2BRIA

Ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 69
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2briA00
2OGXB 3KZFA 3LL9A 2A1FA 4NDRA 2V5HA 2CDQA 2J0WA 4AXSA 4OLCA 2V4YA 3QURA 1OH9A 3EK5A 4NDQB 1GSJA 3L86A 2J5VA 3K4OA 3WWNA 3L76A 2IJ9A 4AB7A 3D40A 4NDRB 4NDQA 3TVIA 2BTYA 4Q1TA 3EK6A 2JJ4A 3U6UA 3AAWA 3K52A 3C1NA 2WXBA 4NDPB 2AKOA 3AB2A 2J4KA 3WWMA 4NDOB 3AB4A 2HMFA 1OHAA 4JZ9A 4NDPA 3S6GA 4I49A 3ZZHA 3QUNA 3NWYA 4A7XA 3ZZFA 4NDOA 2R8VA 2J5TA 3S6KA 4F6TB 2WE4A 4A7WA 2BRXA 2AP9A 2W21A 3C1MA 1E19A 3K4YA 1YBDA 1OHBA 1Z9DA 2E9YA 4F6TA 3T7BA 3LL5A 2BMUA 3S6HA 3QUOA 2J0XA 2J4JA 2BUFA 1GS5A 2VA1A 3C20A 2X2WA 3B8GA 4KZTA 2WE5A 3K56A 3D41A 2BNFA 3D2MA 3D2PA 2OGXA 2JJXA 3ZZGA 3QVFA 3LKKA 3ZZIA 2JI5A 2J4LA 3QVHA 2BNDA 2BNEA 2RD5A 4JZ7A 2BRIA 1B7BA 4USJA 2R98A 4JZ8A
chains in the Genus database with same CATH superfamily
2OGXB 3KZFA 3LL9A 2A1FA 4NDRA 2V5HA 2CDQA 2J0WA 4AXSA 4OLCA 2V4YA 3QURA 1OH9A 3EK5A 4NDQB 1GSJA 3L86A 2J5VA 3K4OA 3WWNA 3L76A 2IJ9A 4AB7A 3D40A 4NDRB 4NDQA 3TVIA 2BTYA 4Q1TA 3EK6A 2JJ4A 3U6UA 3AAWA 3K52A 3C1NA 2WXBA 4NDPB 2AKOA 3AB2A 2J4KA 3WWMA 4NDOB 3AB4A 2HMFA 1OHAA 4JZ9A 4NDPA 3S6GA 4I49A 3ZZHA 3QUNA 3NWYA 4A7XA 3ZZFA 4NDOA 2R8VA 2J5TA 3S6KA 4F6TB 2WE4A 4A7WA 2BRXA 2AP9A 2W21A 3C1MA 1E19A 3K4YA 1YBDA 1OHBA 1Z9DA 2E9YA 4F6TA 3T7BA 3LL5A 2BMUA 3S6HA 3QUOA 2J0XA 2J4JA 2BUFA 1GS5A 2VA1A 3C20A 2X2WA 3B8GA 4KZTA 2WE5A 3K56A 3D41A 2BNFA 3D2MA 3D2PA 2OGXA 2JJXA 3ZZGA 3QVFA 3LKKA 3ZZIA 2JI5A 2J4LA 3QVHA 2BNDA 2BNEA 2RD5A 4JZ7A 2BRIA 1B7BA 4USJA 2R98A 4JZ8A
chains in the Genus database with same CATH topology
2OGXB 3KZFA 3LL9A 2A1FA 4NDRA 2V5HA 2CDQA 2J0WA 4AXSA 4OLCA 2V4YA 3QURA 1OH9A 3EK5A 4NDQB 1GSJA 3L86A 2J5VA 3K4OA 3WWNA 3L76A 2IJ9A 4AB7A 3D40A 4NDRB 4NDQA 3TVIA 2BTYA 4Q1TA 3EK6A 2JJ4A 3U6UA 3AAWA 3K52A 3C1NA 2WXBA 4NDPB 2AKOA 3AB2A 2J4KA 3WWMA 4NDOB 3AB4A 2HMFA 1OHAA 4JZ9A 4NDPA 3S6GA 4I49A 3ZZHA 3QUNA 3NWYA 4A7XA 3ZZFA 4NDOA 2R8VA 2J5TA 3S6KA 4F6TB 2WE4A 4A7WA 2BRXA 2AP9A 2W21A 3C1MA 1E19A 3K4YA 1YBDA 1OHBA 1Z9DA 2E9YA 4F6TA 3T7BA 3LL5A 2BMUA 3S6HA 3QUOA 2J0XA 2J4JA 2BUFA 1GS5A 2VA1A 3C20A 2X2WA 3B8GA 4KZTA 2WE5A 3K56A 3D41A 2BNFA 3D2MA 3D2PA 2OGXA 2JJXA 3ZZGA 3QVFA 3LKKA 3ZZIA 2JI5A 2J4LA 3QVHA 2BNDA 2BNEA 2RD5A 4JZ7A 2BRIA 1B7BA 4USJA 2R98A 4JZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OGX B;  3KZF A;  3LL9 A;  2A1F A;  4NDR A;  2V5H A;  2CDQ A;  2J0W A;  4AXS A;  4OLC A;  2V4Y A;  3QUR A;  1OH9 A;  3EK5 A;  4NDQ B;  1GSJ A;  3L86 A;  2J5V A;  3K4O A;  3WWN A;  3L76 A;  2IJ9 A;  4AB7 A;  3D40 A;  4NDR B;  4NDQ A;  3TVI A;  2BTY A;  4Q1T A;  3EK6 A;  2JJ4 A;  3U6U A;  3AAW A;  3K52 A;  3C1N A;  2WXB A;  4NDP B;  2AKO A;  3AB2 A;  2J4K A;  3WWM A;  4NDO B;  3AB4 A;  2HMF A;  1OHA A;  4JZ9 A;  4NDP A;  3S6G A;  4I49 A;  3ZZH A;  3QUN A;  3NWY A;  4A7X A;  3ZZF A;  4NDO A;  2R8V A;  2J5T A;  3S6K A;  4F6T B;  2WE4 A;  4A7W A;  2BRX A;  2AP9 A;  2W21 A;  3C1M A;  1E19 A;  3K4Y A;  1YBD A;  1OHB A;  1Z9D A;  2E9Y A;  4F6T A;  3T7B A;  3LL5 A;  2BMU A;  3S6H A;  3QUO A;  2J0X A;  2J4J A;  2BUF A;  1GS5 A;  2VA1 A;  3C20 A;  2X2W A;  3B8G A;  4KZT A;  2WE5 A;  3K56 A;  3D41 A;  2BNF A;  3D2M A;  3D2P A;  2OGX A;  2JJX A;  3ZZG A;  3QVF A;  3LKK A;  3ZZI A;  2JI5 A;  2J4L A;  3QVH A;  2BND A;  2BNE A;  2RD5 A;  4JZ7 A;  2BRI A;  1B7B A;  4USJ A;  2R98 A;  4JZ8 A; 
#chains in the Genus database with same CATH topology
 2OGX B;  3KZF A;  3LL9 A;  2A1F A;  4NDR A;  2V5H A;  2CDQ A;  2J0W A;  4AXS A;  4OLC A;  2V4Y A;  3QUR A;  1OH9 A;  3EK5 A;  4NDQ B;  1GSJ A;  3L86 A;  2J5V A;  3K4O A;  3WWN A;  3L76 A;  2IJ9 A;  4AB7 A;  3D40 A;  4NDR B;  4NDQ A;  3TVI A;  2BTY A;  4Q1T A;  3EK6 A;  2JJ4 A;  3U6U A;  3AAW A;  3K52 A;  3C1N A;  2WXB A;  4NDP B;  2AKO A;  3AB2 A;  2J4K A;  3WWM A;  4NDO B;  3AB4 A;  2HMF A;  1OHA A;  4JZ9 A;  4NDP A;  3S6G A;  4I49 A;  3ZZH A;  3QUN A;  3NWY A;  4A7X A;  3ZZF A;  4NDO A;  2R8V A;  2J5T A;  3S6K A;  4F6T B;  2WE4 A;  4A7W A;  2BRX A;  2AP9 A;  2W21 A;  3C1M A;  1E19 A;  3K4Y A;  1YBD A;  1OHB A;  1Z9D A;  2E9Y A;  4F6T A;  3T7B A;  3LL5 A;  2BMU A;  3S6H A;  3QUO A;  2J0X A;  2J4J A;  2BUF A;  1GS5 A;  2VA1 A;  3C20 A;  2X2W A;  3B8G A;  4KZT A;  2WE5 A;  3K56 A;  3D41 A;  2BNF A;  3D2M A;  3D2P A;  2OGX A;  2JJX A;  3ZZG A;  3QVF A;  3LKK A;  3ZZI A;  2JI5 A;  2J4L A;  3QVH A;  2BND A;  2BNE A;  2RD5 A;  4JZ7 A;  2BRI A;  1B7B A;  4USJ A;  2R98 A;  4JZ8 A; 
#chains in the Genus database with same CATH homology
 2OGX B;  3KZF A;  3LL9 A;  2A1F A;  4NDR A;  2V5H A;  2CDQ A;  2J0W A;  4AXS A;  4OLC A;  2V4Y A;  3QUR A;  1OH9 A;  3EK5 A;  4NDQ B;  1GSJ A;  3L86 A;  2J5V A;  3K4O A;  3WWN A;  3L76 A;  2IJ9 A;  4AB7 A;  3D40 A;  4NDR B;  4NDQ A;  3TVI A;  2BTY A;  4Q1T A;  3EK6 A;  2JJ4 A;  3U6U A;  3AAW A;  3K52 A;  3C1N A;  2WXB A;  4NDP B;  2AKO A;  3AB2 A;  2J4K A;  3WWM A;  4NDO B;  3AB4 A;  2HMF A;  1OHA A;  4JZ9 A;  4NDP A;  3S6G A;  4I49 A;  3ZZH A;  3QUN A;  3NWY A;  4A7X A;  3ZZF A;  4NDO A;  2R8V A;  2J5T A;  3S6K A;  4F6T B;  2WE4 A;  4A7W A;  2BRX A;  2AP9 A;  2W21 A;  3C1M A;  1E19 A;  3K4Y A;  1YBD A;  1OHB A;  1Z9D A;  2E9Y A;  4F6T A;  3T7B A;  3LL5 A;  2BMU A;  3S6H A;  3QUO A;  2J0X A;  2J4J A;  2BUF A;  1GS5 A;  2VA1 A;  3C20 A;  2X2W A;  3B8G A;  4KZT A;  2WE5 A;  3K56 A;  3D41 A;  2BNF A;  3D2M A;  3D2P A;  2OGX A;  2JJX A;  3ZZG A;  3QVF A;  3LKK A;  3ZZI A;  2JI5 A;  2J4L A;  3QVH A;  2BND A;  2BNE A;  2RD5 A;  4JZ7 A;  2BRI A;  1B7B A;  4USJ A;  2R98 A;  4JZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...