2BRIA

Ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 69
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2briA00
2OGXA 2BNEA 2R8VA 3AB4A 3QVHA 3K56A 2J5VA 4F6TB 2JI5A 2OGXB 3K52A 2E9YA 4OLCA 2WE4A 1GS5A 2AKOA 2BTYA 1OHAA 2JJXA 4I49A 4JZ9A 4AXSA 2IJ9A 2J5TA 4F6TA 3D41A 2V5HA 1GSJA 2WXBA 2BMUA 3C20A 4NDQB 3ZZFA 2A1FA 3QURA 3L76A 2BRIA 3D2MA 4JZ7A 4USJA 4KZTA 4NDPB 4A7WA 1OH9A 3LL5A 3KZFA 4NDRB 3LKKA 1OHBA 3K4OA 2RD5A 4NDOA 3T7BA 1E19A 3ZZIA 2AP9A 3L86A 2JJ4A 2BRXA 2BNDA 2BUFA 3C1NA 2J4JA 3EK5A 3WWNA 2V4YA 3AB2A 1B7BA 3D2PA 3ZZGA 4NDOB 2CDQA 4NDRA 3S6GA 3D40A 4AB7A 3AAWA 3QUNA 3QVFA 3C1MA 2J4LA 3LL9A 3QUOA 3S6KA 2X2WA 4A7XA 4JZ8A 2VA1A 2BNFA 2J0WA 2J0XA 3K4YA 2WE5A 3ZZHA 1Z9DA 4NDPA 4Q1TA 3EK6A 2J4KA 3B8GA 2HMFA 2R98A 3WWMA 3NWYA 3S6HA 3TVIA 1YBDA 4NDQA 2W21A 3U6UA
chains in the Genus database with same CATH superfamily
2OGXA 2BNEA 2R8VA 3AB4A 3QVHA 3K56A 2J5VA 4F6TB 2JI5A 2OGXB 3K52A 2E9YA 4OLCA 2WE4A 1GS5A 2AKOA 2BTYA 1OHAA 2JJXA 4I49A 4JZ9A 4AXSA 2IJ9A 2J5TA 4F6TA 3D41A 2V5HA 1GSJA 2WXBA 2BMUA 3C20A 4NDQB 3ZZFA 2A1FA 3QURA 3L76A 2BRIA 3D2MA 4JZ7A 4USJA 4KZTA 4NDPB 4A7WA 1OH9A 3LL5A 3KZFA 4NDRB 3LKKA 1OHBA 3K4OA 2RD5A 4NDOA 3T7BA 1E19A 3ZZIA 2AP9A 3L86A 2JJ4A 2BRXA 2BNDA 2BUFA 3C1NA 2J4JA 3EK5A 3WWNA 2V4YA 3AB2A 1B7BA 3D2PA 3ZZGA 4NDOB 2CDQA 4NDRA 3S6GA 3D40A 4AB7A 3AAWA 3QUNA 3QVFA 3C1MA 2J4LA 3LL9A 3QUOA 3S6KA 2X2WA 4A7XA 4JZ8A 2VA1A 2BNFA 2J0WA 2J0XA 3K4YA 2WE5A 3ZZHA 1Z9DA 4NDPA 4Q1TA 3EK6A 2J4KA 3B8GA 2HMFA 2R98A 3WWMA 3NWYA 3S6HA 3TVIA 1YBDA 4NDQA 2W21A 3U6UA
chains in the Genus database with same CATH topology
2OGXA 2BNEA 2R8VA 3AB4A 3QVHA 3K56A 2J5VA 4F6TB 2JI5A 2OGXB 3K52A 2E9YA 4OLCA 2WE4A 1GS5A 2AKOA 2BTYA 1OHAA 2JJXA 4I49A 4JZ9A 4AXSA 2IJ9A 2J5TA 4F6TA 3D41A 2V5HA 1GSJA 2WXBA 2BMUA 3C20A 4NDQB 3ZZFA 2A1FA 3QURA 3L76A 2BRIA 3D2MA 4JZ7A 4USJA 4KZTA 4NDPB 4A7WA 1OH9A 3LL5A 3KZFA 4NDRB 3LKKA 1OHBA 3K4OA 2RD5A 4NDOA 3T7BA 1E19A 3ZZIA 2AP9A 3L86A 2JJ4A 2BRXA 2BNDA 2BUFA 3C1NA 2J4JA 3EK5A 3WWNA 2V4YA 3AB2A 1B7BA 3D2PA 3ZZGA 4NDOB 2CDQA 4NDRA 3S6GA 3D40A 4AB7A 3AAWA 3QUNA 3QVFA 3C1MA 2J4LA 3LL9A 3QUOA 3S6KA 2X2WA 4A7XA 4JZ8A 2VA1A 2BNFA 2J0WA 2J0XA 3K4YA 2WE5A 3ZZHA 1Z9DA 4NDPA 4Q1TA 3EK6A 2J4KA 3B8GA 2HMFA 2R98A 3WWMA 3NWYA 3S6HA 3TVIA 1YBDA 4NDQA 2W21A 3U6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGX A;  2BNE A;  2R8V A;  3AB4 A;  3QVH A;  3K56 A;  2J5V A;  4F6T B;  2JI5 A;  2OGX B;  3K52 A;  2E9Y A;  4OLC A;  2WE4 A;  1GS5 A;  2AKO A;  2BTY A;  1OHA A;  2JJX A;  4I49 A;  4JZ9 A;  4AXS A;  2IJ9 A;  2J5T A;  4F6T A;  3D41 A;  2V5H A;  1GSJ A;  2WXB A;  2BMU A;  3C20 A;  4NDQ B;  3ZZF A;  2A1F A;  3QUR A;  3L76 A;  2BRI A;  3D2M A;  4JZ7 A;  4USJ A;  4KZT A;  4NDP B;  4A7W A;  1OH9 A;  3LL5 A;  3KZF A;  4NDR B;  3LKK A;  1OHB A;  3K4O A;  2RD5 A;  4NDO A;  3T7B A;  1E19 A;  3ZZI A;  2AP9 A;  3L86 A;  2JJ4 A;  2BRX A;  2BND A;  2BUF A;  3C1N A;  2J4J A;  3EK5 A;  3WWN A;  2V4Y A;  3AB2 A;  1B7B A;  3D2P A;  3ZZG A;  4NDO B;  2CDQ A;  4NDR A;  3S6G A;  3D40 A;  4AB7 A;  3AAW A;  3QUN A;  3QVF A;  3C1M A;  2J4L A;  3LL9 A;  3QUO A;  3S6K A;  2X2W A;  4A7X A;  4JZ8 A;  2VA1 A;  2BNF A;  2J0W A;  2J0X A;  3K4Y A;  2WE5 A;  3ZZH A;  1Z9D A;  4NDP A;  4Q1T A;  3EK6 A;  2J4K A;  3B8G A;  2HMF A;  2R98 A;  3WWM A;  3NWY A;  3S6H A;  3TVI A;  1YBD A;  4NDQ A;  2W21 A;  3U6U A; 
#chains in the Genus database with same CATH topology
 2OGX A;  2BNE A;  2R8V A;  3AB4 A;  3QVH A;  3K56 A;  2J5V A;  4F6T B;  2JI5 A;  2OGX B;  3K52 A;  2E9Y A;  4OLC A;  2WE4 A;  1GS5 A;  2AKO A;  2BTY A;  1OHA A;  2JJX A;  4I49 A;  4JZ9 A;  4AXS A;  2IJ9 A;  2J5T A;  4F6T A;  3D41 A;  2V5H A;  1GSJ A;  2WXB A;  2BMU A;  3C20 A;  4NDQ B;  3ZZF A;  2A1F A;  3QUR A;  3L76 A;  2BRI A;  3D2M A;  4JZ7 A;  4USJ A;  4KZT A;  4NDP B;  4A7W A;  1OH9 A;  3LL5 A;  3KZF A;  4NDR B;  3LKK A;  1OHB A;  3K4O A;  2RD5 A;  4NDO A;  3T7B A;  1E19 A;  3ZZI A;  2AP9 A;  3L86 A;  2JJ4 A;  2BRX A;  2BND A;  2BUF A;  3C1N A;  2J4J A;  3EK5 A;  3WWN A;  2V4Y A;  3AB2 A;  1B7B A;  3D2P A;  3ZZG A;  4NDO B;  2CDQ A;  4NDR A;  3S6G A;  3D40 A;  4AB7 A;  3AAW A;  3QUN A;  3QVF A;  3C1M A;  2J4L A;  3LL9 A;  3QUO A;  3S6K A;  2X2W A;  4A7X A;  4JZ8 A;  2VA1 A;  2BNF A;  2J0W A;  2J0X A;  3K4Y A;  2WE5 A;  3ZZH A;  1Z9D A;  4NDP A;  4Q1T A;  3EK6 A;  2J4K A;  3B8G A;  2HMF A;  2R98 A;  3WWM A;  3NWY A;  3S6H A;  3TVI A;  1YBD A;  4NDQ A;  2W21 A;  3U6U A; 
#chains in the Genus database with same CATH homology
 2OGX A;  2BNE A;  2R8V A;  3AB4 A;  3QVH A;  3K56 A;  2J5V A;  4F6T B;  2JI5 A;  2OGX B;  3K52 A;  2E9Y A;  4OLC A;  2WE4 A;  1GS5 A;  2AKO A;  2BTY A;  1OHA A;  2JJX A;  4I49 A;  4JZ9 A;  4AXS A;  2IJ9 A;  2J5T A;  4F6T A;  3D41 A;  2V5H A;  1GSJ A;  2WXB A;  2BMU A;  3C20 A;  4NDQ B;  3ZZF A;  2A1F A;  3QUR A;  3L76 A;  2BRI A;  3D2M A;  4JZ7 A;  4USJ A;  4KZT A;  4NDP B;  4A7W A;  1OH9 A;  3LL5 A;  3KZF A;  4NDR B;  3LKK A;  1OHB A;  3K4O A;  2RD5 A;  4NDO A;  3T7B A;  1E19 A;  3ZZI A;  2AP9 A;  3L86 A;  2JJ4 A;  2BRX A;  2BND A;  2BUF A;  3C1N A;  2J4J A;  3EK5 A;  3WWN A;  2V4Y A;  3AB2 A;  1B7B A;  3D2P A;  3ZZG A;  4NDO B;  2CDQ A;  4NDR A;  3S6G A;  3D40 A;  4AB7 A;  3AAW A;  3QUN A;  3QVF A;  3C1M A;  2J4L A;  3LL9 A;  3QUO A;  3S6K A;  2X2W A;  4A7X A;  4JZ8 A;  2VA1 A;  2BNF A;  2J0W A;  2J0X A;  3K4Y A;  2WE5 A;  3ZZH A;  1Z9D A;  4NDP A;  4Q1T A;  3EK6 A;  2J4K A;  3B8G A;  2HMF A;  2R98 A;  3WWM A;  3NWY A;  3S6H A;  3TVI A;  1YBD A;  4NDQ A;  2W21 A;  3U6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...