2VA1A 3QUNA 3AAWA 2BRXA 2W21A 2IJ9A 2A1FA 3D40A 2WXBA 3AB4A 2BNEA 2OGXB 3NWYA 2V4YA 2BTYA 1OHBA 4NDQB 3D2MA 2WE5A 2WE4A 4NDOA 3L86A 4A7XA 2R8VA 2BNFA 4NDPB 4JZ7A 3EK5A 2AP9A 2J4KA 2J5TA 3D2PA 4KZTA 3LL9A 3D41A 2OGXA
chains in the Genus database with same CATH superfamily
3ZZGA 4JZ9A 3S6GA 2J4LA 4USJA 2BRIA 2J0XA 2CDQA 2JJXA 3C1MA 2X2WA 2RD5A 3AB2A 1OH9A 4Q1TA 3ZZIA 1Z9DA 3K4YA 3S6KA 4F6TA 4F6TB 4NDRA 3ZZHA 2AKOA 4I49A 4OLCA 2J0WA 3QUOA 2V5HA 2JJ4A 4A7WA 3K4OA 4NDOB 4NDQA 2BMUA 1GS5A 2HMFA 3K56A 3LKKA 2R98A 4JZ8A 2J5VA 3T7BA 1B7BA 2JI5A 1GSJA 2BNDA 3QVFA 3C20A 2BUFA 3K52A 3QVHA 3S6HA 3WWNA 2E9YA 3C1NA 1E19A 3QURA 3TVIA 3B8GA 3L76A 3WWMA 2J4JA 3EK6A 4NDPA 3ZZFA 3U6UA 4AB7A 1OHAA 3KZFA 4AXSA 4NDRB 3LL5A 1YBDA 2VA1A 3QUNA 3AAWA 2BRXA 2W21A 2IJ9A 2A1FA 3D40A 2WXBA 3AB4A 2BNEA 2OGXB 3NWYA 2V4YA 2BTYA 1OHBA 4NDQB 3D2MA 2WE5A 2WE4A 4NDOA 3L86A 4A7XA 2R8VA 2BNFA 4NDPB 4JZ7A 3EK5A 2AP9A 2J4KA 2J5TA 3D2PA 4KZTA 3LL9A 3D41A 2OGXA
chains in the Genus database with same CATH topology
3ZZGA 4JZ9A 3S6GA 2J4LA 4USJA 2BRIA 2J0XA 2CDQA 2JJXA 3C1MA 2X2WA 2RD5A 3AB2A 1OH9A 4Q1TA 3ZZIA 1Z9DA 3K4YA 3S6KA 4F6TA 4F6TB 4NDRA 3ZZHA 2AKOA 4I49A 4OLCA 2J0WA 3QUOA 2V5HA 2JJ4A 4A7WA 3K4OA 4NDOB 4NDQA 2BMUA 1GS5A 2HMFA 3K56A 3LKKA 2R98A 4JZ8A 2J5VA 3T7BA 1B7BA 2JI5A 1GSJA 2BNDA 3QVFA 3C20A 2BUFA 3K52A 3QVHA 3S6HA 3WWNA 2E9YA 3C1NA 1E19A 3QURA 3TVIA 3B8GA 3L76A 3WWMA 2J4JA 3EK6A 4NDPA 3ZZFA 3U6UA 4AB7A 1OHAA 3KZFA 4AXSA 4NDRB 3LL5A 1YBDA 2VA1A 3QUNA 3AAWA 2BRXA 2W21A 2IJ9A 2A1FA 3D40A 2WXBA 3AB4A 2BNEA 2OGXB 3NWYA 2V4YA 2BTYA 1OHBA 4NDQB 3D2MA 2WE5A 2WE4A 4NDOA 3L86A 4A7XA 2R8VA 2BNFA 4NDPB 4JZ7A 3EK5A 2AP9A 2J4KA 2J5TA 3D2PA 4KZTA 3LL9A 3D41A 2OGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZG A;  4JZ9 A;  3S6G A;  2J4L A;  4USJ A;  2BRI A;  2J0X A;  2CDQ A;  2JJX A;  3C1M A;  2X2W A;  2RD5 A;  3AB2 A;  1OH9 A;  4Q1T A;  3ZZI A;  1Z9D A;  3K4Y A;  3S6K A;  4F6T A;  4F6T B;  4NDR A;  3ZZH A;  2AKO A;  4I49 A;  4OLC A;  2J0W A;  3QUO A;  2V5H A;  2JJ4 A;  4A7W A;  3K4O A;  4NDO B;  4NDQ A;  2BMU A;  1GS5 A;  2HMF A;  3K56 A;  3LKK A;  2R98 A;  4JZ8 A;  2J5V A;  3T7B A;  1B7B A;  2JI5 A;  1GSJ A;  2BND A;  3QVF A;  3C20 A;  2BUF A;  3K52 A;  3QVH A;  3S6H A;  3WWN A;  2E9Y A;  3C1N A;  1E19 A;  3QUR A;  3TVI A;  3B8G A;  3L76 A;  3WWM A;  2J4J A;  3EK6 A;  4NDP A;  3ZZF A;  3U6U A;  4AB7 A;  1OHA A;  3KZF A;  4AXS A;  4NDR B;  3LL5 A;  1YBD A;  2VA1 A;  3QUN A;  3AAW A;  2BRX A;  2W21 A;  2IJ9 A;  2A1F A;  3D40 A;  2WXB A;  3AB4 A;  2BNE A;  2OGX B;  3NWY A;  2V4Y A;  2BTY A;  1OHB A;  4NDQ B;  3D2M A;  2WE5 A;  2WE4 A;  4NDO A;  3L86 A;  4A7X A;  2R8V A;  2BNF A;  4NDP B;  4JZ7 A;  3EK5 A;  2AP9 A;  2J4K A;  2J5T A;  3D2P A;  4KZT A;  3LL9 A;  3D41 A;  2OGX A; 
#chains in the Genus database with same CATH topology
 3ZZG A;  4JZ9 A;  3S6G A;  2J4L A;  4USJ A;  2BRI A;  2J0X A;  2CDQ A;  2JJX A;  3C1M A;  2X2W A;  2RD5 A;  3AB2 A;  1OH9 A;  4Q1T A;  3ZZI A;  1Z9D A;  3K4Y A;  3S6K A;  4F6T A;  4F6T B;  4NDR A;  3ZZH A;  2AKO A;  4I49 A;  4OLC A;  2J0W A;  3QUO A;  2V5H A;  2JJ4 A;  4A7W A;  3K4O A;  4NDO B;  4NDQ A;  2BMU A;  1GS5 A;  2HMF A;  3K56 A;  3LKK A;  2R98 A;  4JZ8 A;  2J5V A;  3T7B A;  1B7B A;  2JI5 A;  1GSJ A;  2BND A;  3QVF A;  3C20 A;  2BUF A;  3K52 A;  3QVH A;  3S6H A;  3WWN A;  2E9Y A;  3C1N A;  1E19 A;  3QUR A;  3TVI A;  3B8G A;  3L76 A;  3WWM A;  2J4J A;  3EK6 A;  4NDP A;  3ZZF A;  3U6U A;  4AB7 A;  1OHA A;  3KZF A;  4AXS A;  4NDR B;  3LL5 A;  1YBD A;  2VA1 A;  3QUN A;  3AAW A;  2BRX A;  2W21 A;  2IJ9 A;  2A1F A;  3D40 A;  2WXB A;  3AB4 A;  2BNE A;  2OGX B;  3NWY A;  2V4Y A;  2BTY A;  1OHB A;  4NDQ B;  3D2M A;  2WE5 A;  2WE4 A;  4NDO A;  3L86 A;  4A7X A;  2R8V A;  2BNF A;  4NDP B;  4JZ7 A;  3EK5 A;  2AP9 A;  2J4K A;  2J5T A;  3D2P A;  4KZT A;  3LL9 A;  3D41 A;  2OGX A; 
#chains in the Genus database with same CATH homology
 3ZZG A;  4JZ9 A;  3S6G A;  2J4L A;  4USJ A;  2BRI A;  2J0X A;  2CDQ A;  2JJX A;  3C1M A;  2X2W A;  2RD5 A;  3AB2 A;  1OH9 A;  4Q1T A;  3ZZI A;  1Z9D A;  3K4Y A;  3S6K A;  4F6T A;  4F6T B;  4NDR A;  3ZZH A;  2AKO A;  4I49 A;  4OLC A;  2J0W A;  3QUO A;  2V5H A;  2JJ4 A;  4A7W A;  3K4O A;  4NDO B;  4NDQ A;  2BMU A;  1GS5 A;  2HMF A;  3K56 A;  3LKK A;  2R98 A;  4JZ8 A;  2J5V A;  3T7B A;  1B7B A;  2JI5 A;  1GSJ A;  2BND A;  3QVF A;  3C20 A;  2BUF A;  3K52 A;  3QVH A;  3S6H A;  3WWN A;  2E9Y A;  3C1N A;  1E19 A;  3QUR A;  3TVI A;  3B8G A;  3L76 A;  3WWM A;  2J4J A;  3EK6 A;  4NDP A;  3ZZF A;  3U6U A;  4AB7 A;  1OHA A;  3KZF A;  4AXS A;  4NDR B;  3LL5 A;  1YBD A;  2VA1 A;  3QUN A;  3AAW A;  2BRX A;  2W21 A;  2IJ9 A;  2A1F A;  3D40 A;  2WXB A;  3AB4 A;  2BNE A;  2OGX B;  3NWY A;  2V4Y A;  2BTY A;  1OHB A;  4NDQ B;  3D2M A;  2WE5 A;  2WE4 A;  4NDO A;  3L86 A;  4A7X A;  2R8V A;  2BNF A;  4NDP B;  4JZ7 A;  3EK5 A;  2AP9 A;  2J4K A;  2J5T A;  3D2P A;  4KZT A;  3LL9 A;  3D41 A;  2OGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...