3D40A

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with diphosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
252
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGSSEGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FomA protein
publication title Crystal Structure of Fosfomycin Resistance Kinase FomA from Streptomyces wedmorensis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
total genus 79
structure length 252
sequence length 271
ec nomenclature
pdb deposition date 2008-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3d40A00
4A7XA 4JZ8A 4NDPA 1GSJA 2JJ4A 2IJ9A 4AB7A 4NDOB 3L86A 3S6KA 3NWYA 1E19A 2BUFA 2W21A 2RD5A 3AAWA 4AXSA 2J5VA 2WE5A 2J5TA 4I49A 3S6HA 2WXBA 2J4KA 3LKKA 2V4YA 2J0XA 2V5HA 2BRIA 4NDRA 4USJA 2VA1A 3K4YA 3EK6A 2BMUA 2AKOA 3D40A 2E9YA 1B7BA 4A7WA 2WE4A 4KZTA 3U6UA 3AB4A 4F6TA 3QURA 3K4OA 3QUNA 4NDPB 3D2PA 2J4LA 3WWNA 2R98A 1OH9A 3C20A 3C1NA 2J0WA 2HMFA 2OGXA 2BNEA 3ZZHA 1YBDA 3WWMA 4NDQA 2J4JA 2JI5A 1Z9DA 4NDRB 2BRXA 2JJXA 3EK5A 3ZZIA 1GS5A 3B8GA 2A1FA 3K56A 3QVFA 4JZ9A 3KZFA 4NDOA 4Q1TA 3S6GA 2BTYA 4F6TB 3LL5A 3C1MA 2BNFA 1OHBA 3QUOA 3D41A 3LL9A 4OLCA 3L76A 3ZZGA 2OGXB 3AB2A 2R8VA 3TVIA 2X2WA 4JZ7A 4NDQB 2AP9A 3T7BA 2BNDA 3K52A 1OHAA 2CDQA 3QVHA 3D2MA 3ZZFA
chains in the Genus database with same CATH superfamily
4A7XA 4JZ8A 4NDPA 1GSJA 2JJ4A 2IJ9A 4AB7A 4NDOB 3L86A 3S6KA 3NWYA 1E19A 2BUFA 2W21A 2RD5A 3AAWA 4AXSA 2J5VA 2WE5A 2J5TA 4I49A 3S6HA 2WXBA 2J4KA 3LKKA 2V4YA 2J0XA 2V5HA 2BRIA 4NDRA 4USJA 2VA1A 3K4YA 3EK6A 2BMUA 2AKOA 3D40A 2E9YA 1B7BA 4A7WA 2WE4A 4KZTA 3U6UA 3AB4A 4F6TA 3QURA 3K4OA 3QUNA 4NDPB 3D2PA 2J4LA 3WWNA 2R98A 1OH9A 3C20A 3C1NA 2J0WA 2HMFA 2OGXA 2BNEA 3ZZHA 1YBDA 3WWMA 4NDQA 2J4JA 2JI5A 1Z9DA 4NDRB 2BRXA 2JJXA 3EK5A 3ZZIA 1GS5A 3B8GA 2A1FA 3K56A 3QVFA 4JZ9A 3KZFA 4NDOA 4Q1TA 3S6GA 2BTYA 4F6TB 3LL5A 3C1MA 2BNFA 1OHBA 3QUOA 3D41A 3LL9A 4OLCA 3L76A 3ZZGA 2OGXB 3AB2A 2R8VA 3TVIA 2X2WA 4JZ7A 4NDQB 2AP9A 3T7BA 2BNDA 3K52A 1OHAA 2CDQA 3QVHA 3D2MA 3ZZFA
chains in the Genus database with same CATH topology
4A7XA 4JZ8A 4NDPA 1GSJA 2JJ4A 2IJ9A 4AB7A 4NDOB 3L86A 3S6KA 3NWYA 1E19A 2BUFA 2W21A 2RD5A 3AAWA 4AXSA 2J5VA 2WE5A 2J5TA 4I49A 3S6HA 2WXBA 2J4KA 3LKKA 2V4YA 2J0XA 2V5HA 2BRIA 4NDRA 4USJA 2VA1A 3K4YA 3EK6A 2BMUA 2AKOA 3D40A 2E9YA 1B7BA 4A7WA 2WE4A 4KZTA 3U6UA 3AB4A 4F6TA 3QURA 3K4OA 3QUNA 4NDPB 3D2PA 2J4LA 3WWNA 2R98A 1OH9A 3C20A 3C1NA 2J0WA 2HMFA 2OGXA 2BNEA 3ZZHA 1YBDA 3WWMA 4NDQA 2J4JA 2JI5A 1Z9DA 4NDRB 2BRXA 2JJXA 3EK5A 3ZZIA 1GS5A 3B8GA 2A1FA 3K56A 3QVFA 4JZ9A 3KZFA 4NDOA 4Q1TA 3S6GA 2BTYA 4F6TB 3LL5A 3C1MA 2BNFA 1OHBA 3QUOA 3D41A 3LL9A 4OLCA 3L76A 3ZZGA 2OGXB 3AB2A 2R8VA 3TVIA 2X2WA 4JZ7A 4NDQB 2AP9A 3T7BA 2BNDA 3K52A 1OHAA 2CDQA 3QVHA 3D2MA 3ZZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7X A;  4JZ8 A;  4NDP A;  1GSJ A;  2JJ4 A;  2IJ9 A;  4AB7 A;  4NDO B;  3L86 A;  3S6K A;  3NWY A;  1E19 A;  2BUF A;  2W21 A;  2RD5 A;  3AAW A;  4AXS A;  2J5V A;  2WE5 A;  2J5T A;  4I49 A;  3S6H A;  2WXB A;  2J4K A;  3LKK A;  2V4Y A;  2J0X A;  2V5H A;  2BRI A;  4NDR A;  4USJ A;  2VA1 A;  3K4Y A;  3EK6 A;  2BMU A;  2AKO A;  3D40 A;  2E9Y A;  1B7B A;  4A7W A;  2WE4 A;  4KZT A;  3U6U A;  3AB4 A;  4F6T A;  3QUR A;  3K4O A;  3QUN A;  4NDP B;  3D2P A;  2J4L A;  3WWN A;  2R98 A;  1OH9 A;  3C20 A;  3C1N A;  2J0W A;  2HMF A;  2OGX A;  2BNE A;  3ZZH A;  1YBD A;  3WWM A;  4NDQ A;  2J4J A;  2JI5 A;  1Z9D A;  4NDR B;  2BRX A;  2JJX A;  3EK5 A;  3ZZI A;  1GS5 A;  3B8G A;  2A1F A;  3K56 A;  3QVF A;  4JZ9 A;  3KZF A;  4NDO A;  4Q1T A;  3S6G A;  2BTY A;  4F6T B;  3LL5 A;  3C1M A;  2BNF A;  1OHB A;  3QUO A;  3D41 A;  3LL9 A;  4OLC A;  3L76 A;  3ZZG A;  2OGX B;  3AB2 A;  2R8V A;  3TVI A;  2X2W A;  4JZ7 A;  4NDQ B;  2AP9 A;  3T7B A;  2BND A;  3K52 A;  1OHA A;  2CDQ A;  3QVH A;  3D2M A;  3ZZF A; 
#chains in the Genus database with same CATH topology
 4A7X A;  4JZ8 A;  4NDP A;  1GSJ A;  2JJ4 A;  2IJ9 A;  4AB7 A;  4NDO B;  3L86 A;  3S6K A;  3NWY A;  1E19 A;  2BUF A;  2W21 A;  2RD5 A;  3AAW A;  4AXS A;  2J5V A;  2WE5 A;  2J5T A;  4I49 A;  3S6H A;  2WXB A;  2J4K A;  3LKK A;  2V4Y A;  2J0X A;  2V5H A;  2BRI A;  4NDR A;  4USJ A;  2VA1 A;  3K4Y A;  3EK6 A;  2BMU A;  2AKO A;  3D40 A;  2E9Y A;  1B7B A;  4A7W A;  2WE4 A;  4KZT A;  3U6U A;  3AB4 A;  4F6T A;  3QUR A;  3K4O A;  3QUN A;  4NDP B;  3D2P A;  2J4L A;  3WWN A;  2R98 A;  1OH9 A;  3C20 A;  3C1N A;  2J0W A;  2HMF A;  2OGX A;  2BNE A;  3ZZH A;  1YBD A;  3WWM A;  4NDQ A;  2J4J A;  2JI5 A;  1Z9D A;  4NDR B;  2BRX A;  2JJX A;  3EK5 A;  3ZZI A;  1GS5 A;  3B8G A;  2A1F A;  3K56 A;  3QVF A;  4JZ9 A;  3KZF A;  4NDO A;  4Q1T A;  3S6G A;  2BTY A;  4F6T B;  3LL5 A;  3C1M A;  2BNF A;  1OHB A;  3QUO A;  3D41 A;  3LL9 A;  4OLC A;  3L76 A;  3ZZG A;  2OGX B;  3AB2 A;  2R8V A;  3TVI A;  2X2W A;  4JZ7 A;  4NDQ B;  2AP9 A;  3T7B A;  2BND A;  3K52 A;  1OHA A;  2CDQ A;  3QVH A;  3D2M A;  3ZZF A; 
#chains in the Genus database with same CATH homology
 4A7X A;  4JZ8 A;  4NDP A;  1GSJ A;  2JJ4 A;  2IJ9 A;  4AB7 A;  4NDO B;  3L86 A;  3S6K A;  3NWY A;  1E19 A;  2BUF A;  2W21 A;  2RD5 A;  3AAW A;  4AXS A;  2J5V A;  2WE5 A;  2J5T A;  4I49 A;  3S6H A;  2WXB A;  2J4K A;  3LKK A;  2V4Y A;  2J0X A;  2V5H A;  2BRI A;  4NDR A;  4USJ A;  2VA1 A;  3K4Y A;  3EK6 A;  2BMU A;  2AKO A;  3D40 A;  2E9Y A;  1B7B A;  4A7W A;  2WE4 A;  4KZT A;  3U6U A;  3AB4 A;  4F6T A;  3QUR A;  3K4O A;  3QUN A;  4NDP B;  3D2P A;  2J4L A;  3WWN A;  2R98 A;  1OH9 A;  3C20 A;  3C1N A;  2J0W A;  2HMF A;  2OGX A;  2BNE A;  3ZZH A;  1YBD A;  3WWM A;  4NDQ A;  2J4J A;  2JI5 A;  1Z9D A;  4NDR B;  2BRX A;  2JJX A;  3EK5 A;  3ZZI A;  1GS5 A;  3B8G A;  2A1F A;  3K56 A;  3QVF A;  4JZ9 A;  3KZF A;  4NDO A;  4Q1T A;  3S6G A;  2BTY A;  4F6T B;  3LL5 A;  3C1M A;  2BNF A;  1OHB A;  3QUO A;  3D41 A;  3LL9 A;  4OLC A;  3L76 A;  3ZZG A;  2OGX B;  3AB2 A;  2R8V A;  3TVI A;  2X2W A;  4JZ7 A;  4NDQ B;  2AP9 A;  3T7B A;  2BND A;  3K52 A;  1OHA A;  2CDQ A;  3QVH A;  3D2M A;  3ZZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...