2BNDA

The structure of e. coli ump kinase in complex with udp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
b'AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bndA00
3LKKA 3D2PA 4Q1TA 2J5VA 2WE4A 3L76A 2X2WA 3AB4A 2BMUA 3AB2A 3EK6A 3K52A 4NDRB 3TVIA 3L86A 4NDRA 3QVHA 3S6HA 1GS5A 4AXSA 2JJ4A 2WXBA 2OGXA 4NDOB 3AAWA 3EK5A 4NDOA 2HMFA 3C20A 3D2MA 3C1MA 4USJA 1YBDA 1B7BA 2R98A 3K4YA 3WWMA 3QVFA 3D41A 1E19A 1OHBA 3QUOA 3NWYA 2J4JA 3T7BA 3K56A 3ZZHA 2J5TA 3ZZGA 2A1FA 4JZ9A 1Z9DA 2W21A 4F6TB 4I49A 4F6TA 3C1NA 2R8VA 4NDPB 2E9YA 3LL9A 2VA1A 4OLCA 2AP9A 2BNFA 3ZZFA 3LL5A 3KZFA 2BNDA 2BNEA 2BRIA 4KZTA 2J0WA 4JZ7A 2RD5A 3S6GA 1GSJA 2CDQA 2IJ9A 1OH9A 1OHAA 3K4OA 3QURA 2WE5A 3D40A 3S6KA 2V5HA 2JI5A 2V4YA 2J0XA 3B8GA 2J4KA 4NDPA 3ZZIA 2BUFA 3WWNA 4AB7A 2JJXA 2J4LA 2BTYA 3U6UA 4NDQB 4A7WA 4NDQA 2BRXA 2OGXB 4JZ8A 2AKOA 3QUNA 4A7XA
chains in the Genus database with same CATH superfamily
3LKKA 3D2PA 4Q1TA 2J5VA 2WE4A 3L76A 2X2WA 3AB4A 2BMUA 3AB2A 3EK6A 3K52A 4NDRB 3TVIA 3L86A 4NDRA 3QVHA 3S6HA 1GS5A 4AXSA 2JJ4A 2WXBA 2OGXA 4NDOB 3AAWA 3EK5A 4NDOA 2HMFA 3C20A 3D2MA 3C1MA 4USJA 1YBDA 1B7BA 2R98A 3K4YA 3WWMA 3QVFA 3D41A 1E19A 1OHBA 3QUOA 3NWYA 2J4JA 3T7BA 3K56A 3ZZHA 2J5TA 3ZZGA 2A1FA 4JZ9A 1Z9DA 2W21A 4F6TB 4I49A 4F6TA 3C1NA 2R8VA 4NDPB 2E9YA 3LL9A 2VA1A 4OLCA 2AP9A 2BNFA 3ZZFA 3LL5A 3KZFA 2BNDA 2BNEA 2BRIA 4KZTA 2J0WA 4JZ7A 2RD5A 3S6GA 1GSJA 2CDQA 2IJ9A 1OH9A 1OHAA 3K4OA 3QURA 2WE5A 3D40A 3S6KA 2V5HA 2JI5A 2V4YA 2J0XA 3B8GA 2J4KA 4NDPA 3ZZIA 2BUFA 3WWNA 4AB7A 2JJXA 2J4LA 2BTYA 3U6UA 4NDQB 4A7WA 4NDQA 2BRXA 2OGXB 4JZ8A 2AKOA 3QUNA 4A7XA
chains in the Genus database with same CATH topology
3LKKA 3D2PA 4Q1TA 2J5VA 2WE4A 3L76A 2X2WA 3AB4A 2BMUA 3AB2A 3EK6A 3K52A 4NDRB 3TVIA 3L86A 4NDRA 3QVHA 3S6HA 1GS5A 4AXSA 2JJ4A 2WXBA 2OGXA 4NDOB 3AAWA 3EK5A 4NDOA 2HMFA 3C20A 3D2MA 3C1MA 4USJA 1YBDA 1B7BA 2R98A 3K4YA 3WWMA 3QVFA 3D41A 1E19A 1OHBA 3QUOA 3NWYA 2J4JA 3T7BA 3K56A 3ZZHA 2J5TA 3ZZGA 2A1FA 4JZ9A 1Z9DA 2W21A 4F6TB 4I49A 4F6TA 3C1NA 2R8VA 4NDPB 2E9YA 3LL9A 2VA1A 4OLCA 2AP9A 2BNFA 3ZZFA 3LL5A 3KZFA 2BNDA 2BNEA 2BRIA 4KZTA 2J0WA 4JZ7A 2RD5A 3S6GA 1GSJA 2CDQA 2IJ9A 1OH9A 1OHAA 3K4OA 3QURA 2WE5A 3D40A 3S6KA 2V5HA 2JI5A 2V4YA 2J0XA 3B8GA 2J4KA 4NDPA 3ZZIA 2BUFA 3WWNA 4AB7A 2JJXA 2J4LA 2BTYA 3U6UA 4NDQB 4A7WA 4NDQA 2BRXA 2OGXB 4JZ8A 2AKOA 3QUNA 4A7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKK A;  3D2P A;  4Q1T A;  2J5V A;  2WE4 A;  3L76 A;  2X2W A;  3AB4 A;  2BMU A;  3AB2 A;  3EK6 A;  3K52 A;  4NDR B;  3TVI A;  3L86 A;  4NDR A;  3QVH A;  3S6H A;  1GS5 A;  4AXS A;  2JJ4 A;  2WXB A;  2OGX A;  4NDO B;  3AAW A;  3EK5 A;  4NDO A;  2HMF A;  3C20 A;  3D2M A;  3C1M A;  4USJ A;  1YBD A;  1B7B A;  2R98 A;  3K4Y A;  3WWM A;  3QVF A;  3D41 A;  1E19 A;  1OHB A;  3QUO A;  3NWY A;  2J4J A;  3T7B A;  3K56 A;  3ZZH A;  2J5T A;  3ZZG A;  2A1F A;  4JZ9 A;  1Z9D A;  2W21 A;  4F6T B;  4I49 A;  4F6T A;  3C1N A;  2R8V A;  4NDP B;  2E9Y A;  3LL9 A;  2VA1 A;  4OLC A;  2AP9 A;  2BNF A;  3ZZF A;  3LL5 A;  3KZF A;  2BND A;  2BNE A;  2BRI A;  4KZT A;  2J0W A;  4JZ7 A;  2RD5 A;  3S6G A;  1GSJ A;  2CDQ A;  2IJ9 A;  1OH9 A;  1OHA A;  3K4O A;  3QUR A;  2WE5 A;  3D40 A;  3S6K A;  2V5H A;  2JI5 A;  2V4Y A;  2J0X A;  3B8G A;  2J4K A;  4NDP A;  3ZZI A;  2BUF A;  3WWN A;  4AB7 A;  2JJX A;  2J4L A;  2BTY A;  3U6U A;  4NDQ B;  4A7W A;  4NDQ A;  2BRX A;  2OGX B;  4JZ8 A;  2AKO A;  3QUN A;  4A7X A; 
#chains in the Genus database with same CATH topology
 3LKK A;  3D2P A;  4Q1T A;  2J5V A;  2WE4 A;  3L76 A;  2X2W A;  3AB4 A;  2BMU A;  3AB2 A;  3EK6 A;  3K52 A;  4NDR B;  3TVI A;  3L86 A;  4NDR A;  3QVH A;  3S6H A;  1GS5 A;  4AXS A;  2JJ4 A;  2WXB A;  2OGX A;  4NDO B;  3AAW A;  3EK5 A;  4NDO A;  2HMF A;  3C20 A;  3D2M A;  3C1M A;  4USJ A;  1YBD A;  1B7B A;  2R98 A;  3K4Y A;  3WWM A;  3QVF A;  3D41 A;  1E19 A;  1OHB A;  3QUO A;  3NWY A;  2J4J A;  3T7B A;  3K56 A;  3ZZH A;  2J5T A;  3ZZG A;  2A1F A;  4JZ9 A;  1Z9D A;  2W21 A;  4F6T B;  4I49 A;  4F6T A;  3C1N A;  2R8V A;  4NDP B;  2E9Y A;  3LL9 A;  2VA1 A;  4OLC A;  2AP9 A;  2BNF A;  3ZZF A;  3LL5 A;  3KZF A;  2BND A;  2BNE A;  2BRI A;  4KZT A;  2J0W A;  4JZ7 A;  2RD5 A;  3S6G A;  1GSJ A;  2CDQ A;  2IJ9 A;  1OH9 A;  1OHA A;  3K4O A;  3QUR A;  2WE5 A;  3D40 A;  3S6K A;  2V5H A;  2JI5 A;  2V4Y A;  2J0X A;  3B8G A;  2J4K A;  4NDP A;  3ZZI A;  2BUF A;  3WWN A;  4AB7 A;  2JJX A;  2J4L A;  2BTY A;  3U6U A;  4NDQ B;  4A7W A;  4NDQ A;  2BRX A;  2OGX B;  4JZ8 A;  2AKO A;  3QUN A;  4A7X A; 
#chains in the Genus database with same CATH homology
 3LKK A;  3D2P A;  4Q1T A;  2J5V A;  2WE4 A;  3L76 A;  2X2W A;  3AB4 A;  2BMU A;  3AB2 A;  3EK6 A;  3K52 A;  4NDR B;  3TVI A;  3L86 A;  4NDR A;  3QVH A;  3S6H A;  1GS5 A;  4AXS A;  2JJ4 A;  2WXB A;  2OGX A;  4NDO B;  3AAW A;  3EK5 A;  4NDO A;  2HMF A;  3C20 A;  3D2M A;  3C1M A;  4USJ A;  1YBD A;  1B7B A;  2R98 A;  3K4Y A;  3WWM A;  3QVF A;  3D41 A;  1E19 A;  1OHB A;  3QUO A;  3NWY A;  2J4J A;  3T7B A;  3K56 A;  3ZZH A;  2J5T A;  3ZZG A;  2A1F A;  4JZ9 A;  1Z9D A;  2W21 A;  4F6T B;  4I49 A;  4F6T A;  3C1N A;  2R8V A;  4NDP B;  2E9Y A;  3LL9 A;  2VA1 A;  4OLC A;  2AP9 A;  2BNF A;  3ZZF A;  3LL5 A;  3KZF A;  2BND A;  2BNE A;  2BRI A;  4KZT A;  2J0W A;  4JZ7 A;  2RD5 A;  3S6G A;  1GSJ A;  2CDQ A;  2IJ9 A;  1OH9 A;  1OHA A;  3K4O A;  3QUR A;  2WE5 A;  3D40 A;  3S6K A;  2V5H A;  2JI5 A;  2V4Y A;  2J0X A;  3B8G A;  2J4K A;  4NDP A;  3ZZI A;  2BUF A;  3WWN A;  4AB7 A;  2JJX A;  2J4L A;  2BTY A;  3U6U A;  4NDQ B;  4A7W A;  4NDQ A;  2BRX A;  2OGX B;  4JZ8 A;  2AKO A;  3QUN A;  4A7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...