4NDQB

Crystal structure molybdenum storage protein with fully mo-loaded cavity
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of polyoxomolybdate clusters along the three-fold axis of the molybdenum storage protein.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
total genus 92
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2013-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4ndqB00
3TVIA 2OGXA 1OHAA 2BMUA 2RD5A 3B8GA 3QUNA 4OLCA 3AAWA 2BRIA 3C20A 3L76A 4F6TA 4NDQB 4NDPB 2R98A 3D2MA 4KZTA 2X2WA 3L86A 3QVFA 3U6UA 4A7XA 2CDQA 3EK5A 4AXSA 4NDQA 2V5HA 4F6TB 4JZ8A 2WXBA 2A1FA 3S6HA 1OHBA 3ZZGA 2J0WA 3K4YA 2BTYA 1Z9DA 1OH9A 2R8VA 3D41A 2OGXB 2J5TA 3AB2A 2VA1A 3C1MA 2J4LA 4NDRB 1B7BA 3WWMA 2J5VA 3AB4A 4NDRA 3T7BA 2BRXA 4NDOB 4I49A 2W21A 1GS5A 3S6KA 3WWNA 2BUFA 3K56A 4Q1TA 4USJA 3QVHA 3K4OA 4NDOA 2J4KA 1E19A 2WE4A 3KZFA 3LKKA 3ZZFA 3LL5A 2J0XA 4A7WA 4AB7A 2BNDA 2AKOA 2AP9A 3C1NA 2HMFA 1GSJA 3ZZHA 4NDPA 3D40A 3LL9A 2V4YA 3QURA 2BNFA 2E9YA 3QUOA 3NWYA 3D2PA 3K52A 3ZZIA 2J4JA 3EK6A 3S6GA 2BNEA 2JJXA 4JZ9A 4JZ7A 2IJ9A 2JJ4A 2JI5A 1YBDA 2WE5A
chains in the Genus database with same CATH superfamily
3TVIA 2OGXA 1OHAA 2BMUA 2RD5A 3B8GA 3QUNA 4OLCA 3AAWA 2BRIA 3C20A 3L76A 4F6TA 4NDQB 4NDPB 2R98A 3D2MA 4KZTA 2X2WA 3L86A 3QVFA 3U6UA 4A7XA 2CDQA 3EK5A 4AXSA 4NDQA 2V5HA 4F6TB 4JZ8A 2WXBA 2A1FA 3S6HA 1OHBA 3ZZGA 2J0WA 3K4YA 2BTYA 1Z9DA 1OH9A 2R8VA 3D41A 2OGXB 2J5TA 3AB2A 2VA1A 3C1MA 2J4LA 4NDRB 1B7BA 3WWMA 2J5VA 3AB4A 4NDRA 3T7BA 2BRXA 4NDOB 4I49A 2W21A 1GS5A 3S6KA 3WWNA 2BUFA 3K56A 4Q1TA 4USJA 3QVHA 3K4OA 4NDOA 2J4KA 1E19A 2WE4A 3KZFA 3LKKA 3ZZFA 3LL5A 2J0XA 4A7WA 4AB7A 2BNDA 2AKOA 2AP9A 3C1NA 2HMFA 1GSJA 3ZZHA 4NDPA 3D40A 3LL9A 2V4YA 3QURA 2BNFA 2E9YA 3QUOA 3NWYA 3D2PA 3K52A 3ZZIA 2J4JA 3EK6A 3S6GA 2BNEA 2JJXA 4JZ9A 4JZ7A 2IJ9A 2JJ4A 2JI5A 1YBDA 2WE5A
chains in the Genus database with same CATH topology
3TVIA 2OGXA 1OHAA 2BMUA 2RD5A 3B8GA 3QUNA 4OLCA 3AAWA 2BRIA 3C20A 3L76A 4F6TA 4NDQB 4NDPB 2R98A 3D2MA 4KZTA 2X2WA 3L86A 3QVFA 3U6UA 4A7XA 2CDQA 3EK5A 4AXSA 4NDQA 2V5HA 4F6TB 4JZ8A 2WXBA 2A1FA 3S6HA 1OHBA 3ZZGA 2J0WA 3K4YA 2BTYA 1Z9DA 1OH9A 2R8VA 3D41A 2OGXB 2J5TA 3AB2A 2VA1A 3C1MA 2J4LA 4NDRB 1B7BA 3WWMA 2J5VA 3AB4A 4NDRA 3T7BA 2BRXA 4NDOB 4I49A 2W21A 1GS5A 3S6KA 3WWNA 2BUFA 3K56A 4Q1TA 4USJA 3QVHA 3K4OA 4NDOA 2J4KA 1E19A 2WE4A 3KZFA 3LKKA 3ZZFA 3LL5A 2J0XA 4A7WA 4AB7A 2BNDA 2AKOA 2AP9A 3C1NA 2HMFA 1GSJA 3ZZHA 4NDPA 3D40A 3LL9A 2V4YA 3QURA 2BNFA 2E9YA 3QUOA 3NWYA 3D2PA 3K52A 3ZZIA 2J4JA 3EK6A 3S6GA 2BNEA 2JJXA 4JZ9A 4JZ7A 2IJ9A 2JJ4A 2JI5A 1YBDA 2WE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TVI A;  2OGX A;  1OHA A;  2BMU A;  2RD5 A;  3B8G A;  3QUN A;  4OLC A;  3AAW A;  2BRI A;  3C20 A;  3L76 A;  4F6T A;  4NDQ B;  4NDP B;  2R98 A;  3D2M A;  4KZT A;  2X2W A;  3L86 A;  3QVF A;  3U6U A;  4A7X A;  2CDQ A;  3EK5 A;  4AXS A;  4NDQ A;  2V5H A;  4F6T B;  4JZ8 A;  2WXB A;  2A1F A;  3S6H A;  1OHB A;  3ZZG A;  2J0W A;  3K4Y A;  2BTY A;  1Z9D A;  1OH9 A;  2R8V A;  3D41 A;  2OGX B;  2J5T A;  3AB2 A;  2VA1 A;  3C1M A;  2J4L A;  4NDR B;  1B7B A;  3WWM A;  2J5V A;  3AB4 A;  4NDR A;  3T7B A;  2BRX A;  4NDO B;  4I49 A;  2W21 A;  1GS5 A;  3S6K A;  3WWN A;  2BUF A;  3K56 A;  4Q1T A;  4USJ A;  3QVH A;  3K4O A;  4NDO A;  2J4K A;  1E19 A;  2WE4 A;  3KZF A;  3LKK A;  3ZZF A;  3LL5 A;  2J0X A;  4A7W A;  4AB7 A;  2BND A;  2AKO A;  2AP9 A;  3C1N A;  2HMF A;  1GSJ A;  3ZZH A;  4NDP A;  3D40 A;  3LL9 A;  2V4Y A;  3QUR A;  2BNF A;  2E9Y A;  3QUO A;  3NWY A;  3D2P A;  3K52 A;  3ZZI A;  2J4J A;  3EK6 A;  3S6G A;  2BNE A;  2JJX A;  4JZ9 A;  4JZ7 A;  2IJ9 A;  2JJ4 A;  2JI5 A;  1YBD A;  2WE5 A; 
#chains in the Genus database with same CATH topology
 3TVI A;  2OGX A;  1OHA A;  2BMU A;  2RD5 A;  3B8G A;  3QUN A;  4OLC A;  3AAW A;  2BRI A;  3C20 A;  3L76 A;  4F6T A;  4NDQ B;  4NDP B;  2R98 A;  3D2M A;  4KZT A;  2X2W A;  3L86 A;  3QVF A;  3U6U A;  4A7X A;  2CDQ A;  3EK5 A;  4AXS A;  4NDQ A;  2V5H A;  4F6T B;  4JZ8 A;  2WXB A;  2A1F A;  3S6H A;  1OHB A;  3ZZG A;  2J0W A;  3K4Y A;  2BTY A;  1Z9D A;  1OH9 A;  2R8V A;  3D41 A;  2OGX B;  2J5T A;  3AB2 A;  2VA1 A;  3C1M A;  2J4L A;  4NDR B;  1B7B A;  3WWM A;  2J5V A;  3AB4 A;  4NDR A;  3T7B A;  2BRX A;  4NDO B;  4I49 A;  2W21 A;  1GS5 A;  3S6K A;  3WWN A;  2BUF A;  3K56 A;  4Q1T A;  4USJ A;  3QVH A;  3K4O A;  4NDO A;  2J4K A;  1E19 A;  2WE4 A;  3KZF A;  3LKK A;  3ZZF A;  3LL5 A;  2J0X A;  4A7W A;  4AB7 A;  2BND A;  2AKO A;  2AP9 A;  3C1N A;  2HMF A;  1GSJ A;  3ZZH A;  4NDP A;  3D40 A;  3LL9 A;  2V4Y A;  3QUR A;  2BNF A;  2E9Y A;  3QUO A;  3NWY A;  3D2P A;  3K52 A;  3ZZI A;  2J4J A;  3EK6 A;  3S6G A;  2BNE A;  2JJX A;  4JZ9 A;  4JZ7 A;  2IJ9 A;  2JJ4 A;  2JI5 A;  1YBD A;  2WE5 A; 
#chains in the Genus database with same CATH homology
 3TVI A;  2OGX A;  1OHA A;  2BMU A;  2RD5 A;  3B8G A;  3QUN A;  4OLC A;  3AAW A;  2BRI A;  3C20 A;  3L76 A;  4F6T A;  4NDQ B;  4NDP B;  2R98 A;  3D2M A;  4KZT A;  2X2W A;  3L86 A;  3QVF A;  3U6U A;  4A7X A;  2CDQ A;  3EK5 A;  4AXS A;  4NDQ A;  2V5H A;  4F6T B;  4JZ8 A;  2WXB A;  2A1F A;  3S6H A;  1OHB A;  3ZZG A;  2J0W A;  3K4Y A;  2BTY A;  1Z9D A;  1OH9 A;  2R8V A;  3D41 A;  2OGX B;  2J5T A;  3AB2 A;  2VA1 A;  3C1M A;  2J4L A;  4NDR B;  1B7B A;  3WWM A;  2J5V A;  3AB4 A;  4NDR A;  3T7B A;  2BRX A;  4NDO B;  4I49 A;  2W21 A;  1GS5 A;  3S6K A;  3WWN A;  2BUF A;  3K56 A;  4Q1T A;  4USJ A;  3QVH A;  3K4O A;  4NDO A;  2J4K A;  1E19 A;  2WE4 A;  3KZF A;  3LKK A;  3ZZF A;  3LL5 A;  2J0X A;  4A7W A;  4AB7 A;  2BND A;  2AKO A;  2AP9 A;  3C1N A;  2HMF A;  1GSJ A;  3ZZH A;  4NDP A;  3D40 A;  3LL9 A;  2V4Y A;  3QUR A;  2BNF A;  2E9Y A;  3QUO A;  3NWY A;  3D2P A;  3K52 A;  3ZZI A;  2J4J A;  3EK6 A;  3S6G A;  2BNE A;  2JJX A;  4JZ9 A;  4JZ7 A;  2IJ9 A;  2JJ4 A;  2JI5 A;  1YBD A;  2WE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...