2BRIA

Ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 69
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2briA00
3ZZGA 4NDRA 3S6GA 2BNEA 3K56A 3KZFA 2JJXA 4JZ8A 4NDPB 4Q1TA 2VA1A 4NDQA 3L76A 2BNDA 3L86A 3LKKA 3EK5A 3WWNA 1GSJA 3ZZFA 2J0XA 3TVIA 3T7BA 2CDQA 2OGXB 1OH9A 2JJ4A 2BRIA 2J0WA 2J5VA 2HMFA 3K4YA 3QUOA 4OLCA 3C20A 2J5TA 3LL9A 4A7WA 2J4KA 2WE4A 3EK6A 4NDOB 2J4JA 2E9YA 4F6TA 2WXBA 2AKOA 3B8GA 2R98A 4NDRB 3NWYA 2J4LA 3QUNA 3AAWA 3C1NA 3AB2A 2BNFA 3D2PA 4JZ7A 2V4YA 1OHBA 2WE5A 4NDQB 2IJ9A 3K52A 1OHAA 4NDPA 2JI5A 3C1MA 3K4OA 2BRXA 3D41A 4AXSA 2A1FA 2X2WA 3ZZHA 2V5HA 2W21A 2R8VA 1B7BA 2BMUA 3LL5A 3S6KA 4USJA 2OGXA 2BTYA 4AB7A 2RD5A 3S6HA 4I49A 4A7XA 2AP9A 3AB4A 3QVFA 1E19A 3ZZIA 2BUFA 4KZTA 4F6TB 3QVHA 3U6UA 1YBDA 3QURA 4NDOA 1Z9DA 3D2MA 3D40A 4JZ9A 1GS5A 3WWMA
chains in the Genus database with same CATH superfamily
3ZZGA 4NDRA 3S6GA 2BNEA 3K56A 3KZFA 2JJXA 4JZ8A 4NDPB 4Q1TA 2VA1A 4NDQA 3L76A 2BNDA 3L86A 3LKKA 3EK5A 3WWNA 1GSJA 3ZZFA 2J0XA 3TVIA 3T7BA 2CDQA 2OGXB 1OH9A 2JJ4A 2BRIA 2J0WA 2J5VA 2HMFA 3K4YA 3QUOA 4OLCA 3C20A 2J5TA 3LL9A 4A7WA 2J4KA 2WE4A 3EK6A 4NDOB 2J4JA 2E9YA 4F6TA 2WXBA 2AKOA 3B8GA 2R98A 4NDRB 3NWYA 2J4LA 3QUNA 3AAWA 3C1NA 3AB2A 2BNFA 3D2PA 4JZ7A 2V4YA 1OHBA 2WE5A 4NDQB 2IJ9A 3K52A 1OHAA 4NDPA 2JI5A 3C1MA 3K4OA 2BRXA 3D41A 4AXSA 2A1FA 2X2WA 3ZZHA 2V5HA 2W21A 2R8VA 1B7BA 2BMUA 3LL5A 3S6KA 4USJA 2OGXA 2BTYA 4AB7A 2RD5A 3S6HA 4I49A 4A7XA 2AP9A 3AB4A 3QVFA 1E19A 3ZZIA 2BUFA 4KZTA 4F6TB 3QVHA 3U6UA 1YBDA 3QURA 4NDOA 1Z9DA 3D2MA 3D40A 4JZ9A 1GS5A 3WWMA
chains in the Genus database with same CATH topology
3ZZGA 4NDRA 3S6GA 2BNEA 3K56A 3KZFA 2JJXA 4JZ8A 4NDPB 4Q1TA 2VA1A 4NDQA 3L76A 2BNDA 3L86A 3LKKA 3EK5A 3WWNA 1GSJA 3ZZFA 2J0XA 3TVIA 3T7BA 2CDQA 2OGXB 1OH9A 2JJ4A 2BRIA 2J0WA 2J5VA 2HMFA 3K4YA 3QUOA 4OLCA 3C20A 2J5TA 3LL9A 4A7WA 2J4KA 2WE4A 3EK6A 4NDOB 2J4JA 2E9YA 4F6TA 2WXBA 2AKOA 3B8GA 2R98A 4NDRB 3NWYA 2J4LA 3QUNA 3AAWA 3C1NA 3AB2A 2BNFA 3D2PA 4JZ7A 2V4YA 1OHBA 2WE5A 4NDQB 2IJ9A 3K52A 1OHAA 4NDPA 2JI5A 3C1MA 3K4OA 2BRXA 3D41A 4AXSA 2A1FA 2X2WA 3ZZHA 2V5HA 2W21A 2R8VA 1B7BA 2BMUA 3LL5A 3S6KA 4USJA 2OGXA 2BTYA 4AB7A 2RD5A 3S6HA 4I49A 4A7XA 2AP9A 3AB4A 3QVFA 1E19A 3ZZIA 2BUFA 4KZTA 4F6TB 3QVHA 3U6UA 1YBDA 3QURA 4NDOA 1Z9DA 3D2MA 3D40A 4JZ9A 1GS5A 3WWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZG A;  4NDR A;  3S6G A;  2BNE A;  3K56 A;  3KZF A;  2JJX A;  4JZ8 A;  4NDP B;  4Q1T A;  2VA1 A;  4NDQ A;  3L76 A;  2BND A;  3L86 A;  3LKK A;  3EK5 A;  3WWN A;  1GSJ A;  3ZZF A;  2J0X A;  3TVI A;  3T7B A;  2CDQ A;  2OGX B;  1OH9 A;  2JJ4 A;  2BRI A;  2J0W A;  2J5V A;  2HMF A;  3K4Y A;  3QUO A;  4OLC A;  3C20 A;  2J5T A;  3LL9 A;  4A7W A;  2J4K A;  2WE4 A;  3EK6 A;  4NDO B;  2J4J A;  2E9Y A;  4F6T A;  2WXB A;  2AKO A;  3B8G A;  2R98 A;  4NDR B;  3NWY A;  2J4L A;  3QUN A;  3AAW A;  3C1N A;  3AB2 A;  2BNF A;  3D2P A;  4JZ7 A;  2V4Y A;  1OHB A;  2WE5 A;  4NDQ B;  2IJ9 A;  3K52 A;  1OHA A;  4NDP A;  2JI5 A;  3C1M A;  3K4O A;  2BRX A;  3D41 A;  4AXS A;  2A1F A;  2X2W A;  3ZZH A;  2V5H A;  2W21 A;  2R8V A;  1B7B A;  2BMU A;  3LL5 A;  3S6K A;  4USJ A;  2OGX A;  2BTY A;  4AB7 A;  2RD5 A;  3S6H A;  4I49 A;  4A7X A;  2AP9 A;  3AB4 A;  3QVF A;  1E19 A;  3ZZI A;  2BUF A;  4KZT A;  4F6T B;  3QVH A;  3U6U A;  1YBD A;  3QUR A;  4NDO A;  1Z9D A;  3D2M A;  3D40 A;  4JZ9 A;  1GS5 A;  3WWM A; 
#chains in the Genus database with same CATH topology
 3ZZG A;  4NDR A;  3S6G A;  2BNE A;  3K56 A;  3KZF A;  2JJX A;  4JZ8 A;  4NDP B;  4Q1T A;  2VA1 A;  4NDQ A;  3L76 A;  2BND A;  3L86 A;  3LKK A;  3EK5 A;  3WWN A;  1GSJ A;  3ZZF A;  2J0X A;  3TVI A;  3T7B A;  2CDQ A;  2OGX B;  1OH9 A;  2JJ4 A;  2BRI A;  2J0W A;  2J5V A;  2HMF A;  3K4Y A;  3QUO A;  4OLC A;  3C20 A;  2J5T A;  3LL9 A;  4A7W A;  2J4K A;  2WE4 A;  3EK6 A;  4NDO B;  2J4J A;  2E9Y A;  4F6T A;  2WXB A;  2AKO A;  3B8G A;  2R98 A;  4NDR B;  3NWY A;  2J4L A;  3QUN A;  3AAW A;  3C1N A;  3AB2 A;  2BNF A;  3D2P A;  4JZ7 A;  2V4Y A;  1OHB A;  2WE5 A;  4NDQ B;  2IJ9 A;  3K52 A;  1OHA A;  4NDP A;  2JI5 A;  3C1M A;  3K4O A;  2BRX A;  3D41 A;  4AXS A;  2A1F A;  2X2W A;  3ZZH A;  2V5H A;  2W21 A;  2R8V A;  1B7B A;  2BMU A;  3LL5 A;  3S6K A;  4USJ A;  2OGX A;  2BTY A;  4AB7 A;  2RD5 A;  3S6H A;  4I49 A;  4A7X A;  2AP9 A;  3AB4 A;  3QVF A;  1E19 A;  3ZZI A;  2BUF A;  4KZT A;  4F6T B;  3QVH A;  3U6U A;  1YBD A;  3QUR A;  4NDO A;  1Z9D A;  3D2M A;  3D40 A;  4JZ9 A;  1GS5 A;  3WWM A; 
#chains in the Genus database with same CATH homology
 3ZZG A;  4NDR A;  3S6G A;  2BNE A;  3K56 A;  3KZF A;  2JJX A;  4JZ8 A;  4NDP B;  4Q1T A;  2VA1 A;  4NDQ A;  3L76 A;  2BND A;  3L86 A;  3LKK A;  3EK5 A;  3WWN A;  1GSJ A;  3ZZF A;  2J0X A;  3TVI A;  3T7B A;  2CDQ A;  2OGX B;  1OH9 A;  2JJ4 A;  2BRI A;  2J0W A;  2J5V A;  2HMF A;  3K4Y A;  3QUO A;  4OLC A;  3C20 A;  2J5T A;  3LL9 A;  4A7W A;  2J4K A;  2WE4 A;  3EK6 A;  4NDO B;  2J4J A;  2E9Y A;  4F6T A;  2WXB A;  2AKO A;  3B8G A;  2R98 A;  4NDR B;  3NWY A;  2J4L A;  3QUN A;  3AAW A;  3C1N A;  3AB2 A;  2BNF A;  3D2P A;  4JZ7 A;  2V4Y A;  1OHB A;  2WE5 A;  4NDQ B;  2IJ9 A;  3K52 A;  1OHA A;  4NDP A;  2JI5 A;  3C1M A;  3K4O A;  2BRX A;  3D41 A;  4AXS A;  2A1F A;  2X2W A;  3ZZH A;  2V5H A;  2W21 A;  2R8V A;  1B7B A;  2BMU A;  3LL5 A;  3S6K A;  4USJ A;  2OGX A;  2BTY A;  4AB7 A;  2RD5 A;  3S6H A;  4I49 A;  4A7X A;  2AP9 A;  3AB4 A;  3QVF A;  1E19 A;  3ZZI A;  2BUF A;  4KZT A;  4F6T B;  3QVH A;  3U6U A;  1YBD A;  3QUR A;  4NDO A;  1Z9D A;  3D2M A;  3D40 A;  4JZ9 A;  1GS5 A;  3WWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...