3QVHA

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with adp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
260
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFGHGAIRHAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGAGGDTILPEVDARSPEQAYAALWGSGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Structural and biochemical insights into the mechanism of fosfomycin phosphorylation by fosfomycin resistance kinase FomA.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 260
sequence length 271
ec nomenclature
pdb deposition date 2011-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3qvhA00
4NDPA 3AB2A 4KZTA 3D2PA 2JI5A 3ZZFA 2JJ4A 2W21A 1GSJA 3C1MA 4F6TA 3ZZHA 3C20A 3LL9A 2R8VA 3EK5A 2IJ9A 3QVFA 4NDQB 4JZ7A 3AB4A 2A1FA 2J4JA 3D40A 3B8GA 3TVIA 2WE4A 1E19A 4USJA 3D2MA 2J0XA 1OHBA 2BMUA 2X2WA 4NDOB 2BRIA 2RD5A 1Z9DA 3S6GA 2CDQA 4AXSA 2AP9A 4NDRB 2BNDA 4NDQA 3AAWA 4OLCA 3K4YA 1OHAA 2R98A 2J4LA 3KZFA 2BNEA 2V4YA 3U6UA 3ZZIA 4AB7A 3LL5A 2HMFA 2VA1A 2OGXB 4Q1TA 3S6HA 4NDOA 2JJXA 3QUOA 3WWNA 2WXBA 2E9YA 3QUNA 4NDRA 3C1NA 3LKKA 3L86A 3NWYA 2BNFA 2J5TA 2V5HA 3D41A 1OH9A 1B7BA 2WE5A 4NDPB 2BUFA 3ZZGA 2BTYA 3QURA 3K4OA 2J5VA 4I49A 3K52A 3WWMA 2OGXA 2AKOA 3T7BA 4F6TB 1YBDA 4JZ8A 2J0WA 2J4KA 3K56A 4JZ9A 3S6KA 3QVHA 1GS5A 2BRXA 4A7WA 3EK6A 3L76A 4A7XA
chains in the Genus database with same CATH superfamily
4NDPA 3AB2A 4KZTA 3D2PA 2JI5A 3ZZFA 2JJ4A 2W21A 1GSJA 3C1MA 4F6TA 3ZZHA 3C20A 3LL9A 2R8VA 3EK5A 2IJ9A 3QVFA 4NDQB 4JZ7A 3AB4A 2A1FA 2J4JA 3D40A 3B8GA 3TVIA 2WE4A 1E19A 4USJA 3D2MA 2J0XA 1OHBA 2BMUA 2X2WA 4NDOB 2BRIA 2RD5A 1Z9DA 3S6GA 2CDQA 4AXSA 2AP9A 4NDRB 2BNDA 4NDQA 3AAWA 4OLCA 3K4YA 1OHAA 2R98A 2J4LA 3KZFA 2BNEA 2V4YA 3U6UA 3ZZIA 4AB7A 3LL5A 2HMFA 2VA1A 2OGXB 4Q1TA 3S6HA 4NDOA 2JJXA 3QUOA 3WWNA 2WXBA 2E9YA 3QUNA 4NDRA 3C1NA 3LKKA 3L86A 3NWYA 2BNFA 2J5TA 2V5HA 3D41A 1OH9A 1B7BA 2WE5A 4NDPB 2BUFA 3ZZGA 2BTYA 3QURA 3K4OA 2J5VA 4I49A 3K52A 3WWMA 2OGXA 2AKOA 3T7BA 4F6TB 1YBDA 4JZ8A 2J0WA 2J4KA 3K56A 4JZ9A 3S6KA 3QVHA 1GS5A 2BRXA 4A7WA 3EK6A 3L76A 4A7XA
chains in the Genus database with same CATH topology
4NDPA 3AB2A 4KZTA 3D2PA 2JI5A 3ZZFA 2JJ4A 2W21A 1GSJA 3C1MA 4F6TA 3ZZHA 3C20A 3LL9A 2R8VA 3EK5A 2IJ9A 3QVFA 4NDQB 4JZ7A 3AB4A 2A1FA 2J4JA 3D40A 3B8GA 3TVIA 2WE4A 1E19A 4USJA 3D2MA 2J0XA 1OHBA 2BMUA 2X2WA 4NDOB 2BRIA 2RD5A 1Z9DA 3S6GA 2CDQA 4AXSA 2AP9A 4NDRB 2BNDA 4NDQA 3AAWA 4OLCA 3K4YA 1OHAA 2R98A 2J4LA 3KZFA 2BNEA 2V4YA 3U6UA 3ZZIA 4AB7A 3LL5A 2HMFA 2VA1A 2OGXB 4Q1TA 3S6HA 4NDOA 2JJXA 3QUOA 3WWNA 2WXBA 2E9YA 3QUNA 4NDRA 3C1NA 3LKKA 3L86A 3NWYA 2BNFA 2J5TA 2V5HA 3D41A 1OH9A 1B7BA 2WE5A 4NDPB 2BUFA 3ZZGA 2BTYA 3QURA 3K4OA 2J5VA 4I49A 3K52A 3WWMA 2OGXA 2AKOA 3T7BA 4F6TB 1YBDA 4JZ8A 2J0WA 2J4KA 3K56A 4JZ9A 3S6KA 3QVHA 1GS5A 2BRXA 4A7WA 3EK6A 3L76A 4A7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDP A;  3AB2 A;  4KZT A;  3D2P A;  2JI5 A;  3ZZF A;  2JJ4 A;  2W21 A;  1GSJ A;  3C1M A;  4F6T A;  3ZZH A;  3C20 A;  3LL9 A;  2R8V A;  3EK5 A;  2IJ9 A;  3QVF A;  4NDQ B;  4JZ7 A;  3AB4 A;  2A1F A;  2J4J A;  3D40 A;  3B8G A;  3TVI A;  2WE4 A;  1E19 A;  4USJ A;  3D2M A;  2J0X A;  1OHB A;  2BMU A;  2X2W A;  4NDO B;  2BRI A;  2RD5 A;  1Z9D A;  3S6G A;  2CDQ A;  4AXS A;  2AP9 A;  4NDR B;  2BND A;  4NDQ A;  3AAW A;  4OLC A;  3K4Y A;  1OHA A;  2R98 A;  2J4L A;  3KZF A;  2BNE A;  2V4Y A;  3U6U A;  3ZZI A;  4AB7 A;  3LL5 A;  2HMF A;  2VA1 A;  2OGX B;  4Q1T A;  3S6H A;  4NDO A;  2JJX A;  3QUO A;  3WWN A;  2WXB A;  2E9Y A;  3QUN A;  4NDR A;  3C1N A;  3LKK A;  3L86 A;  3NWY A;  2BNF A;  2J5T A;  2V5H A;  3D41 A;  1OH9 A;  1B7B A;  2WE5 A;  4NDP B;  2BUF A;  3ZZG A;  2BTY A;  3QUR A;  3K4O A;  2J5V A;  4I49 A;  3K52 A;  3WWM A;  2OGX A;  2AKO A;  3T7B A;  4F6T B;  1YBD A;  4JZ8 A;  2J0W A;  2J4K A;  3K56 A;  4JZ9 A;  3S6K A;  3QVH A;  1GS5 A;  2BRX A;  4A7W A;  3EK6 A;  3L76 A;  4A7X A; 
#chains in the Genus database with same CATH topology
 4NDP A;  3AB2 A;  4KZT A;  3D2P A;  2JI5 A;  3ZZF A;  2JJ4 A;  2W21 A;  1GSJ A;  3C1M A;  4F6T A;  3ZZH A;  3C20 A;  3LL9 A;  2R8V A;  3EK5 A;  2IJ9 A;  3QVF A;  4NDQ B;  4JZ7 A;  3AB4 A;  2A1F A;  2J4J A;  3D40 A;  3B8G A;  3TVI A;  2WE4 A;  1E19 A;  4USJ A;  3D2M A;  2J0X A;  1OHB A;  2BMU A;  2X2W A;  4NDO B;  2BRI A;  2RD5 A;  1Z9D A;  3S6G A;  2CDQ A;  4AXS A;  2AP9 A;  4NDR B;  2BND A;  4NDQ A;  3AAW A;  4OLC A;  3K4Y A;  1OHA A;  2R98 A;  2J4L A;  3KZF A;  2BNE A;  2V4Y A;  3U6U A;  3ZZI A;  4AB7 A;  3LL5 A;  2HMF A;  2VA1 A;  2OGX B;  4Q1T A;  3S6H A;  4NDO A;  2JJX A;  3QUO A;  3WWN A;  2WXB A;  2E9Y A;  3QUN A;  4NDR A;  3C1N A;  3LKK A;  3L86 A;  3NWY A;  2BNF A;  2J5T A;  2V5H A;  3D41 A;  1OH9 A;  1B7B A;  2WE5 A;  4NDP B;  2BUF A;  3ZZG A;  2BTY A;  3QUR A;  3K4O A;  2J5V A;  4I49 A;  3K52 A;  3WWM A;  2OGX A;  2AKO A;  3T7B A;  4F6T B;  1YBD A;  4JZ8 A;  2J0W A;  2J4K A;  3K56 A;  4JZ9 A;  3S6K A;  3QVH A;  1GS5 A;  2BRX A;  4A7W A;  3EK6 A;  3L76 A;  4A7X A; 
#chains in the Genus database with same CATH homology
 4NDP A;  3AB2 A;  4KZT A;  3D2P A;  2JI5 A;  3ZZF A;  2JJ4 A;  2W21 A;  1GSJ A;  3C1M A;  4F6T A;  3ZZH A;  3C20 A;  3LL9 A;  2R8V A;  3EK5 A;  2IJ9 A;  3QVF A;  4NDQ B;  4JZ7 A;  3AB4 A;  2A1F A;  2J4J A;  3D40 A;  3B8G A;  3TVI A;  2WE4 A;  1E19 A;  4USJ A;  3D2M A;  2J0X A;  1OHB A;  2BMU A;  2X2W A;  4NDO B;  2BRI A;  2RD5 A;  1Z9D A;  3S6G A;  2CDQ A;  4AXS A;  2AP9 A;  4NDR B;  2BND A;  4NDQ A;  3AAW A;  4OLC A;  3K4Y A;  1OHA A;  2R98 A;  2J4L A;  3KZF A;  2BNE A;  2V4Y A;  3U6U A;  3ZZI A;  4AB7 A;  3LL5 A;  2HMF A;  2VA1 A;  2OGX B;  4Q1T A;  3S6H A;  4NDO A;  2JJX A;  3QUO A;  3WWN A;  2WXB A;  2E9Y A;  3QUN A;  4NDR A;  3C1N A;  3LKK A;  3L86 A;  3NWY A;  2BNF A;  2J5T A;  2V5H A;  3D41 A;  1OH9 A;  1B7B A;  2WE5 A;  4NDP B;  2BUF A;  3ZZG A;  2BTY A;  3QUR A;  3K4O A;  2J5V A;  4I49 A;  3K52 A;  3WWM A;  2OGX A;  2AKO A;  3T7B A;  4F6T B;  1YBD A;  4JZ8 A;  2J0W A;  2J4K A;  3K56 A;  4JZ9 A;  3S6K A;  3QVH A;  1GS5 A;  2BRX A;  4A7W A;  3EK6 A;  3L76 A;  4A7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...