2BNDA

The structure of e. coli ump kinase in complex with udp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNAVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 79
structure length 237
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bndA00
3C20A 3ZZGA 2V5HA 2IJ9A 2BNDA 3LL5A 3ZZFA 3QURA 2JJ4A 4NDRA 1E19A 2WXBA 3WWNA 4JZ8A 4NDRB 1GSJA 4OLCA 2BRXA 3L76A 4A7WA 1OHBA 2E9YA 3U6UA 3AAWA 4AXSA 2OGXA 2RD5A 2AP9A 3AB2A 3K56A 1Z9DA 3LKKA 2JJXA 4A7XA 3ZZIA 3C1NA 4NDQA 3LL9A 2J4LA 3QUOA 2R8VA 3EK6A 2HMFA 3S6GA 3KZFA 2BNEA 3K4OA 3QVHA 3QVFA 4JZ9A 2JI5A 3D2PA 4NDOB 2WE4A 3D2MA 2VA1A 4NDOA 2J0WA 3T7BA 4F6TB 4JZ7A 2R98A 4NDPA 2J4JA 1YBDA 4I49A 3C1MA 1OH9A 2AKOA 4AB7A 3TVIA 2BTYA 2V4YA 4KZTA 1OHAA 3B8GA 3AB4A 2BMUA 4Q1TA 3S6KA 4F6TA 2J5VA 1B7BA 3K52A 2J5TA 2CDQA 2BUFA 2X2WA 4NDQB 3EK5A 3D40A 1GS5A 4NDPB 2J4KA 2W21A 3QUNA 3S6HA 2BRIA 2A1FA 2WE5A 2OGXB 4USJA 3NWYA 3L86A 3WWMA 3K4YA 2J0XA 3ZZHA 3D41A 2BNFA
chains in the Genus database with same CATH superfamily
3C20A 3ZZGA 2V5HA 2IJ9A 2BNDA 3LL5A 3ZZFA 3QURA 2JJ4A 4NDRA 1E19A 2WXBA 3WWNA 4JZ8A 4NDRB 1GSJA 4OLCA 2BRXA 3L76A 4A7WA 1OHBA 2E9YA 3U6UA 3AAWA 4AXSA 2OGXA 2RD5A 2AP9A 3AB2A 3K56A 1Z9DA 3LKKA 2JJXA 4A7XA 3ZZIA 3C1NA 4NDQA 3LL9A 2J4LA 3QUOA 2R8VA 3EK6A 2HMFA 3S6GA 3KZFA 2BNEA 3K4OA 3QVHA 3QVFA 4JZ9A 2JI5A 3D2PA 4NDOB 2WE4A 3D2MA 2VA1A 4NDOA 2J0WA 3T7BA 4F6TB 4JZ7A 2R98A 4NDPA 2J4JA 1YBDA 4I49A 3C1MA 1OH9A 2AKOA 4AB7A 3TVIA 2BTYA 2V4YA 4KZTA 1OHAA 3B8GA 3AB4A 2BMUA 4Q1TA 3S6KA 4F6TA 2J5VA 1B7BA 3K52A 2J5TA 2CDQA 2BUFA 2X2WA 4NDQB 3EK5A 3D40A 1GS5A 4NDPB 2J4KA 2W21A 3QUNA 3S6HA 2BRIA 2A1FA 2WE5A 2OGXB 4USJA 3NWYA 3L86A 3WWMA 3K4YA 2J0XA 3ZZHA 3D41A 2BNFA
chains in the Genus database with same CATH topology
3C20A 3ZZGA 2V5HA 2IJ9A 2BNDA 3LL5A 3ZZFA 3QURA 2JJ4A 4NDRA 1E19A 2WXBA 3WWNA 4JZ8A 4NDRB 1GSJA 4OLCA 2BRXA 3L76A 4A7WA 1OHBA 2E9YA 3U6UA 3AAWA 4AXSA 2OGXA 2RD5A 2AP9A 3AB2A 3K56A 1Z9DA 3LKKA 2JJXA 4A7XA 3ZZIA 3C1NA 4NDQA 3LL9A 2J4LA 3QUOA 2R8VA 3EK6A 2HMFA 3S6GA 3KZFA 2BNEA 3K4OA 3QVHA 3QVFA 4JZ9A 2JI5A 3D2PA 4NDOB 2WE4A 3D2MA 2VA1A 4NDOA 2J0WA 3T7BA 4F6TB 4JZ7A 2R98A 4NDPA 2J4JA 1YBDA 4I49A 3C1MA 1OH9A 2AKOA 4AB7A 3TVIA 2BTYA 2V4YA 4KZTA 1OHAA 3B8GA 3AB4A 2BMUA 4Q1TA 3S6KA 4F6TA 2J5VA 1B7BA 3K52A 2J5TA 2CDQA 2BUFA 2X2WA 4NDQB 3EK5A 3D40A 1GS5A 4NDPB 2J4KA 2W21A 3QUNA 3S6HA 2BRIA 2A1FA 2WE5A 2OGXB 4USJA 3NWYA 3L86A 3WWMA 3K4YA 2J0XA 3ZZHA 3D41A 2BNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C20 A;  3ZZG A;  2V5H A;  2IJ9 A;  2BND A;  3LL5 A;  3ZZF A;  3QUR A;  2JJ4 A;  4NDR A;  1E19 A;  2WXB A;  3WWN A;  4JZ8 A;  4NDR B;  1GSJ A;  4OLC A;  2BRX A;  3L76 A;  4A7W A;  1OHB A;  2E9Y A;  3U6U A;  3AAW A;  4AXS A;  2OGX A;  2RD5 A;  2AP9 A;  3AB2 A;  3K56 A;  1Z9D A;  3LKK A;  2JJX A;  4A7X A;  3ZZI A;  3C1N A;  4NDQ A;  3LL9 A;  2J4L A;  3QUO A;  2R8V A;  3EK6 A;  2HMF A;  3S6G A;  3KZF A;  2BNE A;  3K4O A;  3QVH A;  3QVF A;  4JZ9 A;  2JI5 A;  3D2P A;  4NDO B;  2WE4 A;  3D2M A;  2VA1 A;  4NDO A;  2J0W A;  3T7B A;  4F6T B;  4JZ7 A;  2R98 A;  4NDP A;  2J4J A;  1YBD A;  4I49 A;  3C1M A;  1OH9 A;  2AKO A;  4AB7 A;  3TVI A;  2BTY A;  2V4Y A;  4KZT A;  1OHA A;  3B8G A;  3AB4 A;  2BMU A;  4Q1T A;  3S6K A;  4F6T A;  2J5V A;  1B7B A;  3K52 A;  2J5T A;  2CDQ A;  2BUF A;  2X2W A;  4NDQ B;  3EK5 A;  3D40 A;  1GS5 A;  4NDP B;  2J4K A;  2W21 A;  3QUN A;  3S6H A;  2BRI A;  2A1F A;  2WE5 A;  2OGX B;  4USJ A;  3NWY A;  3L86 A;  3WWM A;  3K4Y A;  2J0X A;  3ZZH A;  3D41 A;  2BNF A; 
#chains in the Genus database with same CATH topology
 3C20 A;  3ZZG A;  2V5H A;  2IJ9 A;  2BND A;  3LL5 A;  3ZZF A;  3QUR A;  2JJ4 A;  4NDR A;  1E19 A;  2WXB A;  3WWN A;  4JZ8 A;  4NDR B;  1GSJ A;  4OLC A;  2BRX A;  3L76 A;  4A7W A;  1OHB A;  2E9Y A;  3U6U A;  3AAW A;  4AXS A;  2OGX A;  2RD5 A;  2AP9 A;  3AB2 A;  3K56 A;  1Z9D A;  3LKK A;  2JJX A;  4A7X A;  3ZZI A;  3C1N A;  4NDQ A;  3LL9 A;  2J4L A;  3QUO A;  2R8V A;  3EK6 A;  2HMF A;  3S6G A;  3KZF A;  2BNE A;  3K4O A;  3QVH A;  3QVF A;  4JZ9 A;  2JI5 A;  3D2P A;  4NDO B;  2WE4 A;  3D2M A;  2VA1 A;  4NDO A;  2J0W A;  3T7B A;  4F6T B;  4JZ7 A;  2R98 A;  4NDP A;  2J4J A;  1YBD A;  4I49 A;  3C1M A;  1OH9 A;  2AKO A;  4AB7 A;  3TVI A;  2BTY A;  2V4Y A;  4KZT A;  1OHA A;  3B8G A;  3AB4 A;  2BMU A;  4Q1T A;  3S6K A;  4F6T A;  2J5V A;  1B7B A;  3K52 A;  2J5T A;  2CDQ A;  2BUF A;  2X2W A;  4NDQ B;  3EK5 A;  3D40 A;  1GS5 A;  4NDP B;  2J4K A;  2W21 A;  3QUN A;  3S6H A;  2BRI A;  2A1F A;  2WE5 A;  2OGX B;  4USJ A;  3NWY A;  3L86 A;  3WWM A;  3K4Y A;  2J0X A;  3ZZH A;  3D41 A;  2BNF A; 
#chains in the Genus database with same CATH homology
 3C20 A;  3ZZG A;  2V5H A;  2IJ9 A;  2BND A;  3LL5 A;  3ZZF A;  3QUR A;  2JJ4 A;  4NDR A;  1E19 A;  2WXB A;  3WWN A;  4JZ8 A;  4NDR B;  1GSJ A;  4OLC A;  2BRX A;  3L76 A;  4A7W A;  1OHB A;  2E9Y A;  3U6U A;  3AAW A;  4AXS A;  2OGX A;  2RD5 A;  2AP9 A;  3AB2 A;  3K56 A;  1Z9D A;  3LKK A;  2JJX A;  4A7X A;  3ZZI A;  3C1N A;  4NDQ A;  3LL9 A;  2J4L A;  3QUO A;  2R8V A;  3EK6 A;  2HMF A;  3S6G A;  3KZF A;  2BNE A;  3K4O A;  3QVH A;  3QVF A;  4JZ9 A;  2JI5 A;  3D2P A;  4NDO B;  2WE4 A;  3D2M A;  2VA1 A;  4NDO A;  2J0W A;  3T7B A;  4F6T B;  4JZ7 A;  2R98 A;  4NDP A;  2J4J A;  1YBD A;  4I49 A;  3C1M A;  1OH9 A;  2AKO A;  4AB7 A;  3TVI A;  2BTY A;  2V4Y A;  4KZT A;  1OHA A;  3B8G A;  3AB4 A;  2BMU A;  4Q1T A;  3S6K A;  4F6T A;  2J5V A;  1B7B A;  3K52 A;  2J5T A;  2CDQ A;  2BUF A;  2X2W A;  4NDQ B;  3EK5 A;  3D40 A;  1GS5 A;  4NDP B;  2J4K A;  2W21 A;  3QUN A;  3S6H A;  2BRI A;  2A1F A;  2WE5 A;  2OGX B;  4USJ A;  3NWY A;  3L86 A;  3WWM A;  3K4Y A;  2J0X A;  3ZZH A;  3D41 A;  2BNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...