3QVHA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with adp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
260
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFGHGAIRHAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGAGGDTILPEVDARSPEQAYAALWGSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
molecule keywords FomA protein
total genus 79
structure length 260
sequence length 271
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qvhA00
4A7XA 3K52A 2HMFA 4F6TA 3QVFA 4I49A 2BMUA 2E9YA 2VA1A 2BRXA 4AB7A 3D41A 3QVHA 4Q1TA 2JJ4A 3B8GA 3ZZGA 3C20A 4JZ8A 2V5HA 3LL5A 3C1MA 3S6GA 2J4KA 3LL9A 3D2PA 2V4YA 3EK6A 2J4LA 1Z9DA 3K4YA 3LKKA 1GS5A 3C1NA 3QURA 2WXBA 1YBDA 2WE4A 4JZ9A 3AB2A 3L86A 2BNEA 2JI5A 2J4JA 4USJA 2RD5A 3D2MA 2R8VA 4NDOA 3TVIA 2BNDA 3AB4A 2J0WA 4NDRB 4AXSA 3ZZHA 1B7BA 3U6UA 4NDRA 4JZ7A 3D40A 2X2WA 4NDQB 3T7BA 3S6KA 2R98A 3WWMA 3QUOA 4F6TB 2JJXA 2J5TA 3WWNA 4NDPB 3K4OA 3QUNA 3ZZFA 3AAWA 1E19A 4NDPA 4OLCA 2BNFA 1OH9A 1OHBA 4KZTA 3K56A 2BUFA 2BTYA 3EK5A 2AP9A 2J0XA 3L76A 2OGXA 3ZZIA 4A7WA 3KZFA 2IJ9A 2CDQA 2AKOA 2OGXB 1OHAA 2BRIA 3S6HA 1GSJA 2A1FA 2W21A 2J5VA 4NDOB 4NDQA 3NWYA 2WE5A
chains in the Genus database with same CATH superfamily
4A7XA 3K52A 2HMFA 4F6TA 3QVFA 4I49A 2BMUA 2E9YA 2VA1A 2BRXA 4AB7A 3D41A 3QVHA 4Q1TA 2JJ4A 3B8GA 3ZZGA 3C20A 4JZ8A 2V5HA 3LL5A 3C1MA 3S6GA 2J4KA 3LL9A 3D2PA 2V4YA 3EK6A 2J4LA 1Z9DA 3K4YA 3LKKA 1GS5A 3C1NA 3QURA 2WXBA 1YBDA 2WE4A 4JZ9A 3AB2A 3L86A 2BNEA 2JI5A 2J4JA 4USJA 2RD5A 3D2MA 2R8VA 4NDOA 3TVIA 2BNDA 3AB4A 2J0WA 4NDRB 4AXSA 3ZZHA 1B7BA 3U6UA 4NDRA 4JZ7A 3D40A 2X2WA 4NDQB 3T7BA 3S6KA 2R98A 3WWMA 3QUOA 4F6TB 2JJXA 2J5TA 3WWNA 4NDPB 3K4OA 3QUNA 3ZZFA 3AAWA 1E19A 4NDPA 4OLCA 2BNFA 1OH9A 1OHBA 4KZTA 3K56A 2BUFA 2BTYA 3EK5A 2AP9A 2J0XA 3L76A 2OGXA 3ZZIA 4A7WA 3KZFA 2IJ9A 2CDQA 2AKOA 2OGXB 1OHAA 2BRIA 3S6HA 1GSJA 2A1FA 2W21A 2J5VA 4NDOB 4NDQA 3NWYA 2WE5A
chains in the Genus database with same CATH topology
4A7XA 3K52A 2HMFA 4F6TA 3QVFA 4I49A 2BMUA 2E9YA 2VA1A 2BRXA 4AB7A 3D41A 3QVHA 4Q1TA 2JJ4A 3B8GA 3ZZGA 3C20A 4JZ8A 2V5HA 3LL5A 3C1MA 3S6GA 2J4KA 3LL9A 3D2PA 2V4YA 3EK6A 2J4LA 1Z9DA 3K4YA 3LKKA 1GS5A 3C1NA 3QURA 2WXBA 1YBDA 2WE4A 4JZ9A 3AB2A 3L86A 2BNEA 2JI5A 2J4JA 4USJA 2RD5A 3D2MA 2R8VA 4NDOA 3TVIA 2BNDA 3AB4A 2J0WA 4NDRB 4AXSA 3ZZHA 1B7BA 3U6UA 4NDRA 4JZ7A 3D40A 2X2WA 4NDQB 3T7BA 3S6KA 2R98A 3WWMA 3QUOA 4F6TB 2JJXA 2J5TA 3WWNA 4NDPB 3K4OA 3QUNA 3ZZFA 3AAWA 1E19A 4NDPA 4OLCA 2BNFA 1OH9A 1OHBA 4KZTA 3K56A 2BUFA 2BTYA 3EK5A 2AP9A 2J0XA 3L76A 2OGXA 3ZZIA 4A7WA 3KZFA 2IJ9A 2CDQA 2AKOA 2OGXB 1OHAA 2BRIA 3S6HA 1GSJA 2A1FA 2W21A 2J5VA 4NDOB 4NDQA 3NWYA 2WE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7X A;  3K52 A;  2HMF A;  4F6T A;  3QVF A;  4I49 A;  2BMU A;  2E9Y A;  2VA1 A;  2BRX A;  4AB7 A;  3D41 A;  3QVH A;  4Q1T A;  2JJ4 A;  3B8G A;  3ZZG A;  3C20 A;  4JZ8 A;  2V5H A;  3LL5 A;  3C1M A;  3S6G A;  2J4K A;  3LL9 A;  3D2P A;  2V4Y A;  3EK6 A;  2J4L A;  1Z9D A;  3K4Y A;  3LKK A;  1GS5 A;  3C1N A;  3QUR A;  2WXB A;  1YBD A;  2WE4 A;  4JZ9 A;  3AB2 A;  3L86 A;  2BNE A;  2JI5 A;  2J4J A;  4USJ A;  2RD5 A;  3D2M A;  2R8V A;  4NDO A;  3TVI A;  2BND A;  3AB4 A;  2J0W A;  4NDR B;  4AXS A;  3ZZH A;  1B7B A;  3U6U A;  4NDR A;  4JZ7 A;  3D40 A;  2X2W A;  4NDQ B;  3T7B A;  3S6K A;  2R98 A;  3WWM A;  3QUO A;  4F6T B;  2JJX A;  2J5T A;  3WWN A;  4NDP B;  3K4O A;  3QUN A;  3ZZF A;  3AAW A;  1E19 A;  4NDP A;  4OLC A;  2BNF A;  1OH9 A;  1OHB A;  4KZT A;  3K56 A;  2BUF A;  2BTY A;  3EK5 A;  2AP9 A;  2J0X A;  3L76 A;  2OGX A;  3ZZI A;  4A7W A;  3KZF A;  2IJ9 A;  2CDQ A;  2AKO A;  2OGX B;  1OHA A;  2BRI A;  3S6H A;  1GSJ A;  2A1F A;  2W21 A;  2J5V A;  4NDO B;  4NDQ A;  3NWY A;  2WE5 A; 
#chains in the Genus database with same CATH topology
 4A7X A;  3K52 A;  2HMF A;  4F6T A;  3QVF A;  4I49 A;  2BMU A;  2E9Y A;  2VA1 A;  2BRX A;  4AB7 A;  3D41 A;  3QVH A;  4Q1T A;  2JJ4 A;  3B8G A;  3ZZG A;  3C20 A;  4JZ8 A;  2V5H A;  3LL5 A;  3C1M A;  3S6G A;  2J4K A;  3LL9 A;  3D2P A;  2V4Y A;  3EK6 A;  2J4L A;  1Z9D A;  3K4Y A;  3LKK A;  1GS5 A;  3C1N A;  3QUR A;  2WXB A;  1YBD A;  2WE4 A;  4JZ9 A;  3AB2 A;  3L86 A;  2BNE A;  2JI5 A;  2J4J A;  4USJ A;  2RD5 A;  3D2M A;  2R8V A;  4NDO A;  3TVI A;  2BND A;  3AB4 A;  2J0W A;  4NDR B;  4AXS A;  3ZZH A;  1B7B A;  3U6U A;  4NDR A;  4JZ7 A;  3D40 A;  2X2W A;  4NDQ B;  3T7B A;  3S6K A;  2R98 A;  3WWM A;  3QUO A;  4F6T B;  2JJX A;  2J5T A;  3WWN A;  4NDP B;  3K4O A;  3QUN A;  3ZZF A;  3AAW A;  1E19 A;  4NDP A;  4OLC A;  2BNF A;  1OH9 A;  1OHB A;  4KZT A;  3K56 A;  2BUF A;  2BTY A;  3EK5 A;  2AP9 A;  2J0X A;  3L76 A;  2OGX A;  3ZZI A;  4A7W A;  3KZF A;  2IJ9 A;  2CDQ A;  2AKO A;  2OGX B;  1OHA A;  2BRI A;  3S6H A;  1GSJ A;  2A1F A;  2W21 A;  2J5V A;  4NDO B;  4NDQ A;  3NWY A;  2WE5 A; 
#chains in the Genus database with same CATH homology
 4A7X A;  3K52 A;  2HMF A;  4F6T A;  3QVF A;  4I49 A;  2BMU A;  2E9Y A;  2VA1 A;  2BRX A;  4AB7 A;  3D41 A;  3QVH A;  4Q1T A;  2JJ4 A;  3B8G A;  3ZZG A;  3C20 A;  4JZ8 A;  2V5H A;  3LL5 A;  3C1M A;  3S6G A;  2J4K A;  3LL9 A;  3D2P A;  2V4Y A;  3EK6 A;  2J4L A;  1Z9D A;  3K4Y A;  3LKK A;  1GS5 A;  3C1N A;  3QUR A;  2WXB A;  1YBD A;  2WE4 A;  4JZ9 A;  3AB2 A;  3L86 A;  2BNE A;  2JI5 A;  2J4J A;  4USJ A;  2RD5 A;  3D2M A;  2R8V A;  4NDO A;  3TVI A;  2BND A;  3AB4 A;  2J0W A;  4NDR B;  4AXS A;  3ZZH A;  1B7B A;  3U6U A;  4NDR A;  4JZ7 A;  3D40 A;  2X2W A;  4NDQ B;  3T7B A;  3S6K A;  2R98 A;  3WWM A;  3QUO A;  4F6T B;  2JJX A;  2J5T A;  3WWN A;  4NDP B;  3K4O A;  3QUN A;  3ZZF A;  3AAW A;  1E19 A;  4NDP A;  4OLC A;  2BNF A;  1OH9 A;  1OHB A;  4KZT A;  3K56 A;  2BUF A;  2BTY A;  3EK5 A;  2AP9 A;  2J0X A;  3L76 A;  2OGX A;  3ZZI A;  4A7W A;  3KZF A;  2IJ9 A;  2CDQ A;  2AKO A;  2OGX B;  1OHA A;  2BRI A;  3S6H A;  1GSJ A;  2A1F A;  2W21 A;  2J5V A;  4NDO B;  4NDQ A;  3NWY A;  2WE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...