3QVHA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with adp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
260
Chain Sequence
b'SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFGHGAIRHAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGAGGDTILPEVDARSPEQAYAALWGSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 260
sequence length 271
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qvhA00
1OHBA 4NDOB 2AKOA 4NDRB 3C1MA 3NWYA 4OLCA 3S6KA 3ZZFA 2JJXA 2J5VA 2J5TA 2BNDA 4AXSA 4NDPA 3QUNA 3ZZHA 2R8VA 4F6TA 1E19A 2JJ4A 3WWNA 2X2WA 3LL9A 3L76A 3C20A 4KZTA 4A7XA 1GSJA 3ZZIA 2BRXA 3AAWA 1YBDA 3K56A 3QURA 4A7WA 3EK6A 4NDPB 2J4KA 2BNFA 2AP9A 4F6TB 3U6UA 3QVHA 3LKKA 2BUFA 4NDQA 3B8GA 4Q1TA 2BTYA 3K52A 2A1FA 3TVIA 2OGXA 4AB7A 2J4JA 2J0XA 3KZFA 3T7BA 2V4YA 2R98A 4JZ7A 3D2MA 2CDQA 1Z9DA 3K4YA 2J0WA 3WWMA 4I49A 3D40A 2BRIA 2IJ9A 1B7BA 2JI5A 4NDQB 2BMUA 3AB4A 1OH9A 3AB2A 2WE4A 2VA1A 2OGXB 2WE5A 2J4LA 2WXBA 1OHAA 3EK5A 3D2PA 3QUOA 3C1NA 2BNEA 2HMFA 4JZ9A 4NDOA 4NDRA 3QVFA 2V5HA 2E9YA 3S6GA 3K4OA 2W21A 4USJA 3LL5A 1GS5A 2RD5A 4JZ8A 3S6HA 3D41A 3ZZGA 3L86A
chains in the Genus database with same CATH superfamily
1OHBA 4NDOB 2AKOA 4NDRB 3C1MA 3NWYA 4OLCA 3S6KA 3ZZFA 2JJXA 2J5VA 2J5TA 2BNDA 4AXSA 4NDPA 3QUNA 3ZZHA 2R8VA 4F6TA 1E19A 2JJ4A 3WWNA 2X2WA 3LL9A 3L76A 3C20A 4KZTA 4A7XA 1GSJA 3ZZIA 2BRXA 3AAWA 1YBDA 3K56A 3QURA 4A7WA 3EK6A 4NDPB 2J4KA 2BNFA 2AP9A 4F6TB 3U6UA 3QVHA 3LKKA 2BUFA 4NDQA 3B8GA 4Q1TA 2BTYA 3K52A 2A1FA 3TVIA 2OGXA 4AB7A 2J4JA 2J0XA 3KZFA 3T7BA 2V4YA 2R98A 4JZ7A 3D2MA 2CDQA 1Z9DA 3K4YA 2J0WA 3WWMA 4I49A 3D40A 2BRIA 2IJ9A 1B7BA 2JI5A 4NDQB 2BMUA 3AB4A 1OH9A 3AB2A 2WE4A 2VA1A 2OGXB 2WE5A 2J4LA 2WXBA 1OHAA 3EK5A 3D2PA 3QUOA 3C1NA 2BNEA 2HMFA 4JZ9A 4NDOA 4NDRA 3QVFA 2V5HA 2E9YA 3S6GA 3K4OA 2W21A 4USJA 3LL5A 1GS5A 2RD5A 4JZ8A 3S6HA 3D41A 3ZZGA 3L86A
chains in the Genus database with same CATH topology
1OHBA 4NDOB 2AKOA 4NDRB 3C1MA 3NWYA 4OLCA 3S6KA 3ZZFA 2JJXA 2J5VA 2J5TA 2BNDA 4AXSA 4NDPA 3QUNA 3ZZHA 2R8VA 4F6TA 1E19A 2JJ4A 3WWNA 2X2WA 3LL9A 3L76A 3C20A 4KZTA 4A7XA 1GSJA 3ZZIA 2BRXA 3AAWA 1YBDA 3K56A 3QURA 4A7WA 3EK6A 4NDPB 2J4KA 2BNFA 2AP9A 4F6TB 3U6UA 3QVHA 3LKKA 2BUFA 4NDQA 3B8GA 4Q1TA 2BTYA 3K52A 2A1FA 3TVIA 2OGXA 4AB7A 2J4JA 2J0XA 3KZFA 3T7BA 2V4YA 2R98A 4JZ7A 3D2MA 2CDQA 1Z9DA 3K4YA 2J0WA 3WWMA 4I49A 3D40A 2BRIA 2IJ9A 1B7BA 2JI5A 4NDQB 2BMUA 3AB4A 1OH9A 3AB2A 2WE4A 2VA1A 2OGXB 2WE5A 2J4LA 2WXBA 1OHAA 3EK5A 3D2PA 3QUOA 3C1NA 2BNEA 2HMFA 4JZ9A 4NDOA 4NDRA 3QVFA 2V5HA 2E9YA 3S6GA 3K4OA 2W21A 4USJA 3LL5A 1GS5A 2RD5A 4JZ8A 3S6HA 3D41A 3ZZGA 3L86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHB A;  4NDO B;  2AKO A;  4NDR B;  3C1M A;  3NWY A;  4OLC A;  3S6K A;  3ZZF A;  2JJX A;  2J5V A;  2J5T A;  2BND A;  4AXS A;  4NDP A;  3QUN A;  3ZZH A;  2R8V A;  4F6T A;  1E19 A;  2JJ4 A;  3WWN A;  2X2W A;  3LL9 A;  3L76 A;  3C20 A;  4KZT A;  4A7X A;  1GSJ A;  3ZZI A;  2BRX A;  3AAW A;  1YBD A;  3K56 A;  3QUR A;  4A7W A;  3EK6 A;  4NDP B;  2J4K A;  2BNF A;  2AP9 A;  4F6T B;  3U6U A;  3QVH A;  3LKK A;  2BUF A;  4NDQ A;  3B8G A;  4Q1T A;  2BTY A;  3K52 A;  2A1F A;  3TVI A;  2OGX A;  4AB7 A;  2J4J A;  2J0X A;  3KZF A;  3T7B A;  2V4Y A;  2R98 A;  4JZ7 A;  3D2M A;  2CDQ A;  1Z9D A;  3K4Y A;  2J0W A;  3WWM A;  4I49 A;  3D40 A;  2BRI A;  2IJ9 A;  1B7B A;  2JI5 A;  4NDQ B;  2BMU A;  3AB4 A;  1OH9 A;  3AB2 A;  2WE4 A;  2VA1 A;  2OGX B;  2WE5 A;  2J4L A;  2WXB A;  1OHA A;  3EK5 A;  3D2P A;  3QUO A;  3C1N A;  2BNE A;  2HMF A;  4JZ9 A;  4NDO A;  4NDR A;  3QVF A;  2V5H A;  2E9Y A;  3S6G A;  3K4O A;  2W21 A;  4USJ A;  3LL5 A;  1GS5 A;  2RD5 A;  4JZ8 A;  3S6H A;  3D41 A;  3ZZG A;  3L86 A; 
#chains in the Genus database with same CATH topology
 1OHB A;  4NDO B;  2AKO A;  4NDR B;  3C1M A;  3NWY A;  4OLC A;  3S6K A;  3ZZF A;  2JJX A;  2J5V A;  2J5T A;  2BND A;  4AXS A;  4NDP A;  3QUN A;  3ZZH A;  2R8V A;  4F6T A;  1E19 A;  2JJ4 A;  3WWN A;  2X2W A;  3LL9 A;  3L76 A;  3C20 A;  4KZT A;  4A7X A;  1GSJ A;  3ZZI A;  2BRX A;  3AAW A;  1YBD A;  3K56 A;  3QUR A;  4A7W A;  3EK6 A;  4NDP B;  2J4K A;  2BNF A;  2AP9 A;  4F6T B;  3U6U A;  3QVH A;  3LKK A;  2BUF A;  4NDQ A;  3B8G A;  4Q1T A;  2BTY A;  3K52 A;  2A1F A;  3TVI A;  2OGX A;  4AB7 A;  2J4J A;  2J0X A;  3KZF A;  3T7B A;  2V4Y A;  2R98 A;  4JZ7 A;  3D2M A;  2CDQ A;  1Z9D A;  3K4Y A;  2J0W A;  3WWM A;  4I49 A;  3D40 A;  2BRI A;  2IJ9 A;  1B7B A;  2JI5 A;  4NDQ B;  2BMU A;  3AB4 A;  1OH9 A;  3AB2 A;  2WE4 A;  2VA1 A;  2OGX B;  2WE5 A;  2J4L A;  2WXB A;  1OHA A;  3EK5 A;  3D2P A;  3QUO A;  3C1N A;  2BNE A;  2HMF A;  4JZ9 A;  4NDO A;  4NDR A;  3QVF A;  2V5H A;  2E9Y A;  3S6G A;  3K4O A;  2W21 A;  4USJ A;  3LL5 A;  1GS5 A;  2RD5 A;  4JZ8 A;  3S6H A;  3D41 A;  3ZZG A;  3L86 A; 
#chains in the Genus database with same CATH homology
 1OHB A;  4NDO B;  2AKO A;  4NDR B;  3C1M A;  3NWY A;  4OLC A;  3S6K A;  3ZZF A;  2JJX A;  2J5V A;  2J5T A;  2BND A;  4AXS A;  4NDP A;  3QUN A;  3ZZH A;  2R8V A;  4F6T A;  1E19 A;  2JJ4 A;  3WWN A;  2X2W A;  3LL9 A;  3L76 A;  3C20 A;  4KZT A;  4A7X A;  1GSJ A;  3ZZI A;  2BRX A;  3AAW A;  1YBD A;  3K56 A;  3QUR A;  4A7W A;  3EK6 A;  4NDP B;  2J4K A;  2BNF A;  2AP9 A;  4F6T B;  3U6U A;  3QVH A;  3LKK A;  2BUF A;  4NDQ A;  3B8G A;  4Q1T A;  2BTY A;  3K52 A;  2A1F A;  3TVI A;  2OGX A;  4AB7 A;  2J4J A;  2J0X A;  3KZF A;  3T7B A;  2V4Y A;  2R98 A;  4JZ7 A;  3D2M A;  2CDQ A;  1Z9D A;  3K4Y A;  2J0W A;  3WWM A;  4I49 A;  3D40 A;  2BRI A;  2IJ9 A;  1B7B A;  2JI5 A;  4NDQ B;  2BMU A;  3AB4 A;  1OH9 A;  3AB2 A;  2WE4 A;  2VA1 A;  2OGX B;  2WE5 A;  2J4L A;  2WXB A;  1OHA A;  3EK5 A;  3D2P A;  3QUO A;  3C1N A;  2BNE A;  2HMF A;  4JZ9 A;  4NDO A;  4NDR A;  3QVF A;  2V5H A;  2E9Y A;  3S6G A;  3K4O A;  2W21 A;  4USJ A;  3LL5 A;  1GS5 A;  2RD5 A;  4JZ8 A;  3S6H A;  3D41 A;  3ZZG A;  3L86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...