4A7XA

Crystal structure of uridylate kinase from helicobacter pylori
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
234
structure length
234
Chain Sequence
NKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVENDIEVGIVIGGGNIIRGVSAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTRVQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLIIKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCNMFKKGNLLQVIKHQQGVFSMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Helicobacter Pylori Uridylate Kinase: Insight Into Release of the Product Udp
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 77
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2011-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4a7xA00
2X2WA 3QVHA 3C1MA 3LL5A 4KZTA 2BNDA 2V5HA 4A7WA 2R8VA 3QUOA 4NDOA 3K4OA 3S6KA 1OH9A 3L76A 2J4KA 3WWNA 4NDQB 4JZ9A 3S6HA 2BRIA 3QVFA 4JZ7A 4JZ8A 1GS5A 2J5TA 3D40A 3S6GA 4NDRB 2IJ9A 3D2PA 3WWMA 3AB2A 2A1FA 2WE4A 1E19A 2J5VA 2BNFA 1YBDA 3C1NA 3AAWA 4USJA 2J4LA 2WE5A 3T7BA 3K4YA 4A7XA 4Q1TA 4AB7A 3KZFA 4NDRA 2OGXB 3EK6A 4F6TB 2BTYA 4NDPA 3QURA 4AXSA 1OHBA 2HMFA 3ZZHA 3TVIA 3L86A 2BUFA 2W21A 4NDOB 3AB4A 3LKKA 2E9YA 4OLCA 2WXBA 3B8GA 2JJXA 3QUNA 2VA1A 1GSJA 2BMUA 3LL9A 2BRXA 1OHAA 4F6TA 2AKOA 3ZZIA 3C20A 3K52A 1Z9DA 2CDQA 4NDQA 1B7BA 2OGXA 2RD5A 3D2MA 3ZZFA 2JJ4A 2V4YA 2J0XA 3NWYA 2AP9A 2J0WA 3U6UA 2R98A 3EK5A 3D41A 3K56A 2JI5A 4I49A 3ZZGA 2J4JA 2BNEA 4NDPB
chains in the Genus database with same CATH superfamily
2X2WA 3QVHA 3C1MA 3LL5A 4KZTA 2BNDA 2V5HA 4A7WA 2R8VA 3QUOA 4NDOA 3K4OA 3S6KA 1OH9A 3L76A 2J4KA 3WWNA 4NDQB 4JZ9A 3S6HA 2BRIA 3QVFA 4JZ7A 4JZ8A 1GS5A 2J5TA 3D40A 3S6GA 4NDRB 2IJ9A 3D2PA 3WWMA 3AB2A 2A1FA 2WE4A 1E19A 2J5VA 2BNFA 1YBDA 3C1NA 3AAWA 4USJA 2J4LA 2WE5A 3T7BA 3K4YA 4A7XA 4Q1TA 4AB7A 3KZFA 4NDRA 2OGXB 3EK6A 4F6TB 2BTYA 4NDPA 3QURA 4AXSA 1OHBA 2HMFA 3ZZHA 3TVIA 3L86A 2BUFA 2W21A 4NDOB 3AB4A 3LKKA 2E9YA 4OLCA 2WXBA 3B8GA 2JJXA 3QUNA 2VA1A 1GSJA 2BMUA 3LL9A 2BRXA 1OHAA 4F6TA 2AKOA 3ZZIA 3C20A 3K52A 1Z9DA 2CDQA 4NDQA 1B7BA 2OGXA 2RD5A 3D2MA 3ZZFA 2JJ4A 2V4YA 2J0XA 3NWYA 2AP9A 2J0WA 3U6UA 2R98A 3EK5A 3D41A 3K56A 2JI5A 4I49A 3ZZGA 2J4JA 2BNEA 4NDPB
chains in the Genus database with same CATH topology
2X2WA 3QVHA 3C1MA 3LL5A 4KZTA 2BNDA 2V5HA 4A7WA 2R8VA 3QUOA 4NDOA 3K4OA 3S6KA 1OH9A 3L76A 2J4KA 3WWNA 4NDQB 4JZ9A 3S6HA 2BRIA 3QVFA 4JZ7A 4JZ8A 1GS5A 2J5TA 3D40A 3S6GA 4NDRB 2IJ9A 3D2PA 3WWMA 3AB2A 2A1FA 2WE4A 1E19A 2J5VA 2BNFA 1YBDA 3C1NA 3AAWA 4USJA 2J4LA 2WE5A 3T7BA 3K4YA 4A7XA 4Q1TA 4AB7A 3KZFA 4NDRA 2OGXB 3EK6A 4F6TB 2BTYA 4NDPA 3QURA 4AXSA 1OHBA 2HMFA 3ZZHA 3TVIA 3L86A 2BUFA 2W21A 4NDOB 3AB4A 3LKKA 2E9YA 4OLCA 2WXBA 3B8GA 2JJXA 3QUNA 2VA1A 1GSJA 2BMUA 3LL9A 2BRXA 1OHAA 4F6TA 2AKOA 3ZZIA 3C20A 3K52A 1Z9DA 2CDQA 4NDQA 1B7BA 2OGXA 2RD5A 3D2MA 3ZZFA 2JJ4A 2V4YA 2J0XA 3NWYA 2AP9A 2J0WA 3U6UA 2R98A 3EK5A 3D41A 3K56A 2JI5A 4I49A 3ZZGA 2J4JA 2BNEA 4NDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2W A;  3QVH A;  3C1M A;  3LL5 A;  4KZT A;  2BND A;  2V5H A;  4A7W A;  2R8V A;  3QUO A;  4NDO A;  3K4O A;  3S6K A;  1OH9 A;  3L76 A;  2J4K A;  3WWN A;  4NDQ B;  4JZ9 A;  3S6H A;  2BRI A;  3QVF A;  4JZ7 A;  4JZ8 A;  1GS5 A;  2J5T A;  3D40 A;  3S6G A;  4NDR B;  2IJ9 A;  3D2P A;  3WWM A;  3AB2 A;  2A1F A;  2WE4 A;  1E19 A;  2J5V A;  2BNF A;  1YBD A;  3C1N A;  3AAW A;  4USJ A;  2J4L A;  2WE5 A;  3T7B A;  3K4Y A;  4A7X A;  4Q1T A;  4AB7 A;  3KZF A;  4NDR A;  2OGX B;  3EK6 A;  4F6T B;  2BTY A;  4NDP A;  3QUR A;  4AXS A;  1OHB A;  2HMF A;  3ZZH A;  3TVI A;  3L86 A;  2BUF A;  2W21 A;  4NDO B;  3AB4 A;  3LKK A;  2E9Y A;  4OLC A;  2WXB A;  3B8G A;  2JJX A;  3QUN A;  2VA1 A;  1GSJ A;  2BMU A;  3LL9 A;  2BRX A;  1OHA A;  4F6T A;  2AKO A;  3ZZI A;  3C20 A;  3K52 A;  1Z9D A;  2CDQ A;  4NDQ A;  1B7B A;  2OGX A;  2RD5 A;  3D2M A;  3ZZF A;  2JJ4 A;  2V4Y A;  2J0X A;  3NWY A;  2AP9 A;  2J0W A;  3U6U A;  2R98 A;  3EK5 A;  3D41 A;  3K56 A;  2JI5 A;  4I49 A;  3ZZG A;  2J4J A;  2BNE A;  4NDP B; 
#chains in the Genus database with same CATH topology
 2X2W A;  3QVH A;  3C1M A;  3LL5 A;  4KZT A;  2BND A;  2V5H A;  4A7W A;  2R8V A;  3QUO A;  4NDO A;  3K4O A;  3S6K A;  1OH9 A;  3L76 A;  2J4K A;  3WWN A;  4NDQ B;  4JZ9 A;  3S6H A;  2BRI A;  3QVF A;  4JZ7 A;  4JZ8 A;  1GS5 A;  2J5T A;  3D40 A;  3S6G A;  4NDR B;  2IJ9 A;  3D2P A;  3WWM A;  3AB2 A;  2A1F A;  2WE4 A;  1E19 A;  2J5V A;  2BNF A;  1YBD A;  3C1N A;  3AAW A;  4USJ A;  2J4L A;  2WE5 A;  3T7B A;  3K4Y A;  4A7X A;  4Q1T A;  4AB7 A;  3KZF A;  4NDR A;  2OGX B;  3EK6 A;  4F6T B;  2BTY A;  4NDP A;  3QUR A;  4AXS A;  1OHB A;  2HMF A;  3ZZH A;  3TVI A;  3L86 A;  2BUF A;  2W21 A;  4NDO B;  3AB4 A;  3LKK A;  2E9Y A;  4OLC A;  2WXB A;  3B8G A;  2JJX A;  3QUN A;  2VA1 A;  1GSJ A;  2BMU A;  3LL9 A;  2BRX A;  1OHA A;  4F6T A;  2AKO A;  3ZZI A;  3C20 A;  3K52 A;  1Z9D A;  2CDQ A;  4NDQ A;  1B7B A;  2OGX A;  2RD5 A;  3D2M A;  3ZZF A;  2JJ4 A;  2V4Y A;  2J0X A;  3NWY A;  2AP9 A;  2J0W A;  3U6U A;  2R98 A;  3EK5 A;  3D41 A;  3K56 A;  2JI5 A;  4I49 A;  3ZZG A;  2J4J A;  2BNE A;  4NDP B; 
#chains in the Genus database with same CATH homology
 2X2W A;  3QVH A;  3C1M A;  3LL5 A;  4KZT A;  2BND A;  2V5H A;  4A7W A;  2R8V A;  3QUO A;  4NDO A;  3K4O A;  3S6K A;  1OH9 A;  3L76 A;  2J4K A;  3WWN A;  4NDQ B;  4JZ9 A;  3S6H A;  2BRI A;  3QVF A;  4JZ7 A;  4JZ8 A;  1GS5 A;  2J5T A;  3D40 A;  3S6G A;  4NDR B;  2IJ9 A;  3D2P A;  3WWM A;  3AB2 A;  2A1F A;  2WE4 A;  1E19 A;  2J5V A;  2BNF A;  1YBD A;  3C1N A;  3AAW A;  4USJ A;  2J4L A;  2WE5 A;  3T7B A;  3K4Y A;  4A7X A;  4Q1T A;  4AB7 A;  3KZF A;  4NDR A;  2OGX B;  3EK6 A;  4F6T B;  2BTY A;  4NDP A;  3QUR A;  4AXS A;  1OHB A;  2HMF A;  3ZZH A;  3TVI A;  3L86 A;  2BUF A;  2W21 A;  4NDO B;  3AB4 A;  3LKK A;  2E9Y A;  4OLC A;  2WXB A;  3B8G A;  2JJX A;  3QUN A;  2VA1 A;  1GSJ A;  2BMU A;  3LL9 A;  2BRX A;  1OHA A;  4F6T A;  2AKO A;  3ZZI A;  3C20 A;  3K52 A;  1Z9D A;  2CDQ A;  4NDQ A;  1B7B A;  2OGX A;  2RD5 A;  3D2M A;  3ZZF A;  2JJ4 A;  2V4Y A;  2J0X A;  3NWY A;  2AP9 A;  2J0W A;  3U6U A;  2R98 A;  3EK5 A;  3D41 A;  3K56 A;  2JI5 A;  4I49 A;  3ZZG A;  2J4J A;  2BNE A;  4NDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...