2JJXA

The crystal structure of ump kinase from bacillus anthracis (ba1797)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
RPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTIINSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVAKQGVDGVFTSDPKHNKSAKMYRKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDDASLLVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Ump Kinase from Bacillus Anthracis (Ba1797) Reveals an Allosteric Nucleotide-Binding Site.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 80
structure length 244
sequence length 244
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2jjxA00
2W21A 2BMUA 4NDRA 3K4OA 4USJA 4A7XA 4Q1TA 2J5TA 2BUFA 1OHAA 3ZZIA 3LKKA 2JJXA 3AAWA 4JZ8A 2J4JA 3T7BA 2BNDA 3AB2A 3EK6A 4NDQB 4KZTA 3U6UA 4OLCA 2WXBA 4AXSA 2J4LA 2R8VA 3L76A 3QURA 3C1MA 2J0WA 3EK5A 4NDOB 1Z9DA 4AB7A 3NWYA 2OGXA 3QVHA 2AP9A 2J4KA 4I49A 4NDPB 3WWNA 2V5HA 4JZ9A 3D40A 2X2WA 3TVIA 4A7WA 3L86A 3K4YA 3LL5A 3QUOA 3S6GA 3S6KA 2WE4A 2A1FA 2BTYA 4NDRB 2AKOA 3D2PA 3C1NA 3LL9A 2JI5A 3WWMA 2IJ9A 3K52A 3ZZGA 3D2MA 3QVFA 2V4YA 2E9YA 2BRIA 2OGXB 3KZFA 1OHBA 1B7BA 1OH9A 2J5VA 2BNFA 2CDQA 3ZZFA 2J0XA 1GS5A 4F6TA 2HMFA 3AB4A 4NDQA 2BNEA 2WE5A 2BRXA 1GSJA 4NDOA 4F6TB 4JZ7A 3D41A 2VA1A 2JJ4A 2RD5A 1YBDA 3ZZHA 3B8GA 4NDPA 3K56A 3QUNA 3S6HA 2R98A 3C20A 1E19A
chains in the Genus database with same CATH superfamily
2W21A 2BMUA 4NDRA 3K4OA 4USJA 4A7XA 4Q1TA 2J5TA 2BUFA 1OHAA 3ZZIA 3LKKA 2JJXA 3AAWA 4JZ8A 2J4JA 3T7BA 2BNDA 3AB2A 3EK6A 4NDQB 4KZTA 3U6UA 4OLCA 2WXBA 4AXSA 2J4LA 2R8VA 3L76A 3QURA 3C1MA 2J0WA 3EK5A 4NDOB 1Z9DA 4AB7A 3NWYA 2OGXA 3QVHA 2AP9A 2J4KA 4I49A 4NDPB 3WWNA 2V5HA 4JZ9A 3D40A 2X2WA 3TVIA 4A7WA 3L86A 3K4YA 3LL5A 3QUOA 3S6GA 3S6KA 2WE4A 2A1FA 2BTYA 4NDRB 2AKOA 3D2PA 3C1NA 3LL9A 2JI5A 3WWMA 2IJ9A 3K52A 3ZZGA 3D2MA 3QVFA 2V4YA 2E9YA 2BRIA 2OGXB 3KZFA 1OHBA 1B7BA 1OH9A 2J5VA 2BNFA 2CDQA 3ZZFA 2J0XA 1GS5A 4F6TA 2HMFA 3AB4A 4NDQA 2BNEA 2WE5A 2BRXA 1GSJA 4NDOA 4F6TB 4JZ7A 3D41A 2VA1A 2JJ4A 2RD5A 1YBDA 3ZZHA 3B8GA 4NDPA 3K56A 3QUNA 3S6HA 2R98A 3C20A 1E19A
chains in the Genus database with same CATH topology
2W21A 2BMUA 4NDRA 3K4OA 4USJA 4A7XA 4Q1TA 2J5TA 2BUFA 1OHAA 3ZZIA 3LKKA 2JJXA 3AAWA 4JZ8A 2J4JA 3T7BA 2BNDA 3AB2A 3EK6A 4NDQB 4KZTA 3U6UA 4OLCA 2WXBA 4AXSA 2J4LA 2R8VA 3L76A 3QURA 3C1MA 2J0WA 3EK5A 4NDOB 1Z9DA 4AB7A 3NWYA 2OGXA 3QVHA 2AP9A 2J4KA 4I49A 4NDPB 3WWNA 2V5HA 4JZ9A 3D40A 2X2WA 3TVIA 4A7WA 3L86A 3K4YA 3LL5A 3QUOA 3S6GA 3S6KA 2WE4A 2A1FA 2BTYA 4NDRB 2AKOA 3D2PA 3C1NA 3LL9A 2JI5A 3WWMA 2IJ9A 3K52A 3ZZGA 3D2MA 3QVFA 2V4YA 2E9YA 2BRIA 2OGXB 3KZFA 1OHBA 1B7BA 1OH9A 2J5VA 2BNFA 2CDQA 3ZZFA 2J0XA 1GS5A 4F6TA 2HMFA 3AB4A 4NDQA 2BNEA 2WE5A 2BRXA 1GSJA 4NDOA 4F6TB 4JZ7A 3D41A 2VA1A 2JJ4A 2RD5A 1YBDA 3ZZHA 3B8GA 4NDPA 3K56A 3QUNA 3S6HA 2R98A 3C20A 1E19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W21 A;  2BMU A;  4NDR A;  3K4O A;  4USJ A;  4A7X A;  4Q1T A;  2J5T A;  2BUF A;  1OHA A;  3ZZI A;  3LKK A;  2JJX A;  3AAW A;  4JZ8 A;  2J4J A;  3T7B A;  2BND A;  3AB2 A;  3EK6 A;  4NDQ B;  4KZT A;  3U6U A;  4OLC A;  2WXB A;  4AXS A;  2J4L A;  2R8V A;  3L76 A;  3QUR A;  3C1M A;  2J0W A;  3EK5 A;  4NDO B;  1Z9D A;  4AB7 A;  3NWY A;  2OGX A;  3QVH A;  2AP9 A;  2J4K A;  4I49 A;  4NDP B;  3WWN A;  2V5H A;  4JZ9 A;  3D40 A;  2X2W A;  3TVI A;  4A7W A;  3L86 A;  3K4Y A;  3LL5 A;  3QUO A;  3S6G A;  3S6K A;  2WE4 A;  2A1F A;  2BTY A;  4NDR B;  2AKO A;  3D2P A;  3C1N A;  3LL9 A;  2JI5 A;  3WWM A;  2IJ9 A;  3K52 A;  3ZZG A;  3D2M A;  3QVF A;  2V4Y A;  2E9Y A;  2BRI A;  2OGX B;  3KZF A;  1OHB A;  1B7B A;  1OH9 A;  2J5V A;  2BNF A;  2CDQ A;  3ZZF A;  2J0X A;  1GS5 A;  4F6T A;  2HMF A;  3AB4 A;  4NDQ A;  2BNE A;  2WE5 A;  2BRX A;  1GSJ A;  4NDO A;  4F6T B;  4JZ7 A;  3D41 A;  2VA1 A;  2JJ4 A;  2RD5 A;  1YBD A;  3ZZH A;  3B8G A;  4NDP A;  3K56 A;  3QUN A;  3S6H A;  2R98 A;  3C20 A;  1E19 A; 
#chains in the Genus database with same CATH topology
 2W21 A;  2BMU A;  4NDR A;  3K4O A;  4USJ A;  4A7X A;  4Q1T A;  2J5T A;  2BUF A;  1OHA A;  3ZZI A;  3LKK A;  2JJX A;  3AAW A;  4JZ8 A;  2J4J A;  3T7B A;  2BND A;  3AB2 A;  3EK6 A;  4NDQ B;  4KZT A;  3U6U A;  4OLC A;  2WXB A;  4AXS A;  2J4L A;  2R8V A;  3L76 A;  3QUR A;  3C1M A;  2J0W A;  3EK5 A;  4NDO B;  1Z9D A;  4AB7 A;  3NWY A;  2OGX A;  3QVH A;  2AP9 A;  2J4K A;  4I49 A;  4NDP B;  3WWN A;  2V5H A;  4JZ9 A;  3D40 A;  2X2W A;  3TVI A;  4A7W A;  3L86 A;  3K4Y A;  3LL5 A;  3QUO A;  3S6G A;  3S6K A;  2WE4 A;  2A1F A;  2BTY A;  4NDR B;  2AKO A;  3D2P A;  3C1N A;  3LL9 A;  2JI5 A;  3WWM A;  2IJ9 A;  3K52 A;  3ZZG A;  3D2M A;  3QVF A;  2V4Y A;  2E9Y A;  2BRI A;  2OGX B;  3KZF A;  1OHB A;  1B7B A;  1OH9 A;  2J5V A;  2BNF A;  2CDQ A;  3ZZF A;  2J0X A;  1GS5 A;  4F6T A;  2HMF A;  3AB4 A;  4NDQ A;  2BNE A;  2WE5 A;  2BRX A;  1GSJ A;  4NDO A;  4F6T B;  4JZ7 A;  3D41 A;  2VA1 A;  2JJ4 A;  2RD5 A;  1YBD A;  3ZZH A;  3B8G A;  4NDP A;  3K56 A;  3QUN A;  3S6H A;  2R98 A;  3C20 A;  1E19 A; 
#chains in the Genus database with same CATH homology
 2W21 A;  2BMU A;  4NDR A;  3K4O A;  4USJ A;  4A7X A;  4Q1T A;  2J5T A;  2BUF A;  1OHA A;  3ZZI A;  3LKK A;  2JJX A;  3AAW A;  4JZ8 A;  2J4J A;  3T7B A;  2BND A;  3AB2 A;  3EK6 A;  4NDQ B;  4KZT A;  3U6U A;  4OLC A;  2WXB A;  4AXS A;  2J4L A;  2R8V A;  3L76 A;  3QUR A;  3C1M A;  2J0W A;  3EK5 A;  4NDO B;  1Z9D A;  4AB7 A;  3NWY A;  2OGX A;  3QVH A;  2AP9 A;  2J4K A;  4I49 A;  4NDP B;  3WWN A;  2V5H A;  4JZ9 A;  3D40 A;  2X2W A;  3TVI A;  4A7W A;  3L86 A;  3K4Y A;  3LL5 A;  3QUO A;  3S6G A;  3S6K A;  2WE4 A;  2A1F A;  2BTY A;  4NDR B;  2AKO A;  3D2P A;  3C1N A;  3LL9 A;  2JI5 A;  3WWM A;  2IJ9 A;  3K52 A;  3ZZG A;  3D2M A;  3QVF A;  2V4Y A;  2E9Y A;  2BRI A;  2OGX B;  3KZF A;  1OHB A;  1B7B A;  1OH9 A;  2J5V A;  2BNF A;  2CDQ A;  3ZZF A;  2J0X A;  1GS5 A;  4F6T A;  2HMF A;  3AB4 A;  4NDQ A;  2BNE A;  2WE5 A;  2BRX A;  1GSJ A;  4NDO A;  4F6T B;  4JZ7 A;  3D41 A;  2VA1 A;  2JJ4 A;  2RD5 A;  1YBD A;  3ZZH A;  3B8G A;  4NDP A;  3K56 A;  3QUN A;  3S6H A;  2R98 A;  3C20 A;  1E19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...