2OGXB

The crystal structure of the molybdenum storage protein from azotobacter vinelandii loaded with polyoxotungstates (wsto)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards Biological Supramolecular Chemistry: A Variety of Pocket-Templated, Individual Metal Oxide Cluster Nucleations in the Cavity of a Mo/W-Storage Protein.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit alpha
total genus 79
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ogxB00
4Q1TA 2BUFA 3T7BA 3QVFA 2J0XA 4JZ9A 3ZZGA 3LL9A 3C1MA 3WWNA 2BRXA 3NWYA 2WXBA 2X2WA 2BNDA 2BTYA 2OGXA 3S6GA 4OLCA 2J5TA 2VA1A 4AXSA 2A1FA 2WE5A 3QURA 3S6HA 2BMUA 4NDQA 2JJ4A 3D40A 4F6TB 3ZZFA 3EK5A 2V5HA 1GSJA 4NDPB 2JJXA 3L86A 2J4LA 3TVIA 1E19A 2WE4A 3EK6A 1B7BA 2R8VA 1OHBA 2J4KA 4A7WA 1Z9DA 3AB2A 4NDRA 3QUNA 3D2MA 4KZTA 3LL5A 4NDPA 2BNFA 2E9YA 3K56A 3LKKA 2V4YA 4NDOA 2J4JA 4F6TA 3C20A 3ZZIA 2JI5A 3WWMA 4JZ8A 2J5VA 4AB7A 2J0WA 3ZZHA 3K4YA 1GS5A 3D41A 2IJ9A 2OGXB 3QVHA 2W21A 2AKOA 4JZ7A 2AP9A 4NDQB 3KZFA 2BNEA 3QUOA 3S6KA 1OHAA 2R98A 2RD5A 3AAWA 4USJA 1YBDA 3K52A 3K4OA 4I49A 3L76A 2HMFA 3C1NA 2BRIA 4NDRB 3B8GA 3U6UA 2CDQA 4A7XA 3AB4A 1OH9A 4NDOB 3D2PA
chains in the Genus database with same CATH superfamily
4Q1TA 2BUFA 3T7BA 3QVFA 2J0XA 4JZ9A 3ZZGA 3LL9A 3C1MA 3WWNA 2BRXA 3NWYA 2WXBA 2X2WA 2BNDA 2BTYA 2OGXA 3S6GA 4OLCA 2J5TA 2VA1A 4AXSA 2A1FA 2WE5A 3QURA 3S6HA 2BMUA 4NDQA 2JJ4A 3D40A 4F6TB 3ZZFA 3EK5A 2V5HA 1GSJA 4NDPB 2JJXA 3L86A 2J4LA 3TVIA 1E19A 2WE4A 3EK6A 1B7BA 2R8VA 1OHBA 2J4KA 4A7WA 1Z9DA 3AB2A 4NDRA 3QUNA 3D2MA 4KZTA 3LL5A 4NDPA 2BNFA 2E9YA 3K56A 3LKKA 2V4YA 4NDOA 2J4JA 4F6TA 3C20A 3ZZIA 2JI5A 3WWMA 4JZ8A 2J5VA 4AB7A 2J0WA 3ZZHA 3K4YA 1GS5A 3D41A 2IJ9A 2OGXB 3QVHA 2W21A 2AKOA 4JZ7A 2AP9A 4NDQB 3KZFA 2BNEA 3QUOA 3S6KA 1OHAA 2R98A 2RD5A 3AAWA 4USJA 1YBDA 3K52A 3K4OA 4I49A 3L76A 2HMFA 3C1NA 2BRIA 4NDRB 3B8GA 3U6UA 2CDQA 4A7XA 3AB4A 1OH9A 4NDOB 3D2PA
chains in the Genus database with same CATH topology
4Q1TA 2BUFA 3T7BA 3QVFA 2J0XA 4JZ9A 3ZZGA 3LL9A 3C1MA 3WWNA 2BRXA 3NWYA 2WXBA 2X2WA 2BNDA 2BTYA 2OGXA 3S6GA 4OLCA 2J5TA 2VA1A 4AXSA 2A1FA 2WE5A 3QURA 3S6HA 2BMUA 4NDQA 2JJ4A 3D40A 4F6TB 3ZZFA 3EK5A 2V5HA 1GSJA 4NDPB 2JJXA 3L86A 2J4LA 3TVIA 1E19A 2WE4A 3EK6A 1B7BA 2R8VA 1OHBA 2J4KA 4A7WA 1Z9DA 3AB2A 4NDRA 3QUNA 3D2MA 4KZTA 3LL5A 4NDPA 2BNFA 2E9YA 3K56A 3LKKA 2V4YA 4NDOA 2J4JA 4F6TA 3C20A 3ZZIA 2JI5A 3WWMA 4JZ8A 2J5VA 4AB7A 2J0WA 3ZZHA 3K4YA 1GS5A 3D41A 2IJ9A 2OGXB 3QVHA 2W21A 2AKOA 4JZ7A 2AP9A 4NDQB 3KZFA 2BNEA 3QUOA 3S6KA 1OHAA 2R98A 2RD5A 3AAWA 4USJA 1YBDA 3K52A 3K4OA 4I49A 3L76A 2HMFA 3C1NA 2BRIA 4NDRB 3B8GA 3U6UA 2CDQA 4A7XA 3AB4A 1OH9A 4NDOB 3D2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1T A;  2BUF A;  3T7B A;  3QVF A;  2J0X A;  4JZ9 A;  3ZZG A;  3LL9 A;  3C1M A;  3WWN A;  2BRX A;  3NWY A;  2WXB A;  2X2W A;  2BND A;  2BTY A;  2OGX A;  3S6G A;  4OLC A;  2J5T A;  2VA1 A;  4AXS A;  2A1F A;  2WE5 A;  3QUR A;  3S6H A;  2BMU A;  4NDQ A;  2JJ4 A;  3D40 A;  4F6T B;  3ZZF A;  3EK5 A;  2V5H A;  1GSJ A;  4NDP B;  2JJX A;  3L86 A;  2J4L A;  3TVI A;  1E19 A;  2WE4 A;  3EK6 A;  1B7B A;  2R8V A;  1OHB A;  2J4K A;  4A7W A;  1Z9D A;  3AB2 A;  4NDR A;  3QUN A;  3D2M A;  4KZT A;  3LL5 A;  4NDP A;  2BNF A;  2E9Y A;  3K56 A;  3LKK A;  2V4Y A;  4NDO A;  2J4J A;  4F6T A;  3C20 A;  3ZZI A;  2JI5 A;  3WWM A;  4JZ8 A;  2J5V A;  4AB7 A;  2J0W A;  3ZZH A;  3K4Y A;  1GS5 A;  3D41 A;  2IJ9 A;  2OGX B;  3QVH A;  2W21 A;  2AKO A;  4JZ7 A;  2AP9 A;  4NDQ B;  3KZF A;  2BNE A;  3QUO A;  3S6K A;  1OHA A;  2R98 A;  2RD5 A;  3AAW A;  4USJ A;  1YBD A;  3K52 A;  3K4O A;  4I49 A;  3L76 A;  2HMF A;  3C1N A;  2BRI A;  4NDR B;  3B8G A;  3U6U A;  2CDQ A;  4A7X A;  3AB4 A;  1OH9 A;  4NDO B;  3D2P A; 
#chains in the Genus database with same CATH topology
 4Q1T A;  2BUF A;  3T7B A;  3QVF A;  2J0X A;  4JZ9 A;  3ZZG A;  3LL9 A;  3C1M A;  3WWN A;  2BRX A;  3NWY A;  2WXB A;  2X2W A;  2BND A;  2BTY A;  2OGX A;  3S6G A;  4OLC A;  2J5T A;  2VA1 A;  4AXS A;  2A1F A;  2WE5 A;  3QUR A;  3S6H A;  2BMU A;  4NDQ A;  2JJ4 A;  3D40 A;  4F6T B;  3ZZF A;  3EK5 A;  2V5H A;  1GSJ A;  4NDP B;  2JJX A;  3L86 A;  2J4L A;  3TVI A;  1E19 A;  2WE4 A;  3EK6 A;  1B7B A;  2R8V A;  1OHB A;  2J4K A;  4A7W A;  1Z9D A;  3AB2 A;  4NDR A;  3QUN A;  3D2M A;  4KZT A;  3LL5 A;  4NDP A;  2BNF A;  2E9Y A;  3K56 A;  3LKK A;  2V4Y A;  4NDO A;  2J4J A;  4F6T A;  3C20 A;  3ZZI A;  2JI5 A;  3WWM A;  4JZ8 A;  2J5V A;  4AB7 A;  2J0W A;  3ZZH A;  3K4Y A;  1GS5 A;  3D41 A;  2IJ9 A;  2OGX B;  3QVH A;  2W21 A;  2AKO A;  4JZ7 A;  2AP9 A;  4NDQ B;  3KZF A;  2BNE A;  3QUO A;  3S6K A;  1OHA A;  2R98 A;  2RD5 A;  3AAW A;  4USJ A;  1YBD A;  3K52 A;  3K4O A;  4I49 A;  3L76 A;  2HMF A;  3C1N A;  2BRI A;  4NDR B;  3B8G A;  3U6U A;  2CDQ A;  4A7X A;  3AB4 A;  1OH9 A;  4NDO B;  3D2P A; 
#chains in the Genus database with same CATH homology
 4Q1T A;  2BUF A;  3T7B A;  3QVF A;  2J0X A;  4JZ9 A;  3ZZG A;  3LL9 A;  3C1M A;  3WWN A;  2BRX A;  3NWY A;  2WXB A;  2X2W A;  2BND A;  2BTY A;  2OGX A;  3S6G A;  4OLC A;  2J5T A;  2VA1 A;  4AXS A;  2A1F A;  2WE5 A;  3QUR A;  3S6H A;  2BMU A;  4NDQ A;  2JJ4 A;  3D40 A;  4F6T B;  3ZZF A;  3EK5 A;  2V5H A;  1GSJ A;  4NDP B;  2JJX A;  3L86 A;  2J4L A;  3TVI A;  1E19 A;  2WE4 A;  3EK6 A;  1B7B A;  2R8V A;  1OHB A;  2J4K A;  4A7W A;  1Z9D A;  3AB2 A;  4NDR A;  3QUN A;  3D2M A;  4KZT A;  3LL5 A;  4NDP A;  2BNF A;  2E9Y A;  3K56 A;  3LKK A;  2V4Y A;  4NDO A;  2J4J A;  4F6T A;  3C20 A;  3ZZI A;  2JI5 A;  3WWM A;  4JZ8 A;  2J5V A;  4AB7 A;  2J0W A;  3ZZH A;  3K4Y A;  1GS5 A;  3D41 A;  2IJ9 A;  2OGX B;  3QVH A;  2W21 A;  2AKO A;  4JZ7 A;  2AP9 A;  4NDQ B;  3KZF A;  2BNE A;  3QUO A;  3S6K A;  1OHA A;  2R98 A;  2RD5 A;  3AAW A;  4USJ A;  1YBD A;  3K52 A;  3K4O A;  4I49 A;  3L76 A;  2HMF A;  3C1N A;  2BRI A;  4NDR B;  3B8G A;  3U6U A;  2CDQ A;  4A7X A;  3AB4 A;  1OH9 A;  4NDO B;  3D2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...