3QVHA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with adp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
260
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFGHGAIRHAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGAGGDTILPEVDARSPEQAYAALWGSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 260
sequence length 271
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qvhA00
3S6KA 2E9YA 1GSJA 2VA1A 3K56A 3C1MA 4NDRA 3ZZGA 3QUNA 3D41A 3S6GA 3QUOA 3C20A 4AB7A 2A1FA 3D40A 2RD5A 3ZZFA 3K52A 4A7WA 4NDOA 1OH9A 2V4YA 2WE5A 2J4LA 4JZ9A 4JZ8A 3K4OA 3AB4A 3K4YA 1OHAA 2BRIA 4A7XA 2BNEA 2WXBA 3LL9A 2OGXA 3QVHA 2J4JA 2JI5A 4AXSA 3D2PA 3LKKA 1OHBA 4NDQB 4I49A 1E19A 3ZZIA 2OGXB 3QVFA 2AKOA 3TVIA 3EK6A 3EK5A 1YBDA 2CDQA 3KZFA 2JJXA 4NDQA 3B8GA 4F6TB 3D2MA 4JZ7A 3LL5A 1B7BA 2BMUA 3U6UA 2W21A 2BTYA 3T7BA 3ZZHA 3AB2A 4USJA 3WWMA 2BNDA 3QURA 3WWNA 2HMFA 2V5HA 1GS5A 2X2WA 2J4KA 2J0WA 4KZTA 4Q1TA 4F6TA 2IJ9A 3L76A 2J5TA 1Z9DA 2J0XA 3AAWA 4NDPA 4OLCA 2WE4A 2BRXA 3S6HA 2BUFA 2J5VA 2R98A 3L86A 3NWYA 4NDPB 3C1NA 2BNFA 2R8VA 4NDRB 2AP9A 2JJ4A 4NDOB
chains in the Genus database with same CATH superfamily
3S6KA 2E9YA 1GSJA 2VA1A 3K56A 3C1MA 4NDRA 3ZZGA 3QUNA 3D41A 3S6GA 3QUOA 3C20A 4AB7A 2A1FA 3D40A 2RD5A 3ZZFA 3K52A 4A7WA 4NDOA 1OH9A 2V4YA 2WE5A 2J4LA 4JZ9A 4JZ8A 3K4OA 3AB4A 3K4YA 1OHAA 2BRIA 4A7XA 2BNEA 2WXBA 3LL9A 2OGXA 3QVHA 2J4JA 2JI5A 4AXSA 3D2PA 3LKKA 1OHBA 4NDQB 4I49A 1E19A 3ZZIA 2OGXB 3QVFA 2AKOA 3TVIA 3EK6A 3EK5A 1YBDA 2CDQA 3KZFA 2JJXA 4NDQA 3B8GA 4F6TB 3D2MA 4JZ7A 3LL5A 1B7BA 2BMUA 3U6UA 2W21A 2BTYA 3T7BA 3ZZHA 3AB2A 4USJA 3WWMA 2BNDA 3QURA 3WWNA 2HMFA 2V5HA 1GS5A 2X2WA 2J4KA 2J0WA 4KZTA 4Q1TA 4F6TA 2IJ9A 3L76A 2J5TA 1Z9DA 2J0XA 3AAWA 4NDPA 4OLCA 2WE4A 2BRXA 3S6HA 2BUFA 2J5VA 2R98A 3L86A 3NWYA 4NDPB 3C1NA 2BNFA 2R8VA 4NDRB 2AP9A 2JJ4A 4NDOB
chains in the Genus database with same CATH topology
3S6KA 2E9YA 1GSJA 2VA1A 3K56A 3C1MA 4NDRA 3ZZGA 3QUNA 3D41A 3S6GA 3QUOA 3C20A 4AB7A 2A1FA 3D40A 2RD5A 3ZZFA 3K52A 4A7WA 4NDOA 1OH9A 2V4YA 2WE5A 2J4LA 4JZ9A 4JZ8A 3K4OA 3AB4A 3K4YA 1OHAA 2BRIA 4A7XA 2BNEA 2WXBA 3LL9A 2OGXA 3QVHA 2J4JA 2JI5A 4AXSA 3D2PA 3LKKA 1OHBA 4NDQB 4I49A 1E19A 3ZZIA 2OGXB 3QVFA 2AKOA 3TVIA 3EK6A 3EK5A 1YBDA 2CDQA 3KZFA 2JJXA 4NDQA 3B8GA 4F6TB 3D2MA 4JZ7A 3LL5A 1B7BA 2BMUA 3U6UA 2W21A 2BTYA 3T7BA 3ZZHA 3AB2A 4USJA 3WWMA 2BNDA 3QURA 3WWNA 2HMFA 2V5HA 1GS5A 2X2WA 2J4KA 2J0WA 4KZTA 4Q1TA 4F6TA 2IJ9A 3L76A 2J5TA 1Z9DA 2J0XA 3AAWA 4NDPA 4OLCA 2WE4A 2BRXA 3S6HA 2BUFA 2J5VA 2R98A 3L86A 3NWYA 4NDPB 3C1NA 2BNFA 2R8VA 4NDRB 2AP9A 2JJ4A 4NDOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  2E9Y A;  1GSJ A;  2VA1 A;  3K56 A;  3C1M A;  4NDR A;  3ZZG A;  3QUN A;  3D41 A;  3S6G A;  3QUO A;  3C20 A;  4AB7 A;  2A1F A;  3D40 A;  2RD5 A;  3ZZF A;  3K52 A;  4A7W A;  4NDO A;  1OH9 A;  2V4Y A;  2WE5 A;  2J4L A;  4JZ9 A;  4JZ8 A;  3K4O A;  3AB4 A;  3K4Y A;  1OHA A;  2BRI A;  4A7X A;  2BNE A;  2WXB A;  3LL9 A;  2OGX A;  3QVH A;  2J4J A;  2JI5 A;  4AXS A;  3D2P A;  3LKK A;  1OHB A;  4NDQ B;  4I49 A;  1E19 A;  3ZZI A;  2OGX B;  3QVF A;  2AKO A;  3TVI A;  3EK6 A;  3EK5 A;  1YBD A;  2CDQ A;  3KZF A;  2JJX A;  4NDQ A;  3B8G A;  4F6T B;  3D2M A;  4JZ7 A;  3LL5 A;  1B7B A;  2BMU A;  3U6U A;  2W21 A;  2BTY A;  3T7B A;  3ZZH A;  3AB2 A;  4USJ A;  3WWM A;  2BND A;  3QUR A;  3WWN A;  2HMF A;  2V5H A;  1GS5 A;  2X2W A;  2J4K A;  2J0W A;  4KZT A;  4Q1T A;  4F6T A;  2IJ9 A;  3L76 A;  2J5T A;  1Z9D A;  2J0X A;  3AAW A;  4NDP A;  4OLC A;  2WE4 A;  2BRX A;  3S6H A;  2BUF A;  2J5V A;  2R98 A;  3L86 A;  3NWY A;  4NDP B;  3C1N A;  2BNF A;  2R8V A;  4NDR B;  2AP9 A;  2JJ4 A;  4NDO B; 
#chains in the Genus database with same CATH topology
 3S6K A;  2E9Y A;  1GSJ A;  2VA1 A;  3K56 A;  3C1M A;  4NDR A;  3ZZG A;  3QUN A;  3D41 A;  3S6G A;  3QUO A;  3C20 A;  4AB7 A;  2A1F A;  3D40 A;  2RD5 A;  3ZZF A;  3K52 A;  4A7W A;  4NDO A;  1OH9 A;  2V4Y A;  2WE5 A;  2J4L A;  4JZ9 A;  4JZ8 A;  3K4O A;  3AB4 A;  3K4Y A;  1OHA A;  2BRI A;  4A7X A;  2BNE A;  2WXB A;  3LL9 A;  2OGX A;  3QVH A;  2J4J A;  2JI5 A;  4AXS A;  3D2P A;  3LKK A;  1OHB A;  4NDQ B;  4I49 A;  1E19 A;  3ZZI A;  2OGX B;  3QVF A;  2AKO A;  3TVI A;  3EK6 A;  3EK5 A;  1YBD A;  2CDQ A;  3KZF A;  2JJX A;  4NDQ A;  3B8G A;  4F6T B;  3D2M A;  4JZ7 A;  3LL5 A;  1B7B A;  2BMU A;  3U6U A;  2W21 A;  2BTY A;  3T7B A;  3ZZH A;  3AB2 A;  4USJ A;  3WWM A;  2BND A;  3QUR A;  3WWN A;  2HMF A;  2V5H A;  1GS5 A;  2X2W A;  2J4K A;  2J0W A;  4KZT A;  4Q1T A;  4F6T A;  2IJ9 A;  3L76 A;  2J5T A;  1Z9D A;  2J0X A;  3AAW A;  4NDP A;  4OLC A;  2WE4 A;  2BRX A;  3S6H A;  2BUF A;  2J5V A;  2R98 A;  3L86 A;  3NWY A;  4NDP B;  3C1N A;  2BNF A;  2R8V A;  4NDR B;  2AP9 A;  2JJ4 A;  4NDO B; 
#chains in the Genus database with same CATH homology
 3S6K A;  2E9Y A;  1GSJ A;  2VA1 A;  3K56 A;  3C1M A;  4NDR A;  3ZZG A;  3QUN A;  3D41 A;  3S6G A;  3QUO A;  3C20 A;  4AB7 A;  2A1F A;  3D40 A;  2RD5 A;  3ZZF A;  3K52 A;  4A7W A;  4NDO A;  1OH9 A;  2V4Y A;  2WE5 A;  2J4L A;  4JZ9 A;  4JZ8 A;  3K4O A;  3AB4 A;  3K4Y A;  1OHA A;  2BRI A;  4A7X A;  2BNE A;  2WXB A;  3LL9 A;  2OGX A;  3QVH A;  2J4J A;  2JI5 A;  4AXS A;  3D2P A;  3LKK A;  1OHB A;  4NDQ B;  4I49 A;  1E19 A;  3ZZI A;  2OGX B;  3QVF A;  2AKO A;  3TVI A;  3EK6 A;  3EK5 A;  1YBD A;  2CDQ A;  3KZF A;  2JJX A;  4NDQ A;  3B8G A;  4F6T B;  3D2M A;  4JZ7 A;  3LL5 A;  1B7B A;  2BMU A;  3U6U A;  2W21 A;  2BTY A;  3T7B A;  3ZZH A;  3AB2 A;  4USJ A;  3WWM A;  2BND A;  3QUR A;  3WWN A;  2HMF A;  2V5H A;  1GS5 A;  2X2W A;  2J4K A;  2J0W A;  4KZT A;  4Q1T A;  4F6T A;  2IJ9 A;  3L76 A;  2J5T A;  1Z9D A;  2J0X A;  3AAW A;  4NDP A;  4OLC A;  2WE4 A;  2BRX A;  3S6H A;  2BUF A;  2J5V A;  2R98 A;  3L86 A;  3NWY A;  4NDP B;  3C1N A;  2BNF A;  2R8V A;  4NDR B;  2AP9 A;  2JJ4 A;  4NDO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...