2BRIA

Ump kinase from pyrococcus furiosus complexed with its substrate analog amppnp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 69
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2briA00
3LL9A 4OLCA 3QURA 3ZZFA 2V4YA 4F6TA 3EK6A 2CDQA 3B8GA 2J4KA 2BNFA 2J5TA 3QUNA 2E9YA 2J5VA 1GSJA 3K56A 2BNDA 4I49A 3ZZIA 3S6KA 2WE5A 1OHBA 2J4LA 2BMUA 4KZTA 2V5HA 3NWYA 3TVIA 4A7XA 4AXSA 2WE4A 2R98A 3QVHA 3C1MA 3C1NA 3D2MA 2X2WA 4NDOB 3S6GA 2R8VA 2HMFA 2AP9A 3T7BA 4JZ9A 3D2PA 3AB2A 2BUFA 3ZZGA 4NDPB 3U6UA 2WXBA 3K4OA 2VA1A 3WWMA 2A1FA 2JI5A 3D40A 2BRXA 2JJ4A 4Q1TA 2J0XA 2BNEA 4JZ8A 1OH9A 1Z9DA 4NDRB 3C20A 4NDOA 1OHAA 4USJA 3AB4A 4JZ7A 4NDQB 2OGXB 2IJ9A 3LL5A 2BRIA 3AAWA 4NDPA 2J4JA 2RD5A 3WWNA 3K4YA 1B7BA 4AB7A 2W21A 2AKOA 2JJXA 3LKKA 4F6TB 3S6HA 1E19A 1YBDA 3K52A 3EK5A 4NDRA 3L86A 3QUOA 3QVFA 4A7WA 1GS5A 3KZFA 4NDQA 2OGXA 3L76A 2BTYA 2J0WA 3ZZHA 3D41A
chains in the Genus database with same CATH superfamily
3LL9A 4OLCA 3QURA 3ZZFA 2V4YA 4F6TA 3EK6A 2CDQA 3B8GA 2J4KA 2BNFA 2J5TA 3QUNA 2E9YA 2J5VA 1GSJA 3K56A 2BNDA 4I49A 3ZZIA 3S6KA 2WE5A 1OHBA 2J4LA 2BMUA 4KZTA 2V5HA 3NWYA 3TVIA 4A7XA 4AXSA 2WE4A 2R98A 3QVHA 3C1MA 3C1NA 3D2MA 2X2WA 4NDOB 3S6GA 2R8VA 2HMFA 2AP9A 3T7BA 4JZ9A 3D2PA 3AB2A 2BUFA 3ZZGA 4NDPB 3U6UA 2WXBA 3K4OA 2VA1A 3WWMA 2A1FA 2JI5A 3D40A 2BRXA 2JJ4A 4Q1TA 2J0XA 2BNEA 4JZ8A 1OH9A 1Z9DA 4NDRB 3C20A 4NDOA 1OHAA 4USJA 3AB4A 4JZ7A 4NDQB 2OGXB 2IJ9A 3LL5A 2BRIA 3AAWA 4NDPA 2J4JA 2RD5A 3WWNA 3K4YA 1B7BA 4AB7A 2W21A 2AKOA 2JJXA 3LKKA 4F6TB 3S6HA 1E19A 1YBDA 3K52A 3EK5A 4NDRA 3L86A 3QUOA 3QVFA 4A7WA 1GS5A 3KZFA 4NDQA 2OGXA 3L76A 2BTYA 2J0WA 3ZZHA 3D41A
chains in the Genus database with same CATH topology
3LL9A 4OLCA 3QURA 3ZZFA 2V4YA 4F6TA 3EK6A 2CDQA 3B8GA 2J4KA 2BNFA 2J5TA 3QUNA 2E9YA 2J5VA 1GSJA 3K56A 2BNDA 4I49A 3ZZIA 3S6KA 2WE5A 1OHBA 2J4LA 2BMUA 4KZTA 2V5HA 3NWYA 3TVIA 4A7XA 4AXSA 2WE4A 2R98A 3QVHA 3C1MA 3C1NA 3D2MA 2X2WA 4NDOB 3S6GA 2R8VA 2HMFA 2AP9A 3T7BA 4JZ9A 3D2PA 3AB2A 2BUFA 3ZZGA 4NDPB 3U6UA 2WXBA 3K4OA 2VA1A 3WWMA 2A1FA 2JI5A 3D40A 2BRXA 2JJ4A 4Q1TA 2J0XA 2BNEA 4JZ8A 1OH9A 1Z9DA 4NDRB 3C20A 4NDOA 1OHAA 4USJA 3AB4A 4JZ7A 4NDQB 2OGXB 2IJ9A 3LL5A 2BRIA 3AAWA 4NDPA 2J4JA 2RD5A 3WWNA 3K4YA 1B7BA 4AB7A 2W21A 2AKOA 2JJXA 3LKKA 4F6TB 3S6HA 1E19A 1YBDA 3K52A 3EK5A 4NDRA 3L86A 3QUOA 3QVFA 4A7WA 1GS5A 3KZFA 4NDQA 2OGXA 3L76A 2BTYA 2J0WA 3ZZHA 3D41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LL9 A;  4OLC A;  3QUR A;  3ZZF A;  2V4Y A;  4F6T A;  3EK6 A;  2CDQ A;  3B8G A;  2J4K A;  2BNF A;  2J5T A;  3QUN A;  2E9Y A;  2J5V A;  1GSJ A;  3K56 A;  2BND A;  4I49 A;  3ZZI A;  3S6K A;  2WE5 A;  1OHB A;  2J4L A;  2BMU A;  4KZT A;  2V5H A;  3NWY A;  3TVI A;  4A7X A;  4AXS A;  2WE4 A;  2R98 A;  3QVH A;  3C1M A;  3C1N A;  3D2M A;  2X2W A;  4NDO B;  3S6G A;  2R8V A;  2HMF A;  2AP9 A;  3T7B A;  4JZ9 A;  3D2P A;  3AB2 A;  2BUF A;  3ZZG A;  4NDP B;  3U6U A;  2WXB A;  3K4O A;  2VA1 A;  3WWM A;  2A1F A;  2JI5 A;  3D40 A;  2BRX A;  2JJ4 A;  4Q1T A;  2J0X A;  2BNE A;  4JZ8 A;  1OH9 A;  1Z9D A;  4NDR B;  3C20 A;  4NDO A;  1OHA A;  4USJ A;  3AB4 A;  4JZ7 A;  4NDQ B;  2OGX B;  2IJ9 A;  3LL5 A;  2BRI A;  3AAW A;  4NDP A;  2J4J A;  2RD5 A;  3WWN A;  3K4Y A;  1B7B A;  4AB7 A;  2W21 A;  2AKO A;  2JJX A;  3LKK A;  4F6T B;  3S6H A;  1E19 A;  1YBD A;  3K52 A;  3EK5 A;  4NDR A;  3L86 A;  3QUO A;  3QVF A;  4A7W A;  1GS5 A;  3KZF A;  4NDQ A;  2OGX A;  3L76 A;  2BTY A;  2J0W A;  3ZZH A;  3D41 A; 
#chains in the Genus database with same CATH topology
 3LL9 A;  4OLC A;  3QUR A;  3ZZF A;  2V4Y A;  4F6T A;  3EK6 A;  2CDQ A;  3B8G A;  2J4K A;  2BNF A;  2J5T A;  3QUN A;  2E9Y A;  2J5V A;  1GSJ A;  3K56 A;  2BND A;  4I49 A;  3ZZI A;  3S6K A;  2WE5 A;  1OHB A;  2J4L A;  2BMU A;  4KZT A;  2V5H A;  3NWY A;  3TVI A;  4A7X A;  4AXS A;  2WE4 A;  2R98 A;  3QVH A;  3C1M A;  3C1N A;  3D2M A;  2X2W A;  4NDO B;  3S6G A;  2R8V A;  2HMF A;  2AP9 A;  3T7B A;  4JZ9 A;  3D2P A;  3AB2 A;  2BUF A;  3ZZG A;  4NDP B;  3U6U A;  2WXB A;  3K4O A;  2VA1 A;  3WWM A;  2A1F A;  2JI5 A;  3D40 A;  2BRX A;  2JJ4 A;  4Q1T A;  2J0X A;  2BNE A;  4JZ8 A;  1OH9 A;  1Z9D A;  4NDR B;  3C20 A;  4NDO A;  1OHA A;  4USJ A;  3AB4 A;  4JZ7 A;  4NDQ B;  2OGX B;  2IJ9 A;  3LL5 A;  2BRI A;  3AAW A;  4NDP A;  2J4J A;  2RD5 A;  3WWN A;  3K4Y A;  1B7B A;  4AB7 A;  2W21 A;  2AKO A;  2JJX A;  3LKK A;  4F6T B;  3S6H A;  1E19 A;  1YBD A;  3K52 A;  3EK5 A;  4NDR A;  3L86 A;  3QUO A;  3QVF A;  4A7W A;  1GS5 A;  3KZF A;  4NDQ A;  2OGX A;  3L76 A;  2BTY A;  2J0W A;  3ZZH A;  3D41 A; 
#chains in the Genus database with same CATH homology
 3LL9 A;  4OLC A;  3QUR A;  3ZZF A;  2V4Y A;  4F6T A;  3EK6 A;  2CDQ A;  3B8G A;  2J4K A;  2BNF A;  2J5T A;  3QUN A;  2E9Y A;  2J5V A;  1GSJ A;  3K56 A;  2BND A;  4I49 A;  3ZZI A;  3S6K A;  2WE5 A;  1OHB A;  2J4L A;  2BMU A;  4KZT A;  2V5H A;  3NWY A;  3TVI A;  4A7X A;  4AXS A;  2WE4 A;  2R98 A;  3QVH A;  3C1M A;  3C1N A;  3D2M A;  2X2W A;  4NDO B;  3S6G A;  2R8V A;  2HMF A;  2AP9 A;  3T7B A;  4JZ9 A;  3D2P A;  3AB2 A;  2BUF A;  3ZZG A;  4NDP B;  3U6U A;  2WXB A;  3K4O A;  2VA1 A;  3WWM A;  2A1F A;  2JI5 A;  3D40 A;  2BRX A;  2JJ4 A;  4Q1T A;  2J0X A;  2BNE A;  4JZ8 A;  1OH9 A;  1Z9D A;  4NDR B;  3C20 A;  4NDO A;  1OHA A;  4USJ A;  3AB4 A;  4JZ7 A;  4NDQ B;  2OGX B;  2IJ9 A;  3LL5 A;  2BRI A;  3AAW A;  4NDP A;  2J4J A;  2RD5 A;  3WWN A;  3K4Y A;  1B7B A;  4AB7 A;  2W21 A;  2AKO A;  2JJX A;  3LKK A;  4F6T B;  3S6H A;  1E19 A;  1YBD A;  3K52 A;  3EK5 A;  4NDR A;  3L86 A;  3QUO A;  3QVF A;  4A7W A;  1GS5 A;  3KZF A;  4NDQ A;  2OGX A;  3L76 A;  2BTY A;  2J0W A;  3ZZH A;  3D41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...