2JJXA

The crystal structure of ump kinase from bacillus anthracis (ba1797)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
RPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTIINSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVAKQGVDGVFTSDPKHNKSAKMYRKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDDASLLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Ump Kinase from Bacillus Anthracis (Ba1797) Reveals an Allosteric Nucleotide-Binding Site.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 80
structure length 244
sequence length 244
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2jjxA00
3NWYA 2OGXB 2X2WA 2J5TA 4NDQA 2BUFA 3AB4A 3TVIA 4Q1TA 3L76A 1OHAA 1OH9A 3QVFA 2W21A 4JZ7A 4NDPB 3B8GA 2AKOA 1GSJA 2BNEA 1E19A 3LL9A 3S6GA 2CDQA 3D2MA 3ZZIA 4OLCA 3C1MA 4NDOB 4A7WA 3KZFA 2VA1A 1Z9DA 2E9YA 2BRIA 4NDRB 3K56A 3U6UA 3QUOA 4NDPA 3WWNA 3AAWA 3ZZHA 3T7BA 2V4YA 2BNDA 3AB2A 2HMFA 2BTYA 2J0WA 2J5VA 4A7XA 4USJA 2A1FA 2R98A 4KZTA 3C1NA 3K52A 2WE5A 4JZ9A 2J4KA 2JI5A 3EK6A 4F6TB 4NDQB 3C20A 1GS5A 3ZZFA 3K4OA 3D41A 2AP9A 2BNFA 3K4YA 3D40A 3S6HA 4AB7A 3QVHA 3QUNA 4NDRA 2BMUA 2R8VA 2RD5A 2JJ4A 1B7BA 4F6TA 4NDOA 2BRXA 3LL5A 3S6KA 4I49A 2OGXA 2IJ9A 2V5HA 2J0XA 1OHBA 3EK5A 4AXSA 2JJXA 1YBDA 2J4JA 3QURA 3L86A 2WXBA 2WE4A 3WWMA 4JZ8A 3LKKA 3ZZGA 2J4LA 3D2PA
chains in the Genus database with same CATH superfamily
3NWYA 2OGXB 2X2WA 2J5TA 4NDQA 2BUFA 3AB4A 3TVIA 4Q1TA 3L76A 1OHAA 1OH9A 3QVFA 2W21A 4JZ7A 4NDPB 3B8GA 2AKOA 1GSJA 2BNEA 1E19A 3LL9A 3S6GA 2CDQA 3D2MA 3ZZIA 4OLCA 3C1MA 4NDOB 4A7WA 3KZFA 2VA1A 1Z9DA 2E9YA 2BRIA 4NDRB 3K56A 3U6UA 3QUOA 4NDPA 3WWNA 3AAWA 3ZZHA 3T7BA 2V4YA 2BNDA 3AB2A 2HMFA 2BTYA 2J0WA 2J5VA 4A7XA 4USJA 2A1FA 2R98A 4KZTA 3C1NA 3K52A 2WE5A 4JZ9A 2J4KA 2JI5A 3EK6A 4F6TB 4NDQB 3C20A 1GS5A 3ZZFA 3K4OA 3D41A 2AP9A 2BNFA 3K4YA 3D40A 3S6HA 4AB7A 3QVHA 3QUNA 4NDRA 2BMUA 2R8VA 2RD5A 2JJ4A 1B7BA 4F6TA 4NDOA 2BRXA 3LL5A 3S6KA 4I49A 2OGXA 2IJ9A 2V5HA 2J0XA 1OHBA 3EK5A 4AXSA 2JJXA 1YBDA 2J4JA 3QURA 3L86A 2WXBA 2WE4A 3WWMA 4JZ8A 3LKKA 3ZZGA 2J4LA 3D2PA
chains in the Genus database with same CATH topology
3NWYA 2OGXB 2X2WA 2J5TA 4NDQA 2BUFA 3AB4A 3TVIA 4Q1TA 3L76A 1OHAA 1OH9A 3QVFA 2W21A 4JZ7A 4NDPB 3B8GA 2AKOA 1GSJA 2BNEA 1E19A 3LL9A 3S6GA 2CDQA 3D2MA 3ZZIA 4OLCA 3C1MA 4NDOB 4A7WA 3KZFA 2VA1A 1Z9DA 2E9YA 2BRIA 4NDRB 3K56A 3U6UA 3QUOA 4NDPA 3WWNA 3AAWA 3ZZHA 3T7BA 2V4YA 2BNDA 3AB2A 2HMFA 2BTYA 2J0WA 2J5VA 4A7XA 4USJA 2A1FA 2R98A 4KZTA 3C1NA 3K52A 2WE5A 4JZ9A 2J4KA 2JI5A 3EK6A 4F6TB 4NDQB 3C20A 1GS5A 3ZZFA 3K4OA 3D41A 2AP9A 2BNFA 3K4YA 3D40A 3S6HA 4AB7A 3QVHA 3QUNA 4NDRA 2BMUA 2R8VA 2RD5A 2JJ4A 1B7BA 4F6TA 4NDOA 2BRXA 3LL5A 3S6KA 4I49A 2OGXA 2IJ9A 2V5HA 2J0XA 1OHBA 3EK5A 4AXSA 2JJXA 1YBDA 2J4JA 3QURA 3L86A 2WXBA 2WE4A 3WWMA 4JZ8A 3LKKA 3ZZGA 2J4LA 3D2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWY A;  2OGX B;  2X2W A;  2J5T A;  4NDQ A;  2BUF A;  3AB4 A;  3TVI A;  4Q1T A;  3L76 A;  1OHA A;  1OH9 A;  3QVF A;  2W21 A;  4JZ7 A;  4NDP B;  3B8G A;  2AKO A;  1GSJ A;  2BNE A;  1E19 A;  3LL9 A;  3S6G A;  2CDQ A;  3D2M A;  3ZZI A;  4OLC A;  3C1M A;  4NDO B;  4A7W A;  3KZF A;  2VA1 A;  1Z9D A;  2E9Y A;  2BRI A;  4NDR B;  3K56 A;  3U6U A;  3QUO A;  4NDP A;  3WWN A;  3AAW A;  3ZZH A;  3T7B A;  2V4Y A;  2BND A;  3AB2 A;  2HMF A;  2BTY A;  2J0W A;  2J5V A;  4A7X A;  4USJ A;  2A1F A;  2R98 A;  4KZT A;  3C1N A;  3K52 A;  2WE5 A;  4JZ9 A;  2J4K A;  2JI5 A;  3EK6 A;  4F6T B;  4NDQ B;  3C20 A;  1GS5 A;  3ZZF A;  3K4O A;  3D41 A;  2AP9 A;  2BNF A;  3K4Y A;  3D40 A;  3S6H A;  4AB7 A;  3QVH A;  3QUN A;  4NDR A;  2BMU A;  2R8V A;  2RD5 A;  2JJ4 A;  1B7B A;  4F6T A;  4NDO A;  2BRX A;  3LL5 A;  3S6K A;  4I49 A;  2OGX A;  2IJ9 A;  2V5H A;  2J0X A;  1OHB A;  3EK5 A;  4AXS A;  2JJX A;  1YBD A;  2J4J A;  3QUR A;  3L86 A;  2WXB A;  2WE4 A;  3WWM A;  4JZ8 A;  3LKK A;  3ZZG A;  2J4L A;  3D2P A; 
#chains in the Genus database with same CATH topology
 3NWY A;  2OGX B;  2X2W A;  2J5T A;  4NDQ A;  2BUF A;  3AB4 A;  3TVI A;  4Q1T A;  3L76 A;  1OHA A;  1OH9 A;  3QVF A;  2W21 A;  4JZ7 A;  4NDP B;  3B8G A;  2AKO A;  1GSJ A;  2BNE A;  1E19 A;  3LL9 A;  3S6G A;  2CDQ A;  3D2M A;  3ZZI A;  4OLC A;  3C1M A;  4NDO B;  4A7W A;  3KZF A;  2VA1 A;  1Z9D A;  2E9Y A;  2BRI A;  4NDR B;  3K56 A;  3U6U A;  3QUO A;  4NDP A;  3WWN A;  3AAW A;  3ZZH A;  3T7B A;  2V4Y A;  2BND A;  3AB2 A;  2HMF A;  2BTY A;  2J0W A;  2J5V A;  4A7X A;  4USJ A;  2A1F A;  2R98 A;  4KZT A;  3C1N A;  3K52 A;  2WE5 A;  4JZ9 A;  2J4K A;  2JI5 A;  3EK6 A;  4F6T B;  4NDQ B;  3C20 A;  1GS5 A;  3ZZF A;  3K4O A;  3D41 A;  2AP9 A;  2BNF A;  3K4Y A;  3D40 A;  3S6H A;  4AB7 A;  3QVH A;  3QUN A;  4NDR A;  2BMU A;  2R8V A;  2RD5 A;  2JJ4 A;  1B7B A;  4F6T A;  4NDO A;  2BRX A;  3LL5 A;  3S6K A;  4I49 A;  2OGX A;  2IJ9 A;  2V5H A;  2J0X A;  1OHB A;  3EK5 A;  4AXS A;  2JJX A;  1YBD A;  2J4J A;  3QUR A;  3L86 A;  2WXB A;  2WE4 A;  3WWM A;  4JZ8 A;  3LKK A;  3ZZG A;  2J4L A;  3D2P A; 
#chains in the Genus database with same CATH homology
 3NWY A;  2OGX B;  2X2W A;  2J5T A;  4NDQ A;  2BUF A;  3AB4 A;  3TVI A;  4Q1T A;  3L76 A;  1OHA A;  1OH9 A;  3QVF A;  2W21 A;  4JZ7 A;  4NDP B;  3B8G A;  2AKO A;  1GSJ A;  2BNE A;  1E19 A;  3LL9 A;  3S6G A;  2CDQ A;  3D2M A;  3ZZI A;  4OLC A;  3C1M A;  4NDO B;  4A7W A;  3KZF A;  2VA1 A;  1Z9D A;  2E9Y A;  2BRI A;  4NDR B;  3K56 A;  3U6U A;  3QUO A;  4NDP A;  3WWN A;  3AAW A;  3ZZH A;  3T7B A;  2V4Y A;  2BND A;  3AB2 A;  2HMF A;  2BTY A;  2J0W A;  2J5V A;  4A7X A;  4USJ A;  2A1F A;  2R98 A;  4KZT A;  3C1N A;  3K52 A;  2WE5 A;  4JZ9 A;  2J4K A;  2JI5 A;  3EK6 A;  4F6T B;  4NDQ B;  3C20 A;  1GS5 A;  3ZZF A;  3K4O A;  3D41 A;  2AP9 A;  2BNF A;  3K4Y A;  3D40 A;  3S6H A;  4AB7 A;  3QVH A;  3QUN A;  4NDR A;  2BMU A;  2R8V A;  2RD5 A;  2JJ4 A;  1B7B A;  4F6T A;  4NDO A;  2BRX A;  3LL5 A;  3S6K A;  4I49 A;  2OGX A;  2IJ9 A;  2V5H A;  2J0X A;  1OHB A;  3EK5 A;  4AXS A;  2JJX A;  1YBD A;  2J4J A;  3QUR A;  3L86 A;  2WXB A;  2WE4 A;  3WWM A;  4JZ8 A;  3LKK A;  3ZZG A;  2J4L A;  3D2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...