2OGXB

The crystal structure of the molybdenum storage protein from azotobacter vinelandii loaded with polyoxotungstates (wsto)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit alpha
publication title Towards Biological Supramolecular Chemistry: A Variety of Pocket-Templated, Individual Metal Oxide Cluster Nucleations in the Cavity of a Mo/W-Storage Protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 79
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ogxB00
1Z9DA 2VA1A 2AP9A 2WXBA 1GS5A 2BNEA 3C1MA 2JJ4A 1OH9A 3ZZHA 3QVFA 3C1NA 3QURA 3D2PA 3WWNA 2W21A 1YBDA 3S6KA 2RD5A 3WWMA 4NDQB 3LKKA 1E19A 3B8GA 2BTYA 2OGXB 4NDPA 2WE4A 2J5VA 3EK6A 4AB7A 3K4OA 2R98A 2BRXA 4JZ9A 1OHBA 3QUNA 2WE5A 2J0WA 2BUFA 3LL9A 2E9YA 3QVHA 2HMFA 2J5TA 4KZTA 2J0XA 4NDQA 2JI5A 3T7BA 3LL5A 2OGXA 3KZFA 3AAWA 4JZ7A 3QUOA 4F6TA 3K4YA 4F6TB 3D41A 2R8VA 1B7BA 4USJA 2X2WA 4A7WA 3ZZIA 4Q1TA 3D2MA 2J4KA 2BMUA 4OLCA 3ZZFA 3U6UA 3L76A 3C20A 4JZ8A 4NDOA 4A7XA 2BRIA 4NDOB 3EK5A 1OHAA 2AKOA 2JJXA 2A1FA 3L86A 2J4JA 2BNFA 3S6HA 3S6GA 3K56A 3AB4A 1GSJA 2BNDA 2J4LA 3TVIA 4NDRA 4NDRB 2V5HA 3K52A 3AB2A 4I49A 3NWYA 4NDPB 2CDQA 2V4YA 3D40A 2IJ9A 4AXSA 3ZZGA
chains in the Genus database with same CATH superfamily
1Z9DA 2VA1A 2AP9A 2WXBA 1GS5A 2BNEA 3C1MA 2JJ4A 1OH9A 3ZZHA 3QVFA 3C1NA 3QURA 3D2PA 3WWNA 2W21A 1YBDA 3S6KA 2RD5A 3WWMA 4NDQB 3LKKA 1E19A 3B8GA 2BTYA 2OGXB 4NDPA 2WE4A 2J5VA 3EK6A 4AB7A 3K4OA 2R98A 2BRXA 4JZ9A 1OHBA 3QUNA 2WE5A 2J0WA 2BUFA 3LL9A 2E9YA 3QVHA 2HMFA 2J5TA 4KZTA 2J0XA 4NDQA 2JI5A 3T7BA 3LL5A 2OGXA 3KZFA 3AAWA 4JZ7A 3QUOA 4F6TA 3K4YA 4F6TB 3D41A 2R8VA 1B7BA 4USJA 2X2WA 4A7WA 3ZZIA 4Q1TA 3D2MA 2J4KA 2BMUA 4OLCA 3ZZFA 3U6UA 3L76A 3C20A 4JZ8A 4NDOA 4A7XA 2BRIA 4NDOB 3EK5A 1OHAA 2AKOA 2JJXA 2A1FA 3L86A 2J4JA 2BNFA 3S6HA 3S6GA 3K56A 3AB4A 1GSJA 2BNDA 2J4LA 3TVIA 4NDRA 4NDRB 2V5HA 3K52A 3AB2A 4I49A 3NWYA 4NDPB 2CDQA 2V4YA 3D40A 2IJ9A 4AXSA 3ZZGA
chains in the Genus database with same CATH topology
1Z9DA 2VA1A 2AP9A 2WXBA 1GS5A 2BNEA 3C1MA 2JJ4A 1OH9A 3ZZHA 3QVFA 3C1NA 3QURA 3D2PA 3WWNA 2W21A 1YBDA 3S6KA 2RD5A 3WWMA 4NDQB 3LKKA 1E19A 3B8GA 2BTYA 2OGXB 4NDPA 2WE4A 2J5VA 3EK6A 4AB7A 3K4OA 2R98A 2BRXA 4JZ9A 1OHBA 3QUNA 2WE5A 2J0WA 2BUFA 3LL9A 2E9YA 3QVHA 2HMFA 2J5TA 4KZTA 2J0XA 4NDQA 2JI5A 3T7BA 3LL5A 2OGXA 3KZFA 3AAWA 4JZ7A 3QUOA 4F6TA 3K4YA 4F6TB 3D41A 2R8VA 1B7BA 4USJA 2X2WA 4A7WA 3ZZIA 4Q1TA 3D2MA 2J4KA 2BMUA 4OLCA 3ZZFA 3U6UA 3L76A 3C20A 4JZ8A 4NDOA 4A7XA 2BRIA 4NDOB 3EK5A 1OHAA 2AKOA 2JJXA 2A1FA 3L86A 2J4JA 2BNFA 3S6HA 3S6GA 3K56A 3AB4A 1GSJA 2BNDA 2J4LA 3TVIA 4NDRA 4NDRB 2V5HA 3K52A 3AB2A 4I49A 3NWYA 4NDPB 2CDQA 2V4YA 3D40A 2IJ9A 4AXSA 3ZZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9D A;  2VA1 A;  2AP9 A;  2WXB A;  1GS5 A;  2BNE A;  3C1M A;  2JJ4 A;  1OH9 A;  3ZZH A;  3QVF A;  3C1N A;  3QUR A;  3D2P A;  3WWN A;  2W21 A;  1YBD A;  3S6K A;  2RD5 A;  3WWM A;  4NDQ B;  3LKK A;  1E19 A;  3B8G A;  2BTY A;  2OGX B;  4NDP A;  2WE4 A;  2J5V A;  3EK6 A;  4AB7 A;  3K4O A;  2R98 A;  2BRX A;  4JZ9 A;  1OHB A;  3QUN A;  2WE5 A;  2J0W A;  2BUF A;  3LL9 A;  2E9Y A;  3QVH A;  2HMF A;  2J5T A;  4KZT A;  2J0X A;  4NDQ A;  2JI5 A;  3T7B A;  3LL5 A;  2OGX A;  3KZF A;  3AAW A;  4JZ7 A;  3QUO A;  4F6T A;  3K4Y A;  4F6T B;  3D41 A;  2R8V A;  1B7B A;  4USJ A;  2X2W A;  4A7W A;  3ZZI A;  4Q1T A;  3D2M A;  2J4K A;  2BMU A;  4OLC A;  3ZZF A;  3U6U A;  3L76 A;  3C20 A;  4JZ8 A;  4NDO A;  4A7X A;  2BRI A;  4NDO B;  3EK5 A;  1OHA A;  2AKO A;  2JJX A;  2A1F A;  3L86 A;  2J4J A;  2BNF A;  3S6H A;  3S6G A;  3K56 A;  3AB4 A;  1GSJ A;  2BND A;  2J4L A;  3TVI A;  4NDR A;  4NDR B;  2V5H A;  3K52 A;  3AB2 A;  4I49 A;  3NWY A;  4NDP B;  2CDQ A;  2V4Y A;  3D40 A;  2IJ9 A;  4AXS A;  3ZZG A; 
#chains in the Genus database with same CATH topology
 1Z9D A;  2VA1 A;  2AP9 A;  2WXB A;  1GS5 A;  2BNE A;  3C1M A;  2JJ4 A;  1OH9 A;  3ZZH A;  3QVF A;  3C1N A;  3QUR A;  3D2P A;  3WWN A;  2W21 A;  1YBD A;  3S6K A;  2RD5 A;  3WWM A;  4NDQ B;  3LKK A;  1E19 A;  3B8G A;  2BTY A;  2OGX B;  4NDP A;  2WE4 A;  2J5V A;  3EK6 A;  4AB7 A;  3K4O A;  2R98 A;  2BRX A;  4JZ9 A;  1OHB A;  3QUN A;  2WE5 A;  2J0W A;  2BUF A;  3LL9 A;  2E9Y A;  3QVH A;  2HMF A;  2J5T A;  4KZT A;  2J0X A;  4NDQ A;  2JI5 A;  3T7B A;  3LL5 A;  2OGX A;  3KZF A;  3AAW A;  4JZ7 A;  3QUO A;  4F6T A;  3K4Y A;  4F6T B;  3D41 A;  2R8V A;  1B7B A;  4USJ A;  2X2W A;  4A7W A;  3ZZI A;  4Q1T A;  3D2M A;  2J4K A;  2BMU A;  4OLC A;  3ZZF A;  3U6U A;  3L76 A;  3C20 A;  4JZ8 A;  4NDO A;  4A7X A;  2BRI A;  4NDO B;  3EK5 A;  1OHA A;  2AKO A;  2JJX A;  2A1F A;  3L86 A;  2J4J A;  2BNF A;  3S6H A;  3S6G A;  3K56 A;  3AB4 A;  1GSJ A;  2BND A;  2J4L A;  3TVI A;  4NDR A;  4NDR B;  2V5H A;  3K52 A;  3AB2 A;  4I49 A;  3NWY A;  4NDP B;  2CDQ A;  2V4Y A;  3D40 A;  2IJ9 A;  4AXS A;  3ZZG A; 
#chains in the Genus database with same CATH homology
 1Z9D A;  2VA1 A;  2AP9 A;  2WXB A;  1GS5 A;  2BNE A;  3C1M A;  2JJ4 A;  1OH9 A;  3ZZH A;  3QVF A;  3C1N A;  3QUR A;  3D2P A;  3WWN A;  2W21 A;  1YBD A;  3S6K A;  2RD5 A;  3WWM A;  4NDQ B;  3LKK A;  1E19 A;  3B8G A;  2BTY A;  2OGX B;  4NDP A;  2WE4 A;  2J5V A;  3EK6 A;  4AB7 A;  3K4O A;  2R98 A;  2BRX A;  4JZ9 A;  1OHB A;  3QUN A;  2WE5 A;  2J0W A;  2BUF A;  3LL9 A;  2E9Y A;  3QVH A;  2HMF A;  2J5T A;  4KZT A;  2J0X A;  4NDQ A;  2JI5 A;  3T7B A;  3LL5 A;  2OGX A;  3KZF A;  3AAW A;  4JZ7 A;  3QUO A;  4F6T A;  3K4Y A;  4F6T B;  3D41 A;  2R8V A;  1B7B A;  4USJ A;  2X2W A;  4A7W A;  3ZZI A;  4Q1T A;  3D2M A;  2J4K A;  2BMU A;  4OLC A;  3ZZF A;  3U6U A;  3L76 A;  3C20 A;  4JZ8 A;  4NDO A;  4A7X A;  2BRI A;  4NDO B;  3EK5 A;  1OHA A;  2AKO A;  2JJX A;  2A1F A;  3L86 A;  2J4J A;  2BNF A;  3S6H A;  3S6G A;  3K56 A;  3AB4 A;  1GSJ A;  2BND A;  2J4L A;  3TVI A;  4NDR A;  4NDR B;  2V5H A;  3K52 A;  3AB2 A;  4I49 A;  3NWY A;  4NDP B;  2CDQ A;  2V4Y A;  3D40 A;  2IJ9 A;  4AXS A;  3ZZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...