2BNDA

The structure of e. coli ump kinase in complex with udp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bndA00
2RD5A 3KZFA 2J4JA 3S6HA 3AB2A 2J0WA 2JJXA 1GS5A 4NDPA 3K4YA 3QUNA 4KZTA 3K4OA 2IJ9A 4NDOA 2HMFA 3U6UA 3K56A 1OHAA 4I49A 4JZ8A 3ZZFA 3L76A 4JZ7A 2J5VA 4NDQB 2JJ4A 4NDRB 4AB7A 3D40A 2OGXB 2W21A 2A1FA 2AP9A 2V4YA 1Z9DA 3D2PA 4NDPB 1E19A 3EK6A 2BNDA 2J0XA 1OH9A 2E9YA 2JI5A 2CDQA 4NDOB 2BMUA 2J4LA 3QUOA 2BNFA 3QVFA 2J4KA 2BNEA 4OLCA 3L86A 2BRIA 2V5HA 3TVIA 3ZZHA 3T7BA 2J5TA 4F6TA 3S6GA 2WXBA 3C20A 1OHBA 3K52A 4A7XA 1YBDA 2R98A 3NWYA 3B8GA 4Q1TA 2AKOA 3LKKA 2X2WA 3LL5A 1B7BA 4JZ9A 1GSJA 3D2MA 2BRXA 3ZZGA 3LL9A 3QURA 4A7WA 2WE4A 3AB4A 4AXSA 3WWMA 2BUFA 4F6TB 4USJA 3ZZIA 3C1NA 4NDQA 3D41A 3WWNA 2R8VA 4NDRA 3S6KA 2BTYA 2OGXA 3QVHA 3C1MA 2WE5A 3EK5A 2VA1A 3AAWA
chains in the Genus database with same CATH superfamily
2RD5A 3KZFA 2J4JA 3S6HA 3AB2A 2J0WA 2JJXA 1GS5A 4NDPA 3K4YA 3QUNA 4KZTA 3K4OA 2IJ9A 4NDOA 2HMFA 3U6UA 3K56A 1OHAA 4I49A 4JZ8A 3ZZFA 3L76A 4JZ7A 2J5VA 4NDQB 2JJ4A 4NDRB 4AB7A 3D40A 2OGXB 2W21A 2A1FA 2AP9A 2V4YA 1Z9DA 3D2PA 4NDPB 1E19A 3EK6A 2BNDA 2J0XA 1OH9A 2E9YA 2JI5A 2CDQA 4NDOB 2BMUA 2J4LA 3QUOA 2BNFA 3QVFA 2J4KA 2BNEA 4OLCA 3L86A 2BRIA 2V5HA 3TVIA 3ZZHA 3T7BA 2J5TA 4F6TA 3S6GA 2WXBA 3C20A 1OHBA 3K52A 4A7XA 1YBDA 2R98A 3NWYA 3B8GA 4Q1TA 2AKOA 3LKKA 2X2WA 3LL5A 1B7BA 4JZ9A 1GSJA 3D2MA 2BRXA 3ZZGA 3LL9A 3QURA 4A7WA 2WE4A 3AB4A 4AXSA 3WWMA 2BUFA 4F6TB 4USJA 3ZZIA 3C1NA 4NDQA 3D41A 3WWNA 2R8VA 4NDRA 3S6KA 2BTYA 2OGXA 3QVHA 3C1MA 2WE5A 3EK5A 2VA1A 3AAWA
chains in the Genus database with same CATH topology
2RD5A 3KZFA 2J4JA 3S6HA 3AB2A 2J0WA 2JJXA 1GS5A 4NDPA 3K4YA 3QUNA 4KZTA 3K4OA 2IJ9A 4NDOA 2HMFA 3U6UA 3K56A 1OHAA 4I49A 4JZ8A 3ZZFA 3L76A 4JZ7A 2J5VA 4NDQB 2JJ4A 4NDRB 4AB7A 3D40A 2OGXB 2W21A 2A1FA 2AP9A 2V4YA 1Z9DA 3D2PA 4NDPB 1E19A 3EK6A 2BNDA 2J0XA 1OH9A 2E9YA 2JI5A 2CDQA 4NDOB 2BMUA 2J4LA 3QUOA 2BNFA 3QVFA 2J4KA 2BNEA 4OLCA 3L86A 2BRIA 2V5HA 3TVIA 3ZZHA 3T7BA 2J5TA 4F6TA 3S6GA 2WXBA 3C20A 1OHBA 3K52A 4A7XA 1YBDA 2R98A 3NWYA 3B8GA 4Q1TA 2AKOA 3LKKA 2X2WA 3LL5A 1B7BA 4JZ9A 1GSJA 3D2MA 2BRXA 3ZZGA 3LL9A 3QURA 4A7WA 2WE4A 3AB4A 4AXSA 3WWMA 2BUFA 4F6TB 4USJA 3ZZIA 3C1NA 4NDQA 3D41A 3WWNA 2R8VA 4NDRA 3S6KA 2BTYA 2OGXA 3QVHA 3C1MA 2WE5A 3EK5A 2VA1A 3AAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD5 A;  3KZF A;  2J4J A;  3S6H A;  3AB2 A;  2J0W A;  2JJX A;  1GS5 A;  4NDP A;  3K4Y A;  3QUN A;  4KZT A;  3K4O A;  2IJ9 A;  4NDO A;  2HMF A;  3U6U A;  3K56 A;  1OHA A;  4I49 A;  4JZ8 A;  3ZZF A;  3L76 A;  4JZ7 A;  2J5V A;  4NDQ B;  2JJ4 A;  4NDR B;  4AB7 A;  3D40 A;  2OGX B;  2W21 A;  2A1F A;  2AP9 A;  2V4Y A;  1Z9D A;  3D2P A;  4NDP B;  1E19 A;  3EK6 A;  2BND A;  2J0X A;  1OH9 A;  2E9Y A;  2JI5 A;  2CDQ A;  4NDO B;  2BMU A;  2J4L A;  3QUO A;  2BNF A;  3QVF A;  2J4K A;  2BNE A;  4OLC A;  3L86 A;  2BRI A;  2V5H A;  3TVI A;  3ZZH A;  3T7B A;  2J5T A;  4F6T A;  3S6G A;  2WXB A;  3C20 A;  1OHB A;  3K52 A;  4A7X A;  1YBD A;  2R98 A;  3NWY A;  3B8G A;  4Q1T A;  2AKO A;  3LKK A;  2X2W A;  3LL5 A;  1B7B A;  4JZ9 A;  1GSJ A;  3D2M A;  2BRX A;  3ZZG A;  3LL9 A;  3QUR A;  4A7W A;  2WE4 A;  3AB4 A;  4AXS A;  3WWM A;  2BUF A;  4F6T B;  4USJ A;  3ZZI A;  3C1N A;  4NDQ A;  3D41 A;  3WWN A;  2R8V A;  4NDR A;  3S6K A;  2BTY A;  2OGX A;  3QVH A;  3C1M A;  2WE5 A;  3EK5 A;  2VA1 A;  3AAW A; 
#chains in the Genus database with same CATH topology
 2RD5 A;  3KZF A;  2J4J A;  3S6H A;  3AB2 A;  2J0W A;  2JJX A;  1GS5 A;  4NDP A;  3K4Y A;  3QUN A;  4KZT A;  3K4O A;  2IJ9 A;  4NDO A;  2HMF A;  3U6U A;  3K56 A;  1OHA A;  4I49 A;  4JZ8 A;  3ZZF A;  3L76 A;  4JZ7 A;  2J5V A;  4NDQ B;  2JJ4 A;  4NDR B;  4AB7 A;  3D40 A;  2OGX B;  2W21 A;  2A1F A;  2AP9 A;  2V4Y A;  1Z9D A;  3D2P A;  4NDP B;  1E19 A;  3EK6 A;  2BND A;  2J0X A;  1OH9 A;  2E9Y A;  2JI5 A;  2CDQ A;  4NDO B;  2BMU A;  2J4L A;  3QUO A;  2BNF A;  3QVF A;  2J4K A;  2BNE A;  4OLC A;  3L86 A;  2BRI A;  2V5H A;  3TVI A;  3ZZH A;  3T7B A;  2J5T A;  4F6T A;  3S6G A;  2WXB A;  3C20 A;  1OHB A;  3K52 A;  4A7X A;  1YBD A;  2R98 A;  3NWY A;  3B8G A;  4Q1T A;  2AKO A;  3LKK A;  2X2W A;  3LL5 A;  1B7B A;  4JZ9 A;  1GSJ A;  3D2M A;  2BRX A;  3ZZG A;  3LL9 A;  3QUR A;  4A7W A;  2WE4 A;  3AB4 A;  4AXS A;  3WWM A;  2BUF A;  4F6T B;  4USJ A;  3ZZI A;  3C1N A;  4NDQ A;  3D41 A;  3WWN A;  2R8V A;  4NDR A;  3S6K A;  2BTY A;  2OGX A;  3QVH A;  3C1M A;  2WE5 A;  3EK5 A;  2VA1 A;  3AAW A; 
#chains in the Genus database with same CATH homology
 2RD5 A;  3KZF A;  2J4J A;  3S6H A;  3AB2 A;  2J0W A;  2JJX A;  1GS5 A;  4NDP A;  3K4Y A;  3QUN A;  4KZT A;  3K4O A;  2IJ9 A;  4NDO A;  2HMF A;  3U6U A;  3K56 A;  1OHA A;  4I49 A;  4JZ8 A;  3ZZF A;  3L76 A;  4JZ7 A;  2J5V A;  4NDQ B;  2JJ4 A;  4NDR B;  4AB7 A;  3D40 A;  2OGX B;  2W21 A;  2A1F A;  2AP9 A;  2V4Y A;  1Z9D A;  3D2P A;  4NDP B;  1E19 A;  3EK6 A;  2BND A;  2J0X A;  1OH9 A;  2E9Y A;  2JI5 A;  2CDQ A;  4NDO B;  2BMU A;  2J4L A;  3QUO A;  2BNF A;  3QVF A;  2J4K A;  2BNE A;  4OLC A;  3L86 A;  2BRI A;  2V5H A;  3TVI A;  3ZZH A;  3T7B A;  2J5T A;  4F6T A;  3S6G A;  2WXB A;  3C20 A;  1OHB A;  3K52 A;  4A7X A;  1YBD A;  2R98 A;  3NWY A;  3B8G A;  4Q1T A;  2AKO A;  3LKK A;  2X2W A;  3LL5 A;  1B7B A;  4JZ9 A;  1GSJ A;  3D2M A;  2BRX A;  3ZZG A;  3LL9 A;  3QUR A;  4A7W A;  2WE4 A;  3AB4 A;  4AXS A;  3WWM A;  2BUF A;  4F6T B;  4USJ A;  3ZZI A;  3C1N A;  4NDQ A;  3D41 A;  3WWN A;  2R8V A;  4NDR A;  3S6K A;  2BTY A;  2OGX A;  3QVH A;  3C1M A;  2WE5 A;  3EK5 A;  2VA1 A;  3AAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...