2JJXA

The crystal structure of ump kinase from bacillus anthracis (ba1797)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
RPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTIINSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVAKQGVDGVFTSDPKHNKSAKMYRKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDDASLLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Ump Kinase from Bacillus Anthracis (Ba1797) Reveals an Allosteric Nucleotide-Binding Site.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 80
structure length 244
sequence length 244
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2jjxA00
2J0XA 3K52A 2WXBA 3WWNA 3D41A 3EK6A 1OHBA 4NDQA 2CDQA 2AKOA 3EK5A 2BRXA 1E19A 2WE5A 3TVIA 2W21A 4NDRA 3K4YA 3U6UA 3QURA 4NDQB 2J4LA 2BTYA 3D2MA 1GSJA 3C1NA 1Z9DA 3K4OA 3L76A 3D2PA 4NDRB 1OH9A 2R98A 2J4JA 1OHAA 3S6KA 3AB4A 3WWMA 4F6TA 3ZZHA 2E9YA 3NWYA 3LL5A 3ZZGA 3QUOA 2R8VA 3QVFA 2OGXA 4AB7A 2V4YA 4NDOA 4A7XA 3K56A 3D40A 4NDPA 2AP9A 2J4KA 2J5TA 2BNEA 2V5HA 4F6TB 2X2WA 3LKKA 3S6HA 4JZ9A 3QUNA 2JJXA 2WE4A 2A1FA 4Q1TA 3ZZFA 2OGXB 4OLCA 4NDOB 4NDPB 2HMFA 4JZ7A 2JI5A 2BRIA 4A7WA 3LL9A 3T7BA 3L86A 3ZZIA 2JJ4A 3C20A 2RD5A 4KZTA 1B7BA 4JZ8A 4USJA 2IJ9A 2BNDA 1GS5A 2VA1A 2J5VA 3AAWA 2BMUA 3C1MA 2J0WA 3S6GA 1YBDA 2BUFA 2BNFA 4AXSA 3KZFA 3B8GA 4I49A 3AB2A 3QVHA
chains in the Genus database with same CATH superfamily
2J0XA 3K52A 2WXBA 3WWNA 3D41A 3EK6A 1OHBA 4NDQA 2CDQA 2AKOA 3EK5A 2BRXA 1E19A 2WE5A 3TVIA 2W21A 4NDRA 3K4YA 3U6UA 3QURA 4NDQB 2J4LA 2BTYA 3D2MA 1GSJA 3C1NA 1Z9DA 3K4OA 3L76A 3D2PA 4NDRB 1OH9A 2R98A 2J4JA 1OHAA 3S6KA 3AB4A 3WWMA 4F6TA 3ZZHA 2E9YA 3NWYA 3LL5A 3ZZGA 3QUOA 2R8VA 3QVFA 2OGXA 4AB7A 2V4YA 4NDOA 4A7XA 3K56A 3D40A 4NDPA 2AP9A 2J4KA 2J5TA 2BNEA 2V5HA 4F6TB 2X2WA 3LKKA 3S6HA 4JZ9A 3QUNA 2JJXA 2WE4A 2A1FA 4Q1TA 3ZZFA 2OGXB 4OLCA 4NDOB 4NDPB 2HMFA 4JZ7A 2JI5A 2BRIA 4A7WA 3LL9A 3T7BA 3L86A 3ZZIA 2JJ4A 3C20A 2RD5A 4KZTA 1B7BA 4JZ8A 4USJA 2IJ9A 2BNDA 1GS5A 2VA1A 2J5VA 3AAWA 2BMUA 3C1MA 2J0WA 3S6GA 1YBDA 2BUFA 2BNFA 4AXSA 3KZFA 3B8GA 4I49A 3AB2A 3QVHA
chains in the Genus database with same CATH topology
2J0XA 3K52A 2WXBA 3WWNA 3D41A 3EK6A 1OHBA 4NDQA 2CDQA 2AKOA 3EK5A 2BRXA 1E19A 2WE5A 3TVIA 2W21A 4NDRA 3K4YA 3U6UA 3QURA 4NDQB 2J4LA 2BTYA 3D2MA 1GSJA 3C1NA 1Z9DA 3K4OA 3L76A 3D2PA 4NDRB 1OH9A 2R98A 2J4JA 1OHAA 3S6KA 3AB4A 3WWMA 4F6TA 3ZZHA 2E9YA 3NWYA 3LL5A 3ZZGA 3QUOA 2R8VA 3QVFA 2OGXA 4AB7A 2V4YA 4NDOA 4A7XA 3K56A 3D40A 4NDPA 2AP9A 2J4KA 2J5TA 2BNEA 2V5HA 4F6TB 2X2WA 3LKKA 3S6HA 4JZ9A 3QUNA 2JJXA 2WE4A 2A1FA 4Q1TA 3ZZFA 2OGXB 4OLCA 4NDOB 4NDPB 2HMFA 4JZ7A 2JI5A 2BRIA 4A7WA 3LL9A 3T7BA 3L86A 3ZZIA 2JJ4A 3C20A 2RD5A 4KZTA 1B7BA 4JZ8A 4USJA 2IJ9A 2BNDA 1GS5A 2VA1A 2J5VA 3AAWA 2BMUA 3C1MA 2J0WA 3S6GA 1YBDA 2BUFA 2BNFA 4AXSA 3KZFA 3B8GA 4I49A 3AB2A 3QVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0X A;  3K52 A;  2WXB A;  3WWN A;  3D41 A;  3EK6 A;  1OHB A;  4NDQ A;  2CDQ A;  2AKO A;  3EK5 A;  2BRX A;  1E19 A;  2WE5 A;  3TVI A;  2W21 A;  4NDR A;  3K4Y A;  3U6U A;  3QUR A;  4NDQ B;  2J4L A;  2BTY A;  3D2M A;  1GSJ A;  3C1N A;  1Z9D A;  3K4O A;  3L76 A;  3D2P A;  4NDR B;  1OH9 A;  2R98 A;  2J4J A;  1OHA A;  3S6K A;  3AB4 A;  3WWM A;  4F6T A;  3ZZH A;  2E9Y A;  3NWY A;  3LL5 A;  3ZZG A;  3QUO A;  2R8V A;  3QVF A;  2OGX A;  4AB7 A;  2V4Y A;  4NDO A;  4A7X A;  3K56 A;  3D40 A;  4NDP A;  2AP9 A;  2J4K A;  2J5T A;  2BNE A;  2V5H A;  4F6T B;  2X2W A;  3LKK A;  3S6H A;  4JZ9 A;  3QUN A;  2JJX A;  2WE4 A;  2A1F A;  4Q1T A;  3ZZF A;  2OGX B;  4OLC A;  4NDO B;  4NDP B;  2HMF A;  4JZ7 A;  2JI5 A;  2BRI A;  4A7W A;  3LL9 A;  3T7B A;  3L86 A;  3ZZI A;  2JJ4 A;  3C20 A;  2RD5 A;  4KZT A;  1B7B A;  4JZ8 A;  4USJ A;  2IJ9 A;  2BND A;  1GS5 A;  2VA1 A;  2J5V A;  3AAW A;  2BMU A;  3C1M A;  2J0W A;  3S6G A;  1YBD A;  2BUF A;  2BNF A;  4AXS A;  3KZF A;  3B8G A;  4I49 A;  3AB2 A;  3QVH A; 
#chains in the Genus database with same CATH topology
 2J0X A;  3K52 A;  2WXB A;  3WWN A;  3D41 A;  3EK6 A;  1OHB A;  4NDQ A;  2CDQ A;  2AKO A;  3EK5 A;  2BRX A;  1E19 A;  2WE5 A;  3TVI A;  2W21 A;  4NDR A;  3K4Y A;  3U6U A;  3QUR A;  4NDQ B;  2J4L A;  2BTY A;  3D2M A;  1GSJ A;  3C1N A;  1Z9D A;  3K4O A;  3L76 A;  3D2P A;  4NDR B;  1OH9 A;  2R98 A;  2J4J A;  1OHA A;  3S6K A;  3AB4 A;  3WWM A;  4F6T A;  3ZZH A;  2E9Y A;  3NWY A;  3LL5 A;  3ZZG A;  3QUO A;  2R8V A;  3QVF A;  2OGX A;  4AB7 A;  2V4Y A;  4NDO A;  4A7X A;  3K56 A;  3D40 A;  4NDP A;  2AP9 A;  2J4K A;  2J5T A;  2BNE A;  2V5H A;  4F6T B;  2X2W A;  3LKK A;  3S6H A;  4JZ9 A;  3QUN A;  2JJX A;  2WE4 A;  2A1F A;  4Q1T A;  3ZZF A;  2OGX B;  4OLC A;  4NDO B;  4NDP B;  2HMF A;  4JZ7 A;  2JI5 A;  2BRI A;  4A7W A;  3LL9 A;  3T7B A;  3L86 A;  3ZZI A;  2JJ4 A;  3C20 A;  2RD5 A;  4KZT A;  1B7B A;  4JZ8 A;  4USJ A;  2IJ9 A;  2BND A;  1GS5 A;  2VA1 A;  2J5V A;  3AAW A;  2BMU A;  3C1M A;  2J0W A;  3S6G A;  1YBD A;  2BUF A;  2BNF A;  4AXS A;  3KZF A;  3B8G A;  4I49 A;  3AB2 A;  3QVH A; 
#chains in the Genus database with same CATH homology
 2J0X A;  3K52 A;  2WXB A;  3WWN A;  3D41 A;  3EK6 A;  1OHB A;  4NDQ A;  2CDQ A;  2AKO A;  3EK5 A;  2BRX A;  1E19 A;  2WE5 A;  3TVI A;  2W21 A;  4NDR A;  3K4Y A;  3U6U A;  3QUR A;  4NDQ B;  2J4L A;  2BTY A;  3D2M A;  1GSJ A;  3C1N A;  1Z9D A;  3K4O A;  3L76 A;  3D2P A;  4NDR B;  1OH9 A;  2R98 A;  2J4J A;  1OHA A;  3S6K A;  3AB4 A;  3WWM A;  4F6T A;  3ZZH A;  2E9Y A;  3NWY A;  3LL5 A;  3ZZG A;  3QUO A;  2R8V A;  3QVF A;  2OGX A;  4AB7 A;  2V4Y A;  4NDO A;  4A7X A;  3K56 A;  3D40 A;  4NDP A;  2AP9 A;  2J4K A;  2J5T A;  2BNE A;  2V5H A;  4F6T B;  2X2W A;  3LKK A;  3S6H A;  4JZ9 A;  3QUN A;  2JJX A;  2WE4 A;  2A1F A;  4Q1T A;  3ZZF A;  2OGX B;  4OLC A;  4NDO B;  4NDP B;  2HMF A;  4JZ7 A;  2JI5 A;  2BRI A;  4A7W A;  3LL9 A;  3T7B A;  3L86 A;  3ZZI A;  2JJ4 A;  3C20 A;  2RD5 A;  4KZT A;  1B7B A;  4JZ8 A;  4USJ A;  2IJ9 A;  2BND A;  1GS5 A;  2VA1 A;  2J5V A;  3AAW A;  2BMU A;  3C1M A;  2J0W A;  3S6G A;  1YBD A;  2BUF A;  2BNF A;  4AXS A;  3KZF A;  3B8G A;  4I49 A;  3AB2 A;  3QVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...