2JJXA

The crystal structure of ump kinase from bacillus anthracis (ba1797)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
244
Chain Sequence
b'RPYKRVLIKLSGGALADQTGNSFNSKRLEHIANEILSIVDLGIEVSIVIGGGNIFRGHLAEEWGIDRVEADNIGTLGTIINSLMLRGVLTSKTNKEVRVMTSIPFNAVAEPYIRLRAVHHLDNGYIVIFGGGNGQPFVTTDYPSVQRAIEMNSDAILVAKQGVDGVFTSDPKHNKSAKMYRKLNYNDVVRQNIQVMDQAALLLARDYNLPAHVFNFDEPGVMRRICLGEHVGTLINDDASLLVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Ump Kinase from Bacillus Anthracis (Ba1797) Reveals an Allosteric Nucleotide-Binding Site.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 80
structure length 244
sequence length 244
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2jjxA00
4NDPA 4JZ7A 2R98A 1GSJA 1OHBA 2JI5A 4NDQA 2OGXA 2BNDA 3C1MA 2VA1A 3K52A 2WXBA 2J0XA 3U6UA 2JJ4A 2HMFA 2BRXA 4A7WA 4NDOA 2E9YA 4NDPB 2BRIA 4AXSA 3K4YA 1E19A 2BTYA 2RD5A 2J5VA 2BUFA 3WWNA 3NWYA 2BNEA 2W21A 1B7BA 3K56A 3L76A 4F6TA 3AB2A 3T7BA 1Z9DA 4NDOB 3C20A 2WE5A 3S6KA 4NDRB 2J5TA 3L86A 3B8GA 2V5HA 2A1FA 3D41A 4Q1TA 3QVFA 2BNFA 3QUOA 4NDQB 2OGXB 2WE4A 3D40A 3KZFA 3D2MA 3ZZGA 3QURA 3S6GA 2BMUA 2IJ9A 3ZZHA 2X2WA 2J0WA 1YBDA 2AP9A 2AKOA 3K4OA 1OHAA 4OLCA 3EK6A 2V4YA 3ZZIA 3ZZFA 4AB7A 3AAWA 2J4LA 3TVIA 3AB4A 2R8VA 4USJA 4A7XA 3EK5A 4KZTA 3S6HA 4F6TB 1OH9A 2J4JA 2CDQA 3LL9A 2JJXA 4I49A 3WWMA 4JZ8A 3QVHA 1GS5A 4NDRA 3LL5A 3QUNA 3C1NA 2J4KA 4JZ9A 3D2PA 3LKKA
chains in the Genus database with same CATH superfamily
4NDPA 4JZ7A 2R98A 1GSJA 1OHBA 2JI5A 4NDQA 2OGXA 2BNDA 3C1MA 2VA1A 3K52A 2WXBA 2J0XA 3U6UA 2JJ4A 2HMFA 2BRXA 4A7WA 4NDOA 2E9YA 4NDPB 2BRIA 4AXSA 3K4YA 1E19A 2BTYA 2RD5A 2J5VA 2BUFA 3WWNA 3NWYA 2BNEA 2W21A 1B7BA 3K56A 3L76A 4F6TA 3AB2A 3T7BA 1Z9DA 4NDOB 3C20A 2WE5A 3S6KA 4NDRB 2J5TA 3L86A 3B8GA 2V5HA 2A1FA 3D41A 4Q1TA 3QVFA 2BNFA 3QUOA 4NDQB 2OGXB 2WE4A 3D40A 3KZFA 3D2MA 3ZZGA 3QURA 3S6GA 2BMUA 2IJ9A 3ZZHA 2X2WA 2J0WA 1YBDA 2AP9A 2AKOA 3K4OA 1OHAA 4OLCA 3EK6A 2V4YA 3ZZIA 3ZZFA 4AB7A 3AAWA 2J4LA 3TVIA 3AB4A 2R8VA 4USJA 4A7XA 3EK5A 4KZTA 3S6HA 4F6TB 1OH9A 2J4JA 2CDQA 3LL9A 2JJXA 4I49A 3WWMA 4JZ8A 3QVHA 1GS5A 4NDRA 3LL5A 3QUNA 3C1NA 2J4KA 4JZ9A 3D2PA 3LKKA
chains in the Genus database with same CATH topology
4NDPA 4JZ7A 2R98A 1GSJA 1OHBA 2JI5A 4NDQA 2OGXA 2BNDA 3C1MA 2VA1A 3K52A 2WXBA 2J0XA 3U6UA 2JJ4A 2HMFA 2BRXA 4A7WA 4NDOA 2E9YA 4NDPB 2BRIA 4AXSA 3K4YA 1E19A 2BTYA 2RD5A 2J5VA 2BUFA 3WWNA 3NWYA 2BNEA 2W21A 1B7BA 3K56A 3L76A 4F6TA 3AB2A 3T7BA 1Z9DA 4NDOB 3C20A 2WE5A 3S6KA 4NDRB 2J5TA 3L86A 3B8GA 2V5HA 2A1FA 3D41A 4Q1TA 3QVFA 2BNFA 3QUOA 4NDQB 2OGXB 2WE4A 3D40A 3KZFA 3D2MA 3ZZGA 3QURA 3S6GA 2BMUA 2IJ9A 3ZZHA 2X2WA 2J0WA 1YBDA 2AP9A 2AKOA 3K4OA 1OHAA 4OLCA 3EK6A 2V4YA 3ZZIA 3ZZFA 4AB7A 3AAWA 2J4LA 3TVIA 3AB4A 2R8VA 4USJA 4A7XA 3EK5A 4KZTA 3S6HA 4F6TB 1OH9A 2J4JA 2CDQA 3LL9A 2JJXA 4I49A 3WWMA 4JZ8A 3QVHA 1GS5A 4NDRA 3LL5A 3QUNA 3C1NA 2J4KA 4JZ9A 3D2PA 3LKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDP A;  4JZ7 A;  2R98 A;  1GSJ A;  1OHB A;  2JI5 A;  4NDQ A;  2OGX A;  2BND A;  3C1M A;  2VA1 A;  3K52 A;  2WXB A;  2J0X A;  3U6U A;  2JJ4 A;  2HMF A;  2BRX A;  4A7W A;  4NDO A;  2E9Y A;  4NDP B;  2BRI A;  4AXS A;  3K4Y A;  1E19 A;  2BTY A;  2RD5 A;  2J5V A;  2BUF A;  3WWN A;  3NWY A;  2BNE A;  2W21 A;  1B7B A;  3K56 A;  3L76 A;  4F6T A;  3AB2 A;  3T7B A;  1Z9D A;  4NDO B;  3C20 A;  2WE5 A;  3S6K A;  4NDR B;  2J5T A;  3L86 A;  3B8G A;  2V5H A;  2A1F A;  3D41 A;  4Q1T A;  3QVF A;  2BNF A;  3QUO A;  4NDQ B;  2OGX B;  2WE4 A;  3D40 A;  3KZF A;  3D2M A;  3ZZG A;  3QUR A;  3S6G A;  2BMU A;  2IJ9 A;  3ZZH A;  2X2W A;  2J0W A;  1YBD A;  2AP9 A;  2AKO A;  3K4O A;  1OHA A;  4OLC A;  3EK6 A;  2V4Y A;  3ZZI A;  3ZZF A;  4AB7 A;  3AAW A;  2J4L A;  3TVI A;  3AB4 A;  2R8V A;  4USJ A;  4A7X A;  3EK5 A;  4KZT A;  3S6H A;  4F6T B;  1OH9 A;  2J4J A;  2CDQ A;  3LL9 A;  2JJX A;  4I49 A;  3WWM A;  4JZ8 A;  3QVH A;  1GS5 A;  4NDR A;  3LL5 A;  3QUN A;  3C1N A;  2J4K A;  4JZ9 A;  3D2P A;  3LKK A; 
#chains in the Genus database with same CATH topology
 4NDP A;  4JZ7 A;  2R98 A;  1GSJ A;  1OHB A;  2JI5 A;  4NDQ A;  2OGX A;  2BND A;  3C1M A;  2VA1 A;  3K52 A;  2WXB A;  2J0X A;  3U6U A;  2JJ4 A;  2HMF A;  2BRX A;  4A7W A;  4NDO A;  2E9Y A;  4NDP B;  2BRI A;  4AXS A;  3K4Y A;  1E19 A;  2BTY A;  2RD5 A;  2J5V A;  2BUF A;  3WWN A;  3NWY A;  2BNE A;  2W21 A;  1B7B A;  3K56 A;  3L76 A;  4F6T A;  3AB2 A;  3T7B A;  1Z9D A;  4NDO B;  3C20 A;  2WE5 A;  3S6K A;  4NDR B;  2J5T A;  3L86 A;  3B8G A;  2V5H A;  2A1F A;  3D41 A;  4Q1T A;  3QVF A;  2BNF A;  3QUO A;  4NDQ B;  2OGX B;  2WE4 A;  3D40 A;  3KZF A;  3D2M A;  3ZZG A;  3QUR A;  3S6G A;  2BMU A;  2IJ9 A;  3ZZH A;  2X2W A;  2J0W A;  1YBD A;  2AP9 A;  2AKO A;  3K4O A;  1OHA A;  4OLC A;  3EK6 A;  2V4Y A;  3ZZI A;  3ZZF A;  4AB7 A;  3AAW A;  2J4L A;  3TVI A;  3AB4 A;  2R8V A;  4USJ A;  4A7X A;  3EK5 A;  4KZT A;  3S6H A;  4F6T B;  1OH9 A;  2J4J A;  2CDQ A;  3LL9 A;  2JJX A;  4I49 A;  3WWM A;  4JZ8 A;  3QVH A;  1GS5 A;  4NDR A;  3LL5 A;  3QUN A;  3C1N A;  2J4K A;  4JZ9 A;  3D2P A;  3LKK A; 
#chains in the Genus database with same CATH homology
 4NDP A;  4JZ7 A;  2R98 A;  1GSJ A;  1OHB A;  2JI5 A;  4NDQ A;  2OGX A;  2BND A;  3C1M A;  2VA1 A;  3K52 A;  2WXB A;  2J0X A;  3U6U A;  2JJ4 A;  2HMF A;  2BRX A;  4A7W A;  4NDO A;  2E9Y A;  4NDP B;  2BRI A;  4AXS A;  3K4Y A;  1E19 A;  2BTY A;  2RD5 A;  2J5V A;  2BUF A;  3WWN A;  3NWY A;  2BNE A;  2W21 A;  1B7B A;  3K56 A;  3L76 A;  4F6T A;  3AB2 A;  3T7B A;  1Z9D A;  4NDO B;  3C20 A;  2WE5 A;  3S6K A;  4NDR B;  2J5T A;  3L86 A;  3B8G A;  2V5H A;  2A1F A;  3D41 A;  4Q1T A;  3QVF A;  2BNF A;  3QUO A;  4NDQ B;  2OGX B;  2WE4 A;  3D40 A;  3KZF A;  3D2M A;  3ZZG A;  3QUR A;  3S6G A;  2BMU A;  2IJ9 A;  3ZZH A;  2X2W A;  2J0W A;  1YBD A;  2AP9 A;  2AKO A;  3K4O A;  1OHA A;  4OLC A;  3EK6 A;  2V4Y A;  3ZZI A;  3ZZF A;  4AB7 A;  3AAW A;  2J4L A;  3TVI A;  3AB4 A;  2R8V A;  4USJ A;  4A7X A;  3EK5 A;  4KZT A;  3S6H A;  4F6T B;  1OH9 A;  2J4J A;  2CDQ A;  3LL9 A;  2JJX A;  4I49 A;  3WWM A;  4JZ8 A;  3QVH A;  1GS5 A;  4NDR A;  3LL5 A;  3QUN A;  3C1N A;  2J4K A;  4JZ9 A;  3D2P A;  3LKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...