3D40A

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with diphosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
252
Chain Sequence
SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGSSEGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Crystal Structure of Fosfomycin Resistance Kinase FomA from Streptomyces wedmorensis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 252
sequence length 271
ec nomenclature
pdb deposition date 2008-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3d40A00
3D2PA 4NDQA 2OGXB 4NDRA 2J5VA 2JJXA 1OH9A 4A7XA 3D40A 4NDQB 3TVIA 4NDRB 2CDQA 2J4KA 2BUFA 2JJ4A 4JZ9A 2AP9A 3S6GA 3K52A 1YBDA 3K56A 2OGXA 4KZTA 1E19A 3T7BA 3ZZGA 3LL5A 2JI5A 4NDPA 4JZ8A 2BNDA 2BMUA 2VA1A 4F6TB 4NDPB 1GSJA 2BRXA 2J0XA 3B8GA 2V5HA 3AB4A 2BNEA 1Z9DA 2BRIA 2WXBA 3K4YA 3AB2A 2RD5A 2J4JA 4OLCA 1B7BA 4AXSA 2BNFA 3LKKA 3QVHA 3C20A 2V4YA 4A7WA 3LL9A 1OHAA 3L76A 3QUOA 3ZZFA 3EK6A 4F6TA 2WE4A 4Q1TA 3QVFA 3C1MA 2IJ9A 4USJA 3QURA 3K4OA 2BTYA 4NDOB 2X2WA 3ZZIA 2R8VA 3S6HA 3S6KA 3NWYA 3WWMA 1GS5A 3D2MA 2R98A 3ZZHA 4I49A 2AKOA 3U6UA 3L86A 2W21A 2HMFA 4JZ7A 1OHBA 3D41A 4NDOA 3AAWA 2A1FA 2WE5A 2J0WA 3C1NA 2J5TA 4AB7A 3QUNA 3KZFA 2E9YA 2J4LA 3WWNA 3EK5A
chains in the Genus database with same CATH superfamily
3D2PA 4NDQA 2OGXB 4NDRA 2J5VA 2JJXA 1OH9A 4A7XA 3D40A 4NDQB 3TVIA 4NDRB 2CDQA 2J4KA 2BUFA 2JJ4A 4JZ9A 2AP9A 3S6GA 3K52A 1YBDA 3K56A 2OGXA 4KZTA 1E19A 3T7BA 3ZZGA 3LL5A 2JI5A 4NDPA 4JZ8A 2BNDA 2BMUA 2VA1A 4F6TB 4NDPB 1GSJA 2BRXA 2J0XA 3B8GA 2V5HA 3AB4A 2BNEA 1Z9DA 2BRIA 2WXBA 3K4YA 3AB2A 2RD5A 2J4JA 4OLCA 1B7BA 4AXSA 2BNFA 3LKKA 3QVHA 3C20A 2V4YA 4A7WA 3LL9A 1OHAA 3L76A 3QUOA 3ZZFA 3EK6A 4F6TA 2WE4A 4Q1TA 3QVFA 3C1MA 2IJ9A 4USJA 3QURA 3K4OA 2BTYA 4NDOB 2X2WA 3ZZIA 2R8VA 3S6HA 3S6KA 3NWYA 3WWMA 1GS5A 3D2MA 2R98A 3ZZHA 4I49A 2AKOA 3U6UA 3L86A 2W21A 2HMFA 4JZ7A 1OHBA 3D41A 4NDOA 3AAWA 2A1FA 2WE5A 2J0WA 3C1NA 2J5TA 4AB7A 3QUNA 3KZFA 2E9YA 2J4LA 3WWNA 3EK5A
chains in the Genus database with same CATH topology
3D2PA 4NDQA 2OGXB 4NDRA 2J5VA 2JJXA 1OH9A 4A7XA 3D40A 4NDQB 3TVIA 4NDRB 2CDQA 2J4KA 2BUFA 2JJ4A 4JZ9A 2AP9A 3S6GA 3K52A 1YBDA 3K56A 2OGXA 4KZTA 1E19A 3T7BA 3ZZGA 3LL5A 2JI5A 4NDPA 4JZ8A 2BNDA 2BMUA 2VA1A 4F6TB 4NDPB 1GSJA 2BRXA 2J0XA 3B8GA 2V5HA 3AB4A 2BNEA 1Z9DA 2BRIA 2WXBA 3K4YA 3AB2A 2RD5A 2J4JA 4OLCA 1B7BA 4AXSA 2BNFA 3LKKA 3QVHA 3C20A 2V4YA 4A7WA 3LL9A 1OHAA 3L76A 3QUOA 3ZZFA 3EK6A 4F6TA 2WE4A 4Q1TA 3QVFA 3C1MA 2IJ9A 4USJA 3QURA 3K4OA 2BTYA 4NDOB 2X2WA 3ZZIA 2R8VA 3S6HA 3S6KA 3NWYA 3WWMA 1GS5A 3D2MA 2R98A 3ZZHA 4I49A 2AKOA 3U6UA 3L86A 2W21A 2HMFA 4JZ7A 1OHBA 3D41A 4NDOA 3AAWA 2A1FA 2WE5A 2J0WA 3C1NA 2J5TA 4AB7A 3QUNA 3KZFA 2E9YA 2J4LA 3WWNA 3EK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2P A;  4NDQ A;  2OGX B;  4NDR A;  2J5V A;  2JJX A;  1OH9 A;  4A7X A;  3D40 A;  4NDQ B;  3TVI A;  4NDR B;  2CDQ A;  2J4K A;  2BUF A;  2JJ4 A;  4JZ9 A;  2AP9 A;  3S6G A;  3K52 A;  1YBD A;  3K56 A;  2OGX A;  4KZT A;  1E19 A;  3T7B A;  3ZZG A;  3LL5 A;  2JI5 A;  4NDP A;  4JZ8 A;  2BND A;  2BMU A;  2VA1 A;  4F6T B;  4NDP B;  1GSJ A;  2BRX A;  2J0X A;  3B8G A;  2V5H A;  3AB4 A;  2BNE A;  1Z9D A;  2BRI A;  2WXB A;  3K4Y A;  3AB2 A;  2RD5 A;  2J4J A;  4OLC A;  1B7B A;  4AXS A;  2BNF A;  3LKK A;  3QVH A;  3C20 A;  2V4Y A;  4A7W A;  3LL9 A;  1OHA A;  3L76 A;  3QUO A;  3ZZF A;  3EK6 A;  4F6T A;  2WE4 A;  4Q1T A;  3QVF A;  3C1M A;  2IJ9 A;  4USJ A;  3QUR A;  3K4O A;  2BTY A;  4NDO B;  2X2W A;  3ZZI A;  2R8V A;  3S6H A;  3S6K A;  3NWY A;  3WWM A;  1GS5 A;  3D2M A;  2R98 A;  3ZZH A;  4I49 A;  2AKO A;  3U6U A;  3L86 A;  2W21 A;  2HMF A;  4JZ7 A;  1OHB A;  3D41 A;  4NDO A;  3AAW A;  2A1F A;  2WE5 A;  2J0W A;  3C1N A;  2J5T A;  4AB7 A;  3QUN A;  3KZF A;  2E9Y A;  2J4L A;  3WWN A;  3EK5 A; 
#chains in the Genus database with same CATH topology
 3D2P A;  4NDQ A;  2OGX B;  4NDR A;  2J5V A;  2JJX A;  1OH9 A;  4A7X A;  3D40 A;  4NDQ B;  3TVI A;  4NDR B;  2CDQ A;  2J4K A;  2BUF A;  2JJ4 A;  4JZ9 A;  2AP9 A;  3S6G A;  3K52 A;  1YBD A;  3K56 A;  2OGX A;  4KZT A;  1E19 A;  3T7B A;  3ZZG A;  3LL5 A;  2JI5 A;  4NDP A;  4JZ8 A;  2BND A;  2BMU A;  2VA1 A;  4F6T B;  4NDP B;  1GSJ A;  2BRX A;  2J0X A;  3B8G A;  2V5H A;  3AB4 A;  2BNE A;  1Z9D A;  2BRI A;  2WXB A;  3K4Y A;  3AB2 A;  2RD5 A;  2J4J A;  4OLC A;  1B7B A;  4AXS A;  2BNF A;  3LKK A;  3QVH A;  3C20 A;  2V4Y A;  4A7W A;  3LL9 A;  1OHA A;  3L76 A;  3QUO A;  3ZZF A;  3EK6 A;  4F6T A;  2WE4 A;  4Q1T A;  3QVF A;  3C1M A;  2IJ9 A;  4USJ A;  3QUR A;  3K4O A;  2BTY A;  4NDO B;  2X2W A;  3ZZI A;  2R8V A;  3S6H A;  3S6K A;  3NWY A;  3WWM A;  1GS5 A;  3D2M A;  2R98 A;  3ZZH A;  4I49 A;  2AKO A;  3U6U A;  3L86 A;  2W21 A;  2HMF A;  4JZ7 A;  1OHB A;  3D41 A;  4NDO A;  3AAW A;  2A1F A;  2WE5 A;  2J0W A;  3C1N A;  2J5T A;  4AB7 A;  3QUN A;  3KZF A;  2E9Y A;  2J4L A;  3WWN A;  3EK5 A; 
#chains in the Genus database with same CATH homology
 3D2P A;  4NDQ A;  2OGX B;  4NDR A;  2J5V A;  2JJX A;  1OH9 A;  4A7X A;  3D40 A;  4NDQ B;  3TVI A;  4NDR B;  2CDQ A;  2J4K A;  2BUF A;  2JJ4 A;  4JZ9 A;  2AP9 A;  3S6G A;  3K52 A;  1YBD A;  3K56 A;  2OGX A;  4KZT A;  1E19 A;  3T7B A;  3ZZG A;  3LL5 A;  2JI5 A;  4NDP A;  4JZ8 A;  2BND A;  2BMU A;  2VA1 A;  4F6T B;  4NDP B;  1GSJ A;  2BRX A;  2J0X A;  3B8G A;  2V5H A;  3AB4 A;  2BNE A;  1Z9D A;  2BRI A;  2WXB A;  3K4Y A;  3AB2 A;  2RD5 A;  2J4J A;  4OLC A;  1B7B A;  4AXS A;  2BNF A;  3LKK A;  3QVH A;  3C20 A;  2V4Y A;  4A7W A;  3LL9 A;  1OHA A;  3L76 A;  3QUO A;  3ZZF A;  3EK6 A;  4F6T A;  2WE4 A;  4Q1T A;  3QVF A;  3C1M A;  2IJ9 A;  4USJ A;  3QUR A;  3K4O A;  2BTY A;  4NDO B;  2X2W A;  3ZZI A;  2R8V A;  3S6H A;  3S6K A;  3NWY A;  3WWM A;  1GS5 A;  3D2M A;  2R98 A;  3ZZH A;  4I49 A;  2AKO A;  3U6U A;  3L86 A;  2W21 A;  2HMF A;  4JZ7 A;  1OHB A;  3D41 A;  4NDO A;  3AAW A;  2A1F A;  2WE5 A;  2J0W A;  3C1N A;  2J5T A;  4AB7 A;  3QUN A;  3KZF A;  2E9Y A;  2J4L A;  3WWN A;  3EK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...