2OGXB

The crystal structure of the molybdenum storage protein from azotobacter vinelandii loaded with polyoxotungstates (wsto)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards Biological Supramolecular Chemistry: A Variety of Pocket-Templated, Individual Metal Oxide Cluster Nucleations in the Cavity of a Mo/W-Storage Protein.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit alpha
total genus 79
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ogxB00
4F6TA 3QUNA 3D41A 2AP9A 2J4JA 3S6HA 2X2WA 4NDOB 2WE4A 1Z9DA 3L76A 3TVIA 3D2PA 1GS5A 3LL5A 2BNDA 2V5HA 2AKOA 3AAWA 4NDPA 3B8GA 3K4YA 3S6GA 2BNEA 1YBDA 2JJ4A 4NDPB 3C20A 3EK5A 3AB4A 2R98A 4JZ9A 3ZZHA 2JI5A 4USJA 2J0WA 2BRIA 3K52A 3QURA 4Q1TA 2W21A 2V4YA 2WE5A 2HMFA 2R8VA 2J4KA 2J5VA 4NDQA 1OHAA 3NWYA 3U6UA 2BNFA 2A1FA 3AB2A 3QVHA 1B7BA 4KZTA 2BRXA 4NDRB 4A7XA 3C1NA 4JZ8A 2J4LA 2BTYA 4I49A 3QVFA 4AXSA 3LKKA 3KZFA 4NDOA 3L86A 2BUFA 2OGXA 3K4OA 3C1MA 2OGXB 3WWMA 3LL9A 1OH9A 4OLCA 3ZZFA 3EK6A 1E19A 2J5TA 3D40A 4A7WA 4AB7A 3S6KA 2J0XA 3T7BA 2VA1A 2JJXA 3ZZIA 4NDRA 2IJ9A 4JZ7A 2E9YA 1GSJA 3QUOA 2CDQA 2RD5A 1OHBA 3K56A 4NDQB 4F6TB 3ZZGA 2WXBA 3D2MA 3WWNA 2BMUA
chains in the Genus database with same CATH superfamily
4F6TA 3QUNA 3D41A 2AP9A 2J4JA 3S6HA 2X2WA 4NDOB 2WE4A 1Z9DA 3L76A 3TVIA 3D2PA 1GS5A 3LL5A 2BNDA 2V5HA 2AKOA 3AAWA 4NDPA 3B8GA 3K4YA 3S6GA 2BNEA 1YBDA 2JJ4A 4NDPB 3C20A 3EK5A 3AB4A 2R98A 4JZ9A 3ZZHA 2JI5A 4USJA 2J0WA 2BRIA 3K52A 3QURA 4Q1TA 2W21A 2V4YA 2WE5A 2HMFA 2R8VA 2J4KA 2J5VA 4NDQA 1OHAA 3NWYA 3U6UA 2BNFA 2A1FA 3AB2A 3QVHA 1B7BA 4KZTA 2BRXA 4NDRB 4A7XA 3C1NA 4JZ8A 2J4LA 2BTYA 4I49A 3QVFA 4AXSA 3LKKA 3KZFA 4NDOA 3L86A 2BUFA 2OGXA 3K4OA 3C1MA 2OGXB 3WWMA 3LL9A 1OH9A 4OLCA 3ZZFA 3EK6A 1E19A 2J5TA 3D40A 4A7WA 4AB7A 3S6KA 2J0XA 3T7BA 2VA1A 2JJXA 3ZZIA 4NDRA 2IJ9A 4JZ7A 2E9YA 1GSJA 3QUOA 2CDQA 2RD5A 1OHBA 3K56A 4NDQB 4F6TB 3ZZGA 2WXBA 3D2MA 3WWNA 2BMUA
chains in the Genus database with same CATH topology
4F6TA 3QUNA 3D41A 2AP9A 2J4JA 3S6HA 2X2WA 4NDOB 2WE4A 1Z9DA 3L76A 3TVIA 3D2PA 1GS5A 3LL5A 2BNDA 2V5HA 2AKOA 3AAWA 4NDPA 3B8GA 3K4YA 3S6GA 2BNEA 1YBDA 2JJ4A 4NDPB 3C20A 3EK5A 3AB4A 2R98A 4JZ9A 3ZZHA 2JI5A 4USJA 2J0WA 2BRIA 3K52A 3QURA 4Q1TA 2W21A 2V4YA 2WE5A 2HMFA 2R8VA 2J4KA 2J5VA 4NDQA 1OHAA 3NWYA 3U6UA 2BNFA 2A1FA 3AB2A 3QVHA 1B7BA 4KZTA 2BRXA 4NDRB 4A7XA 3C1NA 4JZ8A 2J4LA 2BTYA 4I49A 3QVFA 4AXSA 3LKKA 3KZFA 4NDOA 3L86A 2BUFA 2OGXA 3K4OA 3C1MA 2OGXB 3WWMA 3LL9A 1OH9A 4OLCA 3ZZFA 3EK6A 1E19A 2J5TA 3D40A 4A7WA 4AB7A 3S6KA 2J0XA 3T7BA 2VA1A 2JJXA 3ZZIA 4NDRA 2IJ9A 4JZ7A 2E9YA 1GSJA 3QUOA 2CDQA 2RD5A 1OHBA 3K56A 4NDQB 4F6TB 3ZZGA 2WXBA 3D2MA 3WWNA 2BMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6T A;  3QUN A;  3D41 A;  2AP9 A;  2J4J A;  3S6H A;  2X2W A;  4NDO B;  2WE4 A;  1Z9D A;  3L76 A;  3TVI A;  3D2P A;  1GS5 A;  3LL5 A;  2BND A;  2V5H A;  2AKO A;  3AAW A;  4NDP A;  3B8G A;  3K4Y A;  3S6G A;  2BNE A;  1YBD A;  2JJ4 A;  4NDP B;  3C20 A;  3EK5 A;  3AB4 A;  2R98 A;  4JZ9 A;  3ZZH A;  2JI5 A;  4USJ A;  2J0W A;  2BRI A;  3K52 A;  3QUR A;  4Q1T A;  2W21 A;  2V4Y A;  2WE5 A;  2HMF A;  2R8V A;  2J4K A;  2J5V A;  4NDQ A;  1OHA A;  3NWY A;  3U6U A;  2BNF A;  2A1F A;  3AB2 A;  3QVH A;  1B7B A;  4KZT A;  2BRX A;  4NDR B;  4A7X A;  3C1N A;  4JZ8 A;  2J4L A;  2BTY A;  4I49 A;  3QVF A;  4AXS A;  3LKK A;  3KZF A;  4NDO A;  3L86 A;  2BUF A;  2OGX A;  3K4O A;  3C1M A;  2OGX B;  3WWM A;  3LL9 A;  1OH9 A;  4OLC A;  3ZZF A;  3EK6 A;  1E19 A;  2J5T A;  3D40 A;  4A7W A;  4AB7 A;  3S6K A;  2J0X A;  3T7B A;  2VA1 A;  2JJX A;  3ZZI A;  4NDR A;  2IJ9 A;  4JZ7 A;  2E9Y A;  1GSJ A;  3QUO A;  2CDQ A;  2RD5 A;  1OHB A;  3K56 A;  4NDQ B;  4F6T B;  3ZZG A;  2WXB A;  3D2M A;  3WWN A;  2BMU A; 
#chains in the Genus database with same CATH topology
 4F6T A;  3QUN A;  3D41 A;  2AP9 A;  2J4J A;  3S6H A;  2X2W A;  4NDO B;  2WE4 A;  1Z9D A;  3L76 A;  3TVI A;  3D2P A;  1GS5 A;  3LL5 A;  2BND A;  2V5H A;  2AKO A;  3AAW A;  4NDP A;  3B8G A;  3K4Y A;  3S6G A;  2BNE A;  1YBD A;  2JJ4 A;  4NDP B;  3C20 A;  3EK5 A;  3AB4 A;  2R98 A;  4JZ9 A;  3ZZH A;  2JI5 A;  4USJ A;  2J0W A;  2BRI A;  3K52 A;  3QUR A;  4Q1T A;  2W21 A;  2V4Y A;  2WE5 A;  2HMF A;  2R8V A;  2J4K A;  2J5V A;  4NDQ A;  1OHA A;  3NWY A;  3U6U A;  2BNF A;  2A1F A;  3AB2 A;  3QVH A;  1B7B A;  4KZT A;  2BRX A;  4NDR B;  4A7X A;  3C1N A;  4JZ8 A;  2J4L A;  2BTY A;  4I49 A;  3QVF A;  4AXS A;  3LKK A;  3KZF A;  4NDO A;  3L86 A;  2BUF A;  2OGX A;  3K4O A;  3C1M A;  2OGX B;  3WWM A;  3LL9 A;  1OH9 A;  4OLC A;  3ZZF A;  3EK6 A;  1E19 A;  2J5T A;  3D40 A;  4A7W A;  4AB7 A;  3S6K A;  2J0X A;  3T7B A;  2VA1 A;  2JJX A;  3ZZI A;  4NDR A;  2IJ9 A;  4JZ7 A;  2E9Y A;  1GSJ A;  3QUO A;  2CDQ A;  2RD5 A;  1OHB A;  3K56 A;  4NDQ B;  4F6T B;  3ZZG A;  2WXB A;  3D2M A;  3WWN A;  2BMU A; 
#chains in the Genus database with same CATH homology
 4F6T A;  3QUN A;  3D41 A;  2AP9 A;  2J4J A;  3S6H A;  2X2W A;  4NDO B;  2WE4 A;  1Z9D A;  3L76 A;  3TVI A;  3D2P A;  1GS5 A;  3LL5 A;  2BND A;  2V5H A;  2AKO A;  3AAW A;  4NDP A;  3B8G A;  3K4Y A;  3S6G A;  2BNE A;  1YBD A;  2JJ4 A;  4NDP B;  3C20 A;  3EK5 A;  3AB4 A;  2R98 A;  4JZ9 A;  3ZZH A;  2JI5 A;  4USJ A;  2J0W A;  2BRI A;  3K52 A;  3QUR A;  4Q1T A;  2W21 A;  2V4Y A;  2WE5 A;  2HMF A;  2R8V A;  2J4K A;  2J5V A;  4NDQ A;  1OHA A;  3NWY A;  3U6U A;  2BNF A;  2A1F A;  3AB2 A;  3QVH A;  1B7B A;  4KZT A;  2BRX A;  4NDR B;  4A7X A;  3C1N A;  4JZ8 A;  2J4L A;  2BTY A;  4I49 A;  3QVF A;  4AXS A;  3LKK A;  3KZF A;  4NDO A;  3L86 A;  2BUF A;  2OGX A;  3K4O A;  3C1M A;  2OGX B;  3WWM A;  3LL9 A;  1OH9 A;  4OLC A;  3ZZF A;  3EK6 A;  1E19 A;  2J5T A;  3D40 A;  4A7W A;  4AB7 A;  3S6K A;  2J0X A;  3T7B A;  2VA1 A;  2JJX A;  3ZZI A;  4NDR A;  2IJ9 A;  4JZ7 A;  2E9Y A;  1GSJ A;  3QUO A;  2CDQ A;  2RD5 A;  1OHB A;  3K56 A;  4NDQ B;  4F6T B;  3ZZG A;  2WXB A;  3D2M A;  3WWN A;  2BMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...