2BNDA

The structure of e. coli ump kinase in complex with udp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 79
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bndA00
2BUFA 1YBDA 4AXSA 2J4KA 1OHAA 4I49A 4OLCA 3EK6A 3LL9A 2BRIA 2E9YA 1OH9A 3QUOA 3ZZFA 3K56A 3K4YA 3AAWA 4JZ9A 2J5TA 3T7BA 3ZZGA 3L86A 1OHBA 3LL5A 3D2MA 4F6TA 4USJA 4NDOA 2BNFA 2J5VA 3K52A 4AB7A 2J0WA 2A1FA 3S6HA 4NDOB 2VA1A 3QURA 4JZ8A 2AP9A 2J0XA 3WWMA 2BMUA 4NDPB 2BTYA 3TVIA 3QUNA 2V4YA 2R8VA 3D41A 3ZZIA 2CDQA 3D2PA 3D40A 3U6UA 3EK5A 3ZZHA 3AB2A 2HMFA 2JJXA 4A7XA 1B7BA 4NDRB 2WXBA 2OGXA 3AB4A 2BNDA 2AKOA 2RD5A 3S6GA 2J4LA 2BRXA 3NWYA 4KZTA 2J4JA 4NDRA 1E19A 3QVFA 2OGXB 3C1MA 1GS5A 3KZFA 4F6TB 3B8GA 3LKKA 3S6KA 1Z9DA 4A7WA 3WWNA 4Q1TA 1GSJA 4NDQA 4NDPA 4JZ7A 3C1NA 3L76A 3C20A 2JI5A 2WE4A 2BNEA 2V5HA 2W21A 2R98A 2JJ4A 2IJ9A 2X2WA 3QVHA 2WE5A 4NDQB 3K4OA
chains in the Genus database with same CATH superfamily
2BUFA 1YBDA 4AXSA 2J4KA 1OHAA 4I49A 4OLCA 3EK6A 3LL9A 2BRIA 2E9YA 1OH9A 3QUOA 3ZZFA 3K56A 3K4YA 3AAWA 4JZ9A 2J5TA 3T7BA 3ZZGA 3L86A 1OHBA 3LL5A 3D2MA 4F6TA 4USJA 4NDOA 2BNFA 2J5VA 3K52A 4AB7A 2J0WA 2A1FA 3S6HA 4NDOB 2VA1A 3QURA 4JZ8A 2AP9A 2J0XA 3WWMA 2BMUA 4NDPB 2BTYA 3TVIA 3QUNA 2V4YA 2R8VA 3D41A 3ZZIA 2CDQA 3D2PA 3D40A 3U6UA 3EK5A 3ZZHA 3AB2A 2HMFA 2JJXA 4A7XA 1B7BA 4NDRB 2WXBA 2OGXA 3AB4A 2BNDA 2AKOA 2RD5A 3S6GA 2J4LA 2BRXA 3NWYA 4KZTA 2J4JA 4NDRA 1E19A 3QVFA 2OGXB 3C1MA 1GS5A 3KZFA 4F6TB 3B8GA 3LKKA 3S6KA 1Z9DA 4A7WA 3WWNA 4Q1TA 1GSJA 4NDQA 4NDPA 4JZ7A 3C1NA 3L76A 3C20A 2JI5A 2WE4A 2BNEA 2V5HA 2W21A 2R98A 2JJ4A 2IJ9A 2X2WA 3QVHA 2WE5A 4NDQB 3K4OA
chains in the Genus database with same CATH topology
2BUFA 1YBDA 4AXSA 2J4KA 1OHAA 4I49A 4OLCA 3EK6A 3LL9A 2BRIA 2E9YA 1OH9A 3QUOA 3ZZFA 3K56A 3K4YA 3AAWA 4JZ9A 2J5TA 3T7BA 3ZZGA 3L86A 1OHBA 3LL5A 3D2MA 4F6TA 4USJA 4NDOA 2BNFA 2J5VA 3K52A 4AB7A 2J0WA 2A1FA 3S6HA 4NDOB 2VA1A 3QURA 4JZ8A 2AP9A 2J0XA 3WWMA 2BMUA 4NDPB 2BTYA 3TVIA 3QUNA 2V4YA 2R8VA 3D41A 3ZZIA 2CDQA 3D2PA 3D40A 3U6UA 3EK5A 3ZZHA 3AB2A 2HMFA 2JJXA 4A7XA 1B7BA 4NDRB 2WXBA 2OGXA 3AB4A 2BNDA 2AKOA 2RD5A 3S6GA 2J4LA 2BRXA 3NWYA 4KZTA 2J4JA 4NDRA 1E19A 3QVFA 2OGXB 3C1MA 1GS5A 3KZFA 4F6TB 3B8GA 3LKKA 3S6KA 1Z9DA 4A7WA 3WWNA 4Q1TA 1GSJA 4NDQA 4NDPA 4JZ7A 3C1NA 3L76A 3C20A 2JI5A 2WE4A 2BNEA 2V5HA 2W21A 2R98A 2JJ4A 2IJ9A 2X2WA 3QVHA 2WE5A 4NDQB 3K4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUF A;  1YBD A;  4AXS A;  2J4K A;  1OHA A;  4I49 A;  4OLC A;  3EK6 A;  3LL9 A;  2BRI A;  2E9Y A;  1OH9 A;  3QUO A;  3ZZF A;  3K56 A;  3K4Y A;  3AAW A;  4JZ9 A;  2J5T A;  3T7B A;  3ZZG A;  3L86 A;  1OHB A;  3LL5 A;  3D2M A;  4F6T A;  4USJ A;  4NDO A;  2BNF A;  2J5V A;  3K52 A;  4AB7 A;  2J0W A;  2A1F A;  3S6H A;  4NDO B;  2VA1 A;  3QUR A;  4JZ8 A;  2AP9 A;  2J0X A;  3WWM A;  2BMU A;  4NDP B;  2BTY A;  3TVI A;  3QUN A;  2V4Y A;  2R8V A;  3D41 A;  3ZZI A;  2CDQ A;  3D2P A;  3D40 A;  3U6U A;  3EK5 A;  3ZZH A;  3AB2 A;  2HMF A;  2JJX A;  4A7X A;  1B7B A;  4NDR B;  2WXB A;  2OGX A;  3AB4 A;  2BND A;  2AKO A;  2RD5 A;  3S6G A;  2J4L A;  2BRX A;  3NWY A;  4KZT A;  2J4J A;  4NDR A;  1E19 A;  3QVF A;  2OGX B;  3C1M A;  1GS5 A;  3KZF A;  4F6T B;  3B8G A;  3LKK A;  3S6K A;  1Z9D A;  4A7W A;  3WWN A;  4Q1T A;  1GSJ A;  4NDQ A;  4NDP A;  4JZ7 A;  3C1N A;  3L76 A;  3C20 A;  2JI5 A;  2WE4 A;  2BNE A;  2V5H A;  2W21 A;  2R98 A;  2JJ4 A;  2IJ9 A;  2X2W A;  3QVH A;  2WE5 A;  4NDQ B;  3K4O A; 
#chains in the Genus database with same CATH topology
 2BUF A;  1YBD A;  4AXS A;  2J4K A;  1OHA A;  4I49 A;  4OLC A;  3EK6 A;  3LL9 A;  2BRI A;  2E9Y A;  1OH9 A;  3QUO A;  3ZZF A;  3K56 A;  3K4Y A;  3AAW A;  4JZ9 A;  2J5T A;  3T7B A;  3ZZG A;  3L86 A;  1OHB A;  3LL5 A;  3D2M A;  4F6T A;  4USJ A;  4NDO A;  2BNF A;  2J5V A;  3K52 A;  4AB7 A;  2J0W A;  2A1F A;  3S6H A;  4NDO B;  2VA1 A;  3QUR A;  4JZ8 A;  2AP9 A;  2J0X A;  3WWM A;  2BMU A;  4NDP B;  2BTY A;  3TVI A;  3QUN A;  2V4Y A;  2R8V A;  3D41 A;  3ZZI A;  2CDQ A;  3D2P A;  3D40 A;  3U6U A;  3EK5 A;  3ZZH A;  3AB2 A;  2HMF A;  2JJX A;  4A7X A;  1B7B A;  4NDR B;  2WXB A;  2OGX A;  3AB4 A;  2BND A;  2AKO A;  2RD5 A;  3S6G A;  2J4L A;  2BRX A;  3NWY A;  4KZT A;  2J4J A;  4NDR A;  1E19 A;  3QVF A;  2OGX B;  3C1M A;  1GS5 A;  3KZF A;  4F6T B;  3B8G A;  3LKK A;  3S6K A;  1Z9D A;  4A7W A;  3WWN A;  4Q1T A;  1GSJ A;  4NDQ A;  4NDP A;  4JZ7 A;  3C1N A;  3L76 A;  3C20 A;  2JI5 A;  2WE4 A;  2BNE A;  2V5H A;  2W21 A;  2R98 A;  2JJ4 A;  2IJ9 A;  2X2W A;  3QVH A;  2WE5 A;  4NDQ B;  3K4O A; 
#chains in the Genus database with same CATH homology
 2BUF A;  1YBD A;  4AXS A;  2J4K A;  1OHA A;  4I49 A;  4OLC A;  3EK6 A;  3LL9 A;  2BRI A;  2E9Y A;  1OH9 A;  3QUO A;  3ZZF A;  3K56 A;  3K4Y A;  3AAW A;  4JZ9 A;  2J5T A;  3T7B A;  3ZZG A;  3L86 A;  1OHB A;  3LL5 A;  3D2M A;  4F6T A;  4USJ A;  4NDO A;  2BNF A;  2J5V A;  3K52 A;  4AB7 A;  2J0W A;  2A1F A;  3S6H A;  4NDO B;  2VA1 A;  3QUR A;  4JZ8 A;  2AP9 A;  2J0X A;  3WWM A;  2BMU A;  4NDP B;  2BTY A;  3TVI A;  3QUN A;  2V4Y A;  2R8V A;  3D41 A;  3ZZI A;  2CDQ A;  3D2P A;  3D40 A;  3U6U A;  3EK5 A;  3ZZH A;  3AB2 A;  2HMF A;  2JJX A;  4A7X A;  1B7B A;  4NDR B;  2WXB A;  2OGX A;  3AB4 A;  2BND A;  2AKO A;  2RD5 A;  3S6G A;  2J4L A;  2BRX A;  3NWY A;  4KZT A;  2J4J A;  4NDR A;  1E19 A;  3QVF A;  2OGX B;  3C1M A;  1GS5 A;  3KZF A;  4F6T B;  3B8G A;  3LKK A;  3S6K A;  1Z9D A;  4A7W A;  3WWN A;  4Q1T A;  1GSJ A;  4NDQ A;  4NDP A;  4JZ7 A;  3C1N A;  3L76 A;  3C20 A;  2JI5 A;  2WE4 A;  2BNE A;  2V5H A;  2W21 A;  2R98 A;  2JJ4 A;  2IJ9 A;  2X2W A;  3QVH A;  2WE5 A;  4NDQ B;  3K4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...