4NDQB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
b'NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndqB00
4NDQB 2JJ4A 2AP9A 3B8GA 4JZ9A 3AAWA 2OGXA 3NWYA 1YBDA 2J5VA 3LL9A 3S6GA 4USJA 2WXBA 2WE5A 3C1NA 1B7BA 4JZ7A 3ZZFA 2J4JA 3QURA 3QVFA 2OGXB 4AXSA 1GSJA 2A1FA 3AB4A 3LL5A 2BNEA 3K4YA 3L76A 4NDOA 2HMFA 2RD5A 4KZTA 3WWNA 1OH9A 3ZZIA 2J4LA 3S6HA 2AKOA 3WWMA 2CDQA 2BRXA 2J4KA 4Q1TA 1Z9DA 3AB2A 3C1MA 2JJXA 3TVIA 2BRIA 3EK5A 3ZZHA 2WE4A 4I49A 4NDOB 3S6KA 1E19A 3K56A 2X2WA 2BTYA 2BNFA 1OHBA 3QUNA 4F6TA 2R8VA 2J5TA 3L86A 2V5HA 3U6UA 4NDRA 2W21A 3D40A 4OLCA 4NDPA 2J0WA 2BUFA 2R98A 2BMUA 4NDQA 2IJ9A 4JZ8A 2J0XA 2V4YA 3T7BA 1GS5A 3D41A 3QUOA 3D2MA 2VA1A 3LKKA 3K4OA 2E9YA 3D2PA 3QVHA 4F6TB 4AB7A 4A7WA 1OHAA 3ZZGA 3K52A 3C20A 4NDRB 2BNDA 3KZFA 3EK6A 4NDPB 2JI5A 4A7XA
chains in the Genus database with same CATH superfamily
4NDQB 2JJ4A 2AP9A 3B8GA 4JZ9A 3AAWA 2OGXA 3NWYA 1YBDA 2J5VA 3LL9A 3S6GA 4USJA 2WXBA 2WE5A 3C1NA 1B7BA 4JZ7A 3ZZFA 2J4JA 3QURA 3QVFA 2OGXB 4AXSA 1GSJA 2A1FA 3AB4A 3LL5A 2BNEA 3K4YA 3L76A 4NDOA 2HMFA 2RD5A 4KZTA 3WWNA 1OH9A 3ZZIA 2J4LA 3S6HA 2AKOA 3WWMA 2CDQA 2BRXA 2J4KA 4Q1TA 1Z9DA 3AB2A 3C1MA 2JJXA 3TVIA 2BRIA 3EK5A 3ZZHA 2WE4A 4I49A 4NDOB 3S6KA 1E19A 3K56A 2X2WA 2BTYA 2BNFA 1OHBA 3QUNA 4F6TA 2R8VA 2J5TA 3L86A 2V5HA 3U6UA 4NDRA 2W21A 3D40A 4OLCA 4NDPA 2J0WA 2BUFA 2R98A 2BMUA 4NDQA 2IJ9A 4JZ8A 2J0XA 2V4YA 3T7BA 1GS5A 3D41A 3QUOA 3D2MA 2VA1A 3LKKA 3K4OA 2E9YA 3D2PA 3QVHA 4F6TB 4AB7A 4A7WA 1OHAA 3ZZGA 3K52A 3C20A 4NDRB 2BNDA 3KZFA 3EK6A 4NDPB 2JI5A 4A7XA
chains in the Genus database with same CATH topology
4NDQB 2JJ4A 2AP9A 3B8GA 4JZ9A 3AAWA 2OGXA 3NWYA 1YBDA 2J5VA 3LL9A 3S6GA 4USJA 2WXBA 2WE5A 3C1NA 1B7BA 4JZ7A 3ZZFA 2J4JA 3QURA 3QVFA 2OGXB 4AXSA 1GSJA 2A1FA 3AB4A 3LL5A 2BNEA 3K4YA 3L76A 4NDOA 2HMFA 2RD5A 4KZTA 3WWNA 1OH9A 3ZZIA 2J4LA 3S6HA 2AKOA 3WWMA 2CDQA 2BRXA 2J4KA 4Q1TA 1Z9DA 3AB2A 3C1MA 2JJXA 3TVIA 2BRIA 3EK5A 3ZZHA 2WE4A 4I49A 4NDOB 3S6KA 1E19A 3K56A 2X2WA 2BTYA 2BNFA 1OHBA 3QUNA 4F6TA 2R8VA 2J5TA 3L86A 2V5HA 3U6UA 4NDRA 2W21A 3D40A 4OLCA 4NDPA 2J0WA 2BUFA 2R98A 2BMUA 4NDQA 2IJ9A 4JZ8A 2J0XA 2V4YA 3T7BA 1GS5A 3D41A 3QUOA 3D2MA 2VA1A 3LKKA 3K4OA 2E9YA 3D2PA 3QVHA 4F6TB 4AB7A 4A7WA 1OHAA 3ZZGA 3K52A 3C20A 4NDRB 2BNDA 3KZFA 3EK6A 4NDPB 2JI5A 4A7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDQ B;  2JJ4 A;  2AP9 A;  3B8G A;  4JZ9 A;  3AAW A;  2OGX A;  3NWY A;  1YBD A;  2J5V A;  3LL9 A;  3S6G A;  4USJ A;  2WXB A;  2WE5 A;  3C1N A;  1B7B A;  4JZ7 A;  3ZZF A;  2J4J A;  3QUR A;  3QVF A;  2OGX B;  4AXS A;  1GSJ A;  2A1F A;  3AB4 A;  3LL5 A;  2BNE A;  3K4Y A;  3L76 A;  4NDO A;  2HMF A;  2RD5 A;  4KZT A;  3WWN A;  1OH9 A;  3ZZI A;  2J4L A;  3S6H A;  2AKO A;  3WWM A;  2CDQ A;  2BRX A;  2J4K A;  4Q1T A;  1Z9D A;  3AB2 A;  3C1M A;  2JJX A;  3TVI A;  2BRI A;  3EK5 A;  3ZZH A;  2WE4 A;  4I49 A;  4NDO B;  3S6K A;  1E19 A;  3K56 A;  2X2W A;  2BTY A;  2BNF A;  1OHB A;  3QUN A;  4F6T A;  2R8V A;  2J5T A;  3L86 A;  2V5H A;  3U6U A;  4NDR A;  2W21 A;  3D40 A;  4OLC A;  4NDP A;  2J0W A;  2BUF A;  2R98 A;  2BMU A;  4NDQ A;  2IJ9 A;  4JZ8 A;  2J0X A;  2V4Y A;  3T7B A;  1GS5 A;  3D41 A;  3QUO A;  3D2M A;  2VA1 A;  3LKK A;  3K4O A;  2E9Y A;  3D2P A;  3QVH A;  4F6T B;  4AB7 A;  4A7W A;  1OHA A;  3ZZG A;  3K52 A;  3C20 A;  4NDR B;  2BND A;  3KZF A;  3EK6 A;  4NDP B;  2JI5 A;  4A7X A; 
#chains in the Genus database with same CATH topology
 4NDQ B;  2JJ4 A;  2AP9 A;  3B8G A;  4JZ9 A;  3AAW A;  2OGX A;  3NWY A;  1YBD A;  2J5V A;  3LL9 A;  3S6G A;  4USJ A;  2WXB A;  2WE5 A;  3C1N A;  1B7B A;  4JZ7 A;  3ZZF A;  2J4J A;  3QUR A;  3QVF A;  2OGX B;  4AXS A;  1GSJ A;  2A1F A;  3AB4 A;  3LL5 A;  2BNE A;  3K4Y A;  3L76 A;  4NDO A;  2HMF A;  2RD5 A;  4KZT A;  3WWN A;  1OH9 A;  3ZZI A;  2J4L A;  3S6H A;  2AKO A;  3WWM A;  2CDQ A;  2BRX A;  2J4K A;  4Q1T A;  1Z9D A;  3AB2 A;  3C1M A;  2JJX A;  3TVI A;  2BRI A;  3EK5 A;  3ZZH A;  2WE4 A;  4I49 A;  4NDO B;  3S6K A;  1E19 A;  3K56 A;  2X2W A;  2BTY A;  2BNF A;  1OHB A;  3QUN A;  4F6T A;  2R8V A;  2J5T A;  3L86 A;  2V5H A;  3U6U A;  4NDR A;  2W21 A;  3D40 A;  4OLC A;  4NDP A;  2J0W A;  2BUF A;  2R98 A;  2BMU A;  4NDQ A;  2IJ9 A;  4JZ8 A;  2J0X A;  2V4Y A;  3T7B A;  1GS5 A;  3D41 A;  3QUO A;  3D2M A;  2VA1 A;  3LKK A;  3K4O A;  2E9Y A;  3D2P A;  3QVH A;  4F6T B;  4AB7 A;  4A7W A;  1OHA A;  3ZZG A;  3K52 A;  3C20 A;  4NDR B;  2BND A;  3KZF A;  3EK6 A;  4NDP B;  2JI5 A;  4A7X A; 
#chains in the Genus database with same CATH homology
 4NDQ B;  2JJ4 A;  2AP9 A;  3B8G A;  4JZ9 A;  3AAW A;  2OGX A;  3NWY A;  1YBD A;  2J5V A;  3LL9 A;  3S6G A;  4USJ A;  2WXB A;  2WE5 A;  3C1N A;  1B7B A;  4JZ7 A;  3ZZF A;  2J4J A;  3QUR A;  3QVF A;  2OGX B;  4AXS A;  1GSJ A;  2A1F A;  3AB4 A;  3LL5 A;  2BNE A;  3K4Y A;  3L76 A;  4NDO A;  2HMF A;  2RD5 A;  4KZT A;  3WWN A;  1OH9 A;  3ZZI A;  2J4L A;  3S6H A;  2AKO A;  3WWM A;  2CDQ A;  2BRX A;  2J4K A;  4Q1T A;  1Z9D A;  3AB2 A;  3C1M A;  2JJX A;  3TVI A;  2BRI A;  3EK5 A;  3ZZH A;  2WE4 A;  4I49 A;  4NDO B;  3S6K A;  1E19 A;  3K56 A;  2X2W A;  2BTY A;  2BNF A;  1OHB A;  3QUN A;  4F6T A;  2R8V A;  2J5T A;  3L86 A;  2V5H A;  3U6U A;  4NDR A;  2W21 A;  3D40 A;  4OLC A;  4NDP A;  2J0W A;  2BUF A;  2R98 A;  2BMU A;  4NDQ A;  2IJ9 A;  4JZ8 A;  2J0X A;  2V4Y A;  3T7B A;  1GS5 A;  3D41 A;  3QUO A;  3D2M A;  2VA1 A;  3LKK A;  3K4O A;  2E9Y A;  3D2P A;  3QVH A;  4F6T B;  4AB7 A;  4A7W A;  1OHA A;  3ZZG A;  3K52 A;  3C20 A;  4NDR B;  2BND A;  3KZF A;  3EK6 A;  4NDP B;  2JI5 A;  4A7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...