2BNDA

The structure of e. coli ump kinase in complex with udp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bndA00
3KZFA 2AKOA 2BNEA 2VA1A 3K56A 3ZZHA 3K4YA 3S6HA 4AXSA 4NDPA 2A1FA 2JI5A 4JZ9A 4OLCA 2BRXA 4KZTA 1Z9DA 3AB2A 4NDQA 2WE5A 3K4OA 2J5VA 3C1NA 4NDPB 3WWNA 4AB7A 2R8VA 2WE4A 3K52A 1GS5A 2R98A 3LKKA 2WXBA 3U6UA 3S6GA 1B7BA 2BMUA 2BUFA 2V4YA 3ZZGA 2BNDA 3NWYA 4USJA 1OHBA 1GSJA 3L86A 2J0XA 2W21A 3EK5A 4NDOA 2OGXB 2J0WA 2JJ4A 3LL9A 4A7WA 2J4LA 3AAWA 2HMFA 4Q1TA 4JZ8A 3ZZFA 2CDQA 3QVHA 2J5TA 3C20A 3L76A 4NDOB 3AB4A 3D2PA 2BNFA 4F6TB 1OH9A 3D40A 2BRIA 3D41A 3EK6A 2OGXA 3QVFA 3C1MA 2AP9A 3B8GA 2J4KA 2BTYA 2E9YA 3D2MA 1YBDA 4F6TA 3QUNA 2X2WA 2RD5A 3QUOA 4I49A 3QURA 4NDRA 3T7BA 2IJ9A 2V5HA 3TVIA 2J4JA 2JJXA 3S6KA 4A7XA 4NDRB 1E19A 3ZZIA 4JZ7A 1OHAA 3LL5A 4NDQB 3WWMA
chains in the Genus database with same CATH superfamily
3KZFA 2AKOA 2BNEA 2VA1A 3K56A 3ZZHA 3K4YA 3S6HA 4AXSA 4NDPA 2A1FA 2JI5A 4JZ9A 4OLCA 2BRXA 4KZTA 1Z9DA 3AB2A 4NDQA 2WE5A 3K4OA 2J5VA 3C1NA 4NDPB 3WWNA 4AB7A 2R8VA 2WE4A 3K52A 1GS5A 2R98A 3LKKA 2WXBA 3U6UA 3S6GA 1B7BA 2BMUA 2BUFA 2V4YA 3ZZGA 2BNDA 3NWYA 4USJA 1OHBA 1GSJA 3L86A 2J0XA 2W21A 3EK5A 4NDOA 2OGXB 2J0WA 2JJ4A 3LL9A 4A7WA 2J4LA 3AAWA 2HMFA 4Q1TA 4JZ8A 3ZZFA 2CDQA 3QVHA 2J5TA 3C20A 3L76A 4NDOB 3AB4A 3D2PA 2BNFA 4F6TB 1OH9A 3D40A 2BRIA 3D41A 3EK6A 2OGXA 3QVFA 3C1MA 2AP9A 3B8GA 2J4KA 2BTYA 2E9YA 3D2MA 1YBDA 4F6TA 3QUNA 2X2WA 2RD5A 3QUOA 4I49A 3QURA 4NDRA 3T7BA 2IJ9A 2V5HA 3TVIA 2J4JA 2JJXA 3S6KA 4A7XA 4NDRB 1E19A 3ZZIA 4JZ7A 1OHAA 3LL5A 4NDQB 3WWMA
chains in the Genus database with same CATH topology
3KZFA 2AKOA 2BNEA 2VA1A 3K56A 3ZZHA 3K4YA 3S6HA 4AXSA 4NDPA 2A1FA 2JI5A 4JZ9A 4OLCA 2BRXA 4KZTA 1Z9DA 3AB2A 4NDQA 2WE5A 3K4OA 2J5VA 3C1NA 4NDPB 3WWNA 4AB7A 2R8VA 2WE4A 3K52A 1GS5A 2R98A 3LKKA 2WXBA 3U6UA 3S6GA 1B7BA 2BMUA 2BUFA 2V4YA 3ZZGA 2BNDA 3NWYA 4USJA 1OHBA 1GSJA 3L86A 2J0XA 2W21A 3EK5A 4NDOA 2OGXB 2J0WA 2JJ4A 3LL9A 4A7WA 2J4LA 3AAWA 2HMFA 4Q1TA 4JZ8A 3ZZFA 2CDQA 3QVHA 2J5TA 3C20A 3L76A 4NDOB 3AB4A 3D2PA 2BNFA 4F6TB 1OH9A 3D40A 2BRIA 3D41A 3EK6A 2OGXA 3QVFA 3C1MA 2AP9A 3B8GA 2J4KA 2BTYA 2E9YA 3D2MA 1YBDA 4F6TA 3QUNA 2X2WA 2RD5A 3QUOA 4I49A 3QURA 4NDRA 3T7BA 2IJ9A 2V5HA 3TVIA 2J4JA 2JJXA 3S6KA 4A7XA 4NDRB 1E19A 3ZZIA 4JZ7A 1OHAA 3LL5A 4NDQB 3WWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZF A;  2AKO A;  2BNE A;  2VA1 A;  3K56 A;  3ZZH A;  3K4Y A;  3S6H A;  4AXS A;  4NDP A;  2A1F A;  2JI5 A;  4JZ9 A;  4OLC A;  2BRX A;  4KZT A;  1Z9D A;  3AB2 A;  4NDQ A;  2WE5 A;  3K4O A;  2J5V A;  3C1N A;  4NDP B;  3WWN A;  4AB7 A;  2R8V A;  2WE4 A;  3K52 A;  1GS5 A;  2R98 A;  3LKK A;  2WXB A;  3U6U A;  3S6G A;  1B7B A;  2BMU A;  2BUF A;  2V4Y A;  3ZZG A;  2BND A;  3NWY A;  4USJ A;  1OHB A;  1GSJ A;  3L86 A;  2J0X A;  2W21 A;  3EK5 A;  4NDO A;  2OGX B;  2J0W A;  2JJ4 A;  3LL9 A;  4A7W A;  2J4L A;  3AAW A;  2HMF A;  4Q1T A;  4JZ8 A;  3ZZF A;  2CDQ A;  3QVH A;  2J5T A;  3C20 A;  3L76 A;  4NDO B;  3AB4 A;  3D2P A;  2BNF A;  4F6T B;  1OH9 A;  3D40 A;  2BRI A;  3D41 A;  3EK6 A;  2OGX A;  3QVF A;  3C1M A;  2AP9 A;  3B8G A;  2J4K A;  2BTY A;  2E9Y A;  3D2M A;  1YBD A;  4F6T A;  3QUN A;  2X2W A;  2RD5 A;  3QUO A;  4I49 A;  3QUR A;  4NDR A;  3T7B A;  2IJ9 A;  2V5H A;  3TVI A;  2J4J A;  2JJX A;  3S6K A;  4A7X A;  4NDR B;  1E19 A;  3ZZI A;  4JZ7 A;  1OHA A;  3LL5 A;  4NDQ B;  3WWM A; 
#chains in the Genus database with same CATH topology
 3KZF A;  2AKO A;  2BNE A;  2VA1 A;  3K56 A;  3ZZH A;  3K4Y A;  3S6H A;  4AXS A;  4NDP A;  2A1F A;  2JI5 A;  4JZ9 A;  4OLC A;  2BRX A;  4KZT A;  1Z9D A;  3AB2 A;  4NDQ A;  2WE5 A;  3K4O A;  2J5V A;  3C1N A;  4NDP B;  3WWN A;  4AB7 A;  2R8V A;  2WE4 A;  3K52 A;  1GS5 A;  2R98 A;  3LKK A;  2WXB A;  3U6U A;  3S6G A;  1B7B A;  2BMU A;  2BUF A;  2V4Y A;  3ZZG A;  2BND A;  3NWY A;  4USJ A;  1OHB A;  1GSJ A;  3L86 A;  2J0X A;  2W21 A;  3EK5 A;  4NDO A;  2OGX B;  2J0W A;  2JJ4 A;  3LL9 A;  4A7W A;  2J4L A;  3AAW A;  2HMF A;  4Q1T A;  4JZ8 A;  3ZZF A;  2CDQ A;  3QVH A;  2J5T A;  3C20 A;  3L76 A;  4NDO B;  3AB4 A;  3D2P A;  2BNF A;  4F6T B;  1OH9 A;  3D40 A;  2BRI A;  3D41 A;  3EK6 A;  2OGX A;  3QVF A;  3C1M A;  2AP9 A;  3B8G A;  2J4K A;  2BTY A;  2E9Y A;  3D2M A;  1YBD A;  4F6T A;  3QUN A;  2X2W A;  2RD5 A;  3QUO A;  4I49 A;  3QUR A;  4NDR A;  3T7B A;  2IJ9 A;  2V5H A;  3TVI A;  2J4J A;  2JJX A;  3S6K A;  4A7X A;  4NDR B;  1E19 A;  3ZZI A;  4JZ7 A;  1OHA A;  3LL5 A;  4NDQ B;  3WWM A; 
#chains in the Genus database with same CATH homology
 3KZF A;  2AKO A;  2BNE A;  2VA1 A;  3K56 A;  3ZZH A;  3K4Y A;  3S6H A;  4AXS A;  4NDP A;  2A1F A;  2JI5 A;  4JZ9 A;  4OLC A;  2BRX A;  4KZT A;  1Z9D A;  3AB2 A;  4NDQ A;  2WE5 A;  3K4O A;  2J5V A;  3C1N A;  4NDP B;  3WWN A;  4AB7 A;  2R8V A;  2WE4 A;  3K52 A;  1GS5 A;  2R98 A;  3LKK A;  2WXB A;  3U6U A;  3S6G A;  1B7B A;  2BMU A;  2BUF A;  2V4Y A;  3ZZG A;  2BND A;  3NWY A;  4USJ A;  1OHB A;  1GSJ A;  3L86 A;  2J0X A;  2W21 A;  3EK5 A;  4NDO A;  2OGX B;  2J0W A;  2JJ4 A;  3LL9 A;  4A7W A;  2J4L A;  3AAW A;  2HMF A;  4Q1T A;  4JZ8 A;  3ZZF A;  2CDQ A;  3QVH A;  2J5T A;  3C20 A;  3L76 A;  4NDO B;  3AB4 A;  3D2P A;  2BNF A;  4F6T B;  1OH9 A;  3D40 A;  2BRI A;  3D41 A;  3EK6 A;  2OGX A;  3QVF A;  3C1M A;  2AP9 A;  3B8G A;  2J4K A;  2BTY A;  2E9Y A;  3D2M A;  1YBD A;  4F6T A;  3QUN A;  2X2W A;  2RD5 A;  3QUO A;  4I49 A;  3QUR A;  4NDR A;  3T7B A;  2IJ9 A;  2V5H A;  3TVI A;  2J4J A;  2JJX A;  3S6K A;  4A7X A;  4NDR B;  1E19 A;  3ZZI A;  4JZ7 A;  1OHA A;  3LL5 A;  4NDQ B;  3WWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...