2BNDA

The structure of e. coli ump kinase in complex with udp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bndA00
2WXBA 2AP9A 3L86A 4NDQA 4JZ7A 1OHBA 4KZTA 4USJA 3D40A 1YBDA 3K56A 2JJ4A 3D2PA 2V5HA 2BRXA 3S6HA 2WE5A 4A7WA 3NWYA 2BNFA 3AB2A 4I49A 4NDPB 4F6TB 3C20A 2J0WA 3LL5A 3D2MA 4NDPA 4F6TA 3C1MA 2JI5A 3ZZHA 2OGXA 4A7XA 2W21A 3AB4A 1OHAA 3LL9A 3C1NA 3QUNA 2A1FA 2JJXA 3K4OA 1GSJA 3S6GA 4Q1TA 4JZ9A 3TVIA 3EK6A 2BNDA 3ZZGA 3KZFA 2BTYA 2J4KA 2R98A 2BMUA 2HMFA 2BNEA 4AB7A 3LKKA 3QUOA 3EK5A 1GS5A 3QVFA 1E19A 2AKOA 3WWMA 2J0XA 2J5VA 2X2WA 3QVHA 4NDRB 4AXSA 4NDRA 3D41A 2IJ9A 2V4YA 2J4JA 2J5TA 2BUFA 2WE4A 1B7BA 4NDQB 3K52A 3QURA 1OH9A 2VA1A 3U6UA 3S6KA 4OLCA 2E9YA 1Z9DA 3T7BA 3AAWA 4JZ8A 2BRIA 2R8VA 3ZZIA 3ZZFA 3WWNA 3K4YA 3L76A 4NDOB 2RD5A 3B8GA 4NDOA 2CDQA 2J4LA 2OGXB
chains in the Genus database with same CATH superfamily
2WXBA 2AP9A 3L86A 4NDQA 4JZ7A 1OHBA 4KZTA 4USJA 3D40A 1YBDA 3K56A 2JJ4A 3D2PA 2V5HA 2BRXA 3S6HA 2WE5A 4A7WA 3NWYA 2BNFA 3AB2A 4I49A 4NDPB 4F6TB 3C20A 2J0WA 3LL5A 3D2MA 4NDPA 4F6TA 3C1MA 2JI5A 3ZZHA 2OGXA 4A7XA 2W21A 3AB4A 1OHAA 3LL9A 3C1NA 3QUNA 2A1FA 2JJXA 3K4OA 1GSJA 3S6GA 4Q1TA 4JZ9A 3TVIA 3EK6A 2BNDA 3ZZGA 3KZFA 2BTYA 2J4KA 2R98A 2BMUA 2HMFA 2BNEA 4AB7A 3LKKA 3QUOA 3EK5A 1GS5A 3QVFA 1E19A 2AKOA 3WWMA 2J0XA 2J5VA 2X2WA 3QVHA 4NDRB 4AXSA 4NDRA 3D41A 2IJ9A 2V4YA 2J4JA 2J5TA 2BUFA 2WE4A 1B7BA 4NDQB 3K52A 3QURA 1OH9A 2VA1A 3U6UA 3S6KA 4OLCA 2E9YA 1Z9DA 3T7BA 3AAWA 4JZ8A 2BRIA 2R8VA 3ZZIA 3ZZFA 3WWNA 3K4YA 3L76A 4NDOB 2RD5A 3B8GA 4NDOA 2CDQA 2J4LA 2OGXB
chains in the Genus database with same CATH topology
2WXBA 2AP9A 3L86A 4NDQA 4JZ7A 1OHBA 4KZTA 4USJA 3D40A 1YBDA 3K56A 2JJ4A 3D2PA 2V5HA 2BRXA 3S6HA 2WE5A 4A7WA 3NWYA 2BNFA 3AB2A 4I49A 4NDPB 4F6TB 3C20A 2J0WA 3LL5A 3D2MA 4NDPA 4F6TA 3C1MA 2JI5A 3ZZHA 2OGXA 4A7XA 2W21A 3AB4A 1OHAA 3LL9A 3C1NA 3QUNA 2A1FA 2JJXA 3K4OA 1GSJA 3S6GA 4Q1TA 4JZ9A 3TVIA 3EK6A 2BNDA 3ZZGA 3KZFA 2BTYA 2J4KA 2R98A 2BMUA 2HMFA 2BNEA 4AB7A 3LKKA 3QUOA 3EK5A 1GS5A 3QVFA 1E19A 2AKOA 3WWMA 2J0XA 2J5VA 2X2WA 3QVHA 4NDRB 4AXSA 4NDRA 3D41A 2IJ9A 2V4YA 2J4JA 2J5TA 2BUFA 2WE4A 1B7BA 4NDQB 3K52A 3QURA 1OH9A 2VA1A 3U6UA 3S6KA 4OLCA 2E9YA 1Z9DA 3T7BA 3AAWA 4JZ8A 2BRIA 2R8VA 3ZZIA 3ZZFA 3WWNA 3K4YA 3L76A 4NDOB 2RD5A 3B8GA 4NDOA 2CDQA 2J4LA 2OGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WXB A;  2AP9 A;  3L86 A;  4NDQ A;  4JZ7 A;  1OHB A;  4KZT A;  4USJ A;  3D40 A;  1YBD A;  3K56 A;  2JJ4 A;  3D2P A;  2V5H A;  2BRX A;  3S6H A;  2WE5 A;  4A7W A;  3NWY A;  2BNF A;  3AB2 A;  4I49 A;  4NDP B;  4F6T B;  3C20 A;  2J0W A;  3LL5 A;  3D2M A;  4NDP A;  4F6T A;  3C1M A;  2JI5 A;  3ZZH A;  2OGX A;  4A7X A;  2W21 A;  3AB4 A;  1OHA A;  3LL9 A;  3C1N A;  3QUN A;  2A1F A;  2JJX A;  3K4O A;  1GSJ A;  3S6G A;  4Q1T A;  4JZ9 A;  3TVI A;  3EK6 A;  2BND A;  3ZZG A;  3KZF A;  2BTY A;  2J4K A;  2R98 A;  2BMU A;  2HMF A;  2BNE A;  4AB7 A;  3LKK A;  3QUO A;  3EK5 A;  1GS5 A;  3QVF A;  1E19 A;  2AKO A;  3WWM A;  2J0X A;  2J5V A;  2X2W A;  3QVH A;  4NDR B;  4AXS A;  4NDR A;  3D41 A;  2IJ9 A;  2V4Y A;  2J4J A;  2J5T A;  2BUF A;  2WE4 A;  1B7B A;  4NDQ B;  3K52 A;  3QUR A;  1OH9 A;  2VA1 A;  3U6U A;  3S6K A;  4OLC A;  2E9Y A;  1Z9D A;  3T7B A;  3AAW A;  4JZ8 A;  2BRI A;  2R8V A;  3ZZI A;  3ZZF A;  3WWN A;  3K4Y A;  3L76 A;  4NDO B;  2RD5 A;  3B8G A;  4NDO A;  2CDQ A;  2J4L A;  2OGX B; 
#chains in the Genus database with same CATH topology
 2WXB A;  2AP9 A;  3L86 A;  4NDQ A;  4JZ7 A;  1OHB A;  4KZT A;  4USJ A;  3D40 A;  1YBD A;  3K56 A;  2JJ4 A;  3D2P A;  2V5H A;  2BRX A;  3S6H A;  2WE5 A;  4A7W A;  3NWY A;  2BNF A;  3AB2 A;  4I49 A;  4NDP B;  4F6T B;  3C20 A;  2J0W A;  3LL5 A;  3D2M A;  4NDP A;  4F6T A;  3C1M A;  2JI5 A;  3ZZH A;  2OGX A;  4A7X A;  2W21 A;  3AB4 A;  1OHA A;  3LL9 A;  3C1N A;  3QUN A;  2A1F A;  2JJX A;  3K4O A;  1GSJ A;  3S6G A;  4Q1T A;  4JZ9 A;  3TVI A;  3EK6 A;  2BND A;  3ZZG A;  3KZF A;  2BTY A;  2J4K A;  2R98 A;  2BMU A;  2HMF A;  2BNE A;  4AB7 A;  3LKK A;  3QUO A;  3EK5 A;  1GS5 A;  3QVF A;  1E19 A;  2AKO A;  3WWM A;  2J0X A;  2J5V A;  2X2W A;  3QVH A;  4NDR B;  4AXS A;  4NDR A;  3D41 A;  2IJ9 A;  2V4Y A;  2J4J A;  2J5T A;  2BUF A;  2WE4 A;  1B7B A;  4NDQ B;  3K52 A;  3QUR A;  1OH9 A;  2VA1 A;  3U6U A;  3S6K A;  4OLC A;  2E9Y A;  1Z9D A;  3T7B A;  3AAW A;  4JZ8 A;  2BRI A;  2R8V A;  3ZZI A;  3ZZF A;  3WWN A;  3K4Y A;  3L76 A;  4NDO B;  2RD5 A;  3B8G A;  4NDO A;  2CDQ A;  2J4L A;  2OGX B; 
#chains in the Genus database with same CATH homology
 2WXB A;  2AP9 A;  3L86 A;  4NDQ A;  4JZ7 A;  1OHB A;  4KZT A;  4USJ A;  3D40 A;  1YBD A;  3K56 A;  2JJ4 A;  3D2P A;  2V5H A;  2BRX A;  3S6H A;  2WE5 A;  4A7W A;  3NWY A;  2BNF A;  3AB2 A;  4I49 A;  4NDP B;  4F6T B;  3C20 A;  2J0W A;  3LL5 A;  3D2M A;  4NDP A;  4F6T A;  3C1M A;  2JI5 A;  3ZZH A;  2OGX A;  4A7X A;  2W21 A;  3AB4 A;  1OHA A;  3LL9 A;  3C1N A;  3QUN A;  2A1F A;  2JJX A;  3K4O A;  1GSJ A;  3S6G A;  4Q1T A;  4JZ9 A;  3TVI A;  3EK6 A;  2BND A;  3ZZG A;  3KZF A;  2BTY A;  2J4K A;  2R98 A;  2BMU A;  2HMF A;  2BNE A;  4AB7 A;  3LKK A;  3QUO A;  3EK5 A;  1GS5 A;  3QVF A;  1E19 A;  2AKO A;  3WWM A;  2J0X A;  2J5V A;  2X2W A;  3QVH A;  4NDR B;  4AXS A;  4NDR A;  3D41 A;  2IJ9 A;  2V4Y A;  2J4J A;  2J5T A;  2BUF A;  2WE4 A;  1B7B A;  4NDQ B;  3K52 A;  3QUR A;  1OH9 A;  2VA1 A;  3U6U A;  3S6K A;  4OLC A;  2E9Y A;  1Z9D A;  3T7B A;  3AAW A;  4JZ8 A;  2BRI A;  2R8V A;  3ZZI A;  3ZZF A;  3WWN A;  3K4Y A;  3L76 A;  4NDO B;  2RD5 A;  3B8G A;  4NDO A;  2CDQ A;  2J4L A;  2OGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...