3D40A

Crystal structure of fosfomycin resistance kinase foma from streptomyces wedmorensis complexed with diphosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
271
structure length
252
Chain Sequence
b'SGLVPRGSHMTPDFLAIKVGGSLFSRKDEPGSLDDDAVTRFARNFARLAETYRGRMVLISGGGAFAFSLAGLTEATFEVKKRWAEKLRGIGVDAFPLQLAAMCTLRNGIPQLRSEVLRDVLDHGALPVLAGDALFDEHGKLWAFSSDRVPEVLLPMVEGRLRVVTLTDVDGIVTDGDTILPEVDARSPEQAYAALWGSSEGAMHTKLDALVTCARRGAECFIMRGDPGSDLEFLTAPFSSWPAHVRSTRITT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FomA protein
publication title Crystal Structure of Fosfomycin Resistance Kinase FomA from Streptomyces wedmorensis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Transferase
total genus 79
structure length 252
sequence length 271
ec nomenclature
pdb deposition date 2008-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3d40A00
2VA1A 2AKOA 4A7XA 3QURA 4Q1TA 2BNDA 3D2PA 2R98A 3NWYA 2BNFA 2E9YA 3S6GA 2J0WA 2J5VA 4JZ7A 2A1FA 2BUFA 3S6HA 2WE4A 3TVIA 3K4OA 3QVFA 2V5HA 3WWNA 3LKKA 3ZZFA 1OHBA 2OGXB 3LL5A 3K56A 2W21A 3D41A 3K52A 1E19A 4AB7A 2IJ9A 2R8VA 4NDRB 3ZZIA 4NDOB 2OGXA 4F6TB 3ZZHA 4OLCA 3QVHA 2X2WA 2J0XA 2BTYA 2JJ4A 3QUNA 3LL9A 4JZ9A 2RD5A 3S6KA 2V4YA 3QUOA 4AXSA 4A7WA 1OHAA 4NDRA 4NDQB 4NDOA 4F6TA 2J5TA 1Z9DA 2BMUA 4NDPA 2JJXA 2J4KA 2JI5A 3ZZGA 2AP9A 3L76A 3K4YA 3C20A 3AB2A 3D40A 2HMFA 4NDQA 3WWMA 4NDPB 2BNEA 1YBDA 4KZTA 3C1NA 3L86A 1B7BA 3U6UA 2WE5A 3KZFA 3B8GA 3D2MA 1OH9A 3T7BA 2J4LA 2CDQA 1GS5A 3C1MA 2WXBA 3EK5A 2J4JA 4USJA 4I49A 3AB4A 3AAWA 2BRIA 4JZ8A 2BRXA 1GSJA 3EK6A
chains in the Genus database with same CATH superfamily
2VA1A 2AKOA 4A7XA 3QURA 4Q1TA 2BNDA 3D2PA 2R98A 3NWYA 2BNFA 2E9YA 3S6GA 2J0WA 2J5VA 4JZ7A 2A1FA 2BUFA 3S6HA 2WE4A 3TVIA 3K4OA 3QVFA 2V5HA 3WWNA 3LKKA 3ZZFA 1OHBA 2OGXB 3LL5A 3K56A 2W21A 3D41A 3K52A 1E19A 4AB7A 2IJ9A 2R8VA 4NDRB 3ZZIA 4NDOB 2OGXA 4F6TB 3ZZHA 4OLCA 3QVHA 2X2WA 2J0XA 2BTYA 2JJ4A 3QUNA 3LL9A 4JZ9A 2RD5A 3S6KA 2V4YA 3QUOA 4AXSA 4A7WA 1OHAA 4NDRA 4NDQB 4NDOA 4F6TA 2J5TA 1Z9DA 2BMUA 4NDPA 2JJXA 2J4KA 2JI5A 3ZZGA 2AP9A 3L76A 3K4YA 3C20A 3AB2A 3D40A 2HMFA 4NDQA 3WWMA 4NDPB 2BNEA 1YBDA 4KZTA 3C1NA 3L86A 1B7BA 3U6UA 2WE5A 3KZFA 3B8GA 3D2MA 1OH9A 3T7BA 2J4LA 2CDQA 1GS5A 3C1MA 2WXBA 3EK5A 2J4JA 4USJA 4I49A 3AB4A 3AAWA 2BRIA 4JZ8A 2BRXA 1GSJA 3EK6A
chains in the Genus database with same CATH topology
2VA1A 2AKOA 4A7XA 3QURA 4Q1TA 2BNDA 3D2PA 2R98A 3NWYA 2BNFA 2E9YA 3S6GA 2J0WA 2J5VA 4JZ7A 2A1FA 2BUFA 3S6HA 2WE4A 3TVIA 3K4OA 3QVFA 2V5HA 3WWNA 3LKKA 3ZZFA 1OHBA 2OGXB 3LL5A 3K56A 2W21A 3D41A 3K52A 1E19A 4AB7A 2IJ9A 2R8VA 4NDRB 3ZZIA 4NDOB 2OGXA 4F6TB 3ZZHA 4OLCA 3QVHA 2X2WA 2J0XA 2BTYA 2JJ4A 3QUNA 3LL9A 4JZ9A 2RD5A 3S6KA 2V4YA 3QUOA 4AXSA 4A7WA 1OHAA 4NDRA 4NDQB 4NDOA 4F6TA 2J5TA 1Z9DA 2BMUA 4NDPA 2JJXA 2J4KA 2JI5A 3ZZGA 2AP9A 3L76A 3K4YA 3C20A 3AB2A 3D40A 2HMFA 4NDQA 3WWMA 4NDPB 2BNEA 1YBDA 4KZTA 3C1NA 3L86A 1B7BA 3U6UA 2WE5A 3KZFA 3B8GA 3D2MA 1OH9A 3T7BA 2J4LA 2CDQA 1GS5A 3C1MA 2WXBA 3EK5A 2J4JA 4USJA 4I49A 3AB4A 3AAWA 2BRIA 4JZ8A 2BRXA 1GSJA 3EK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VA1 A;  2AKO A;  4A7X A;  3QUR A;  4Q1T A;  2BND A;  3D2P A;  2R98 A;  3NWY A;  2BNF A;  2E9Y A;  3S6G A;  2J0W A;  2J5V A;  4JZ7 A;  2A1F A;  2BUF A;  3S6H A;  2WE4 A;  3TVI A;  3K4O A;  3QVF A;  2V5H A;  3WWN A;  3LKK A;  3ZZF A;  1OHB A;  2OGX B;  3LL5 A;  3K56 A;  2W21 A;  3D41 A;  3K52 A;  1E19 A;  4AB7 A;  2IJ9 A;  2R8V A;  4NDR B;  3ZZI A;  4NDO B;  2OGX A;  4F6T B;  3ZZH A;  4OLC A;  3QVH A;  2X2W A;  2J0X A;  2BTY A;  2JJ4 A;  3QUN A;  3LL9 A;  4JZ9 A;  2RD5 A;  3S6K A;  2V4Y A;  3QUO A;  4AXS A;  4A7W A;  1OHA A;  4NDR A;  4NDQ B;  4NDO A;  4F6T A;  2J5T A;  1Z9D A;  2BMU A;  4NDP A;  2JJX A;  2J4K A;  2JI5 A;  3ZZG A;  2AP9 A;  3L76 A;  3K4Y A;  3C20 A;  3AB2 A;  3D40 A;  2HMF A;  4NDQ A;  3WWM A;  4NDP B;  2BNE A;  1YBD A;  4KZT A;  3C1N A;  3L86 A;  1B7B A;  3U6U A;  2WE5 A;  3KZF A;  3B8G A;  3D2M A;  1OH9 A;  3T7B A;  2J4L A;  2CDQ A;  1GS5 A;  3C1M A;  2WXB A;  3EK5 A;  2J4J A;  4USJ A;  4I49 A;  3AB4 A;  3AAW A;  2BRI A;  4JZ8 A;  2BRX A;  1GSJ A;  3EK6 A; 
#chains in the Genus database with same CATH topology
 2VA1 A;  2AKO A;  4A7X A;  3QUR A;  4Q1T A;  2BND A;  3D2P A;  2R98 A;  3NWY A;  2BNF A;  2E9Y A;  3S6G A;  2J0W A;  2J5V A;  4JZ7 A;  2A1F A;  2BUF A;  3S6H A;  2WE4 A;  3TVI A;  3K4O A;  3QVF A;  2V5H A;  3WWN A;  3LKK A;  3ZZF A;  1OHB A;  2OGX B;  3LL5 A;  3K56 A;  2W21 A;  3D41 A;  3K52 A;  1E19 A;  4AB7 A;  2IJ9 A;  2R8V A;  4NDR B;  3ZZI A;  4NDO B;  2OGX A;  4F6T B;  3ZZH A;  4OLC A;  3QVH A;  2X2W A;  2J0X A;  2BTY A;  2JJ4 A;  3QUN A;  3LL9 A;  4JZ9 A;  2RD5 A;  3S6K A;  2V4Y A;  3QUO A;  4AXS A;  4A7W A;  1OHA A;  4NDR A;  4NDQ B;  4NDO A;  4F6T A;  2J5T A;  1Z9D A;  2BMU A;  4NDP A;  2JJX A;  2J4K A;  2JI5 A;  3ZZG A;  2AP9 A;  3L76 A;  3K4Y A;  3C20 A;  3AB2 A;  3D40 A;  2HMF A;  4NDQ A;  3WWM A;  4NDP B;  2BNE A;  1YBD A;  4KZT A;  3C1N A;  3L86 A;  1B7B A;  3U6U A;  2WE5 A;  3KZF A;  3B8G A;  3D2M A;  1OH9 A;  3T7B A;  2J4L A;  2CDQ A;  1GS5 A;  3C1M A;  2WXB A;  3EK5 A;  2J4J A;  4USJ A;  4I49 A;  3AB4 A;  3AAW A;  2BRI A;  4JZ8 A;  2BRX A;  1GSJ A;  3EK6 A; 
#chains in the Genus database with same CATH homology
 2VA1 A;  2AKO A;  4A7X A;  3QUR A;  4Q1T A;  2BND A;  3D2P A;  2R98 A;  3NWY A;  2BNF A;  2E9Y A;  3S6G A;  2J0W A;  2J5V A;  4JZ7 A;  2A1F A;  2BUF A;  3S6H A;  2WE4 A;  3TVI A;  3K4O A;  3QVF A;  2V5H A;  3WWN A;  3LKK A;  3ZZF A;  1OHB A;  2OGX B;  3LL5 A;  3K56 A;  2W21 A;  3D41 A;  3K52 A;  1E19 A;  4AB7 A;  2IJ9 A;  2R8V A;  4NDR B;  3ZZI A;  4NDO B;  2OGX A;  4F6T B;  3ZZH A;  4OLC A;  3QVH A;  2X2W A;  2J0X A;  2BTY A;  2JJ4 A;  3QUN A;  3LL9 A;  4JZ9 A;  2RD5 A;  3S6K A;  2V4Y A;  3QUO A;  4AXS A;  4A7W A;  1OHA A;  4NDR A;  4NDQ B;  4NDO A;  4F6T A;  2J5T A;  1Z9D A;  2BMU A;  4NDP A;  2JJX A;  2J4K A;  2JI5 A;  3ZZG A;  2AP9 A;  3L76 A;  3K4Y A;  3C20 A;  3AB2 A;  3D40 A;  2HMF A;  4NDQ A;  3WWM A;  4NDP B;  2BNE A;  1YBD A;  4KZT A;  3C1N A;  3L86 A;  1B7B A;  3U6U A;  2WE5 A;  3KZF A;  3B8G A;  3D2M A;  1OH9 A;  3T7B A;  2J4L A;  2CDQ A;  1GS5 A;  3C1M A;  2WXB A;  3EK5 A;  2J4J A;  4USJ A;  4I49 A;  3AB4 A;  3AAW A;  2BRI A;  4JZ8 A;  2BRX A;  1GSJ A;  3EK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...