2OGXB

The crystal structure of the molybdenum storage protein from azotobacter vinelandii loaded with polyoxotungstates (wsto)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit alpha
publication title Towards Biological Supramolecular Chemistry: A Variety of Pocket-Templated, Individual Metal Oxide Cluster Nucleations in the Cavity of a Mo/W-Storage Protein.
pubmed doi rcsb
total genus 79
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ogxB00
1OHAA 1Z9DA 3QURA 3S6GA 3QUNA 2BRXA 2VA1A 2J5VA 3QVFA 2RD5A 2JI5A 4NDQB 2V5HA 1GS5A 3LKKA 4NDPA 2WE4A 2BNEA 2IJ9A 2J0XA 2J5TA 4A7WA 2OGXB 3LL5A 3U6UA 4KZTA 2BNDA 4Q1TA 4NDOA 4F6TA 3C20A 2V4YA 3T7BA 3D2MA 2JJ4A 4AXSA 3WWNA 4JZ8A 2X2WA 4USJA 3S6HA 3EK5A 3QUOA 3B8GA 3D2PA 1YBDA 4JZ7A 3KZFA 3K52A 2R8VA 2AP9A 3LL9A 2WE5A 1GSJA 2BMUA 4I49A 3QVHA 2J4LA 3ZZGA 2BNFA 3ZZHA 4NDQA 2CDQA 2J0WA 3K4YA 1E19A 3C1MA 3EK6A 1OHBA 3AB2A 3K4OA 1OH9A 4NDPB 4NDRB 2W21A 3D41A 2AKOA 2OGXA 4OLCA 3ZZIA 3L76A 3D40A 3S6KA 4NDOB 4F6TB 2BTYA 4AB7A 2J4KA 2A1FA 3L86A 2HMFA 2JJXA 3TVIA 2J4JA 2BUFA 4JZ9A 3AAWA 1B7BA 3WWMA 4NDRA 3NWYA 2E9YA 4A7XA 3ZZFA 2WXBA 2R98A 3AB4A 3C1NA 3K56A 2BRIA
chains in the Genus database with same CATH superfamily
1OHAA 1Z9DA 3QURA 3S6GA 3QUNA 2BRXA 2VA1A 2J5VA 3QVFA 2RD5A 2JI5A 4NDQB 2V5HA 1GS5A 3LKKA 4NDPA 2WE4A 2BNEA 2IJ9A 2J0XA 2J5TA 4A7WA 2OGXB 3LL5A 3U6UA 4KZTA 2BNDA 4Q1TA 4NDOA 4F6TA 3C20A 2V4YA 3T7BA 3D2MA 2JJ4A 4AXSA 3WWNA 4JZ8A 2X2WA 4USJA 3S6HA 3EK5A 3QUOA 3B8GA 3D2PA 1YBDA 4JZ7A 3KZFA 3K52A 2R8VA 2AP9A 3LL9A 2WE5A 1GSJA 2BMUA 4I49A 3QVHA 2J4LA 3ZZGA 2BNFA 3ZZHA 4NDQA 2CDQA 2J0WA 3K4YA 1E19A 3C1MA 3EK6A 1OHBA 3AB2A 3K4OA 1OH9A 4NDPB 4NDRB 2W21A 3D41A 2AKOA 2OGXA 4OLCA 3ZZIA 3L76A 3D40A 3S6KA 4NDOB 4F6TB 2BTYA 4AB7A 2J4KA 2A1FA 3L86A 2HMFA 2JJXA 3TVIA 2J4JA 2BUFA 4JZ9A 3AAWA 1B7BA 3WWMA 4NDRA 3NWYA 2E9YA 4A7XA 3ZZFA 2WXBA 2R98A 3AB4A 3C1NA 3K56A 2BRIA
chains in the Genus database with same CATH topology
1OHAA 1Z9DA 3QURA 3S6GA 3QUNA 2BRXA 2VA1A 2J5VA 3QVFA 2RD5A 2JI5A 4NDQB 2V5HA 1GS5A 3LKKA 4NDPA 2WE4A 2BNEA 2IJ9A 2J0XA 2J5TA 4A7WA 2OGXB 3LL5A 3U6UA 4KZTA 2BNDA 4Q1TA 4NDOA 4F6TA 3C20A 2V4YA 3T7BA 3D2MA 2JJ4A 4AXSA 3WWNA 4JZ8A 2X2WA 4USJA 3S6HA 3EK5A 3QUOA 3B8GA 3D2PA 1YBDA 4JZ7A 3KZFA 3K52A 2R8VA 2AP9A 3LL9A 2WE5A 1GSJA 2BMUA 4I49A 3QVHA 2J4LA 3ZZGA 2BNFA 3ZZHA 4NDQA 2CDQA 2J0WA 3K4YA 1E19A 3C1MA 3EK6A 1OHBA 3AB2A 3K4OA 1OH9A 4NDPB 4NDRB 2W21A 3D41A 2AKOA 2OGXA 4OLCA 3ZZIA 3L76A 3D40A 3S6KA 4NDOB 4F6TB 2BTYA 4AB7A 2J4KA 2A1FA 3L86A 2HMFA 2JJXA 3TVIA 2J4JA 2BUFA 4JZ9A 3AAWA 1B7BA 3WWMA 4NDRA 3NWYA 2E9YA 4A7XA 3ZZFA 2WXBA 2R98A 3AB4A 3C1NA 3K56A 2BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHA A;  1Z9D A;  3QUR A;  3S6G A;  3QUN A;  2BRX A;  2VA1 A;  2J5V A;  3QVF A;  2RD5 A;  2JI5 A;  4NDQ B;  2V5H A;  1GS5 A;  3LKK A;  4NDP A;  2WE4 A;  2BNE A;  2IJ9 A;  2J0X A;  2J5T A;  4A7W A;  2OGX B;  3LL5 A;  3U6U A;  4KZT A;  2BND A;  4Q1T A;  4NDO A;  4F6T A;  3C20 A;  2V4Y A;  3T7B A;  3D2M A;  2JJ4 A;  4AXS A;  3WWN A;  4JZ8 A;  2X2W A;  4USJ A;  3S6H A;  3EK5 A;  3QUO A;  3B8G A;  3D2P A;  1YBD A;  4JZ7 A;  3KZF A;  3K52 A;  2R8V A;  2AP9 A;  3LL9 A;  2WE5 A;  1GSJ A;  2BMU A;  4I49 A;  3QVH A;  2J4L A;  3ZZG A;  2BNF A;  3ZZH A;  4NDQ A;  2CDQ A;  2J0W A;  3K4Y A;  1E19 A;  3C1M A;  3EK6 A;  1OHB A;  3AB2 A;  3K4O A;  1OH9 A;  4NDP B;  4NDR B;  2W21 A;  3D41 A;  2AKO A;  2OGX A;  4OLC A;  3ZZI A;  3L76 A;  3D40 A;  3S6K A;  4NDO B;  4F6T B;  2BTY A;  4AB7 A;  2J4K A;  2A1F A;  3L86 A;  2HMF A;  2JJX A;  3TVI A;  2J4J A;  2BUF A;  4JZ9 A;  3AAW A;  1B7B A;  3WWM A;  4NDR A;  3NWY A;  2E9Y A;  4A7X A;  3ZZF A;  2WXB A;  2R98 A;  3AB4 A;  3C1N A;  3K56 A;  2BRI A; 
#chains in the Genus database with same CATH topology
 1OHA A;  1Z9D A;  3QUR A;  3S6G A;  3QUN A;  2BRX A;  2VA1 A;  2J5V A;  3QVF A;  2RD5 A;  2JI5 A;  4NDQ B;  2V5H A;  1GS5 A;  3LKK A;  4NDP A;  2WE4 A;  2BNE A;  2IJ9 A;  2J0X A;  2J5T A;  4A7W A;  2OGX B;  3LL5 A;  3U6U A;  4KZT A;  2BND A;  4Q1T A;  4NDO A;  4F6T A;  3C20 A;  2V4Y A;  3T7B A;  3D2M A;  2JJ4 A;  4AXS A;  3WWN A;  4JZ8 A;  2X2W A;  4USJ A;  3S6H A;  3EK5 A;  3QUO A;  3B8G A;  3D2P A;  1YBD A;  4JZ7 A;  3KZF A;  3K52 A;  2R8V A;  2AP9 A;  3LL9 A;  2WE5 A;  1GSJ A;  2BMU A;  4I49 A;  3QVH A;  2J4L A;  3ZZG A;  2BNF A;  3ZZH A;  4NDQ A;  2CDQ A;  2J0W A;  3K4Y A;  1E19 A;  3C1M A;  3EK6 A;  1OHB A;  3AB2 A;  3K4O A;  1OH9 A;  4NDP B;  4NDR B;  2W21 A;  3D41 A;  2AKO A;  2OGX A;  4OLC A;  3ZZI A;  3L76 A;  3D40 A;  3S6K A;  4NDO B;  4F6T B;  2BTY A;  4AB7 A;  2J4K A;  2A1F A;  3L86 A;  2HMF A;  2JJX A;  3TVI A;  2J4J A;  2BUF A;  4JZ9 A;  3AAW A;  1B7B A;  3WWM A;  4NDR A;  3NWY A;  2E9Y A;  4A7X A;  3ZZF A;  2WXB A;  2R98 A;  3AB4 A;  3C1N A;  3K56 A;  2BRI A; 
#chains in the Genus database with same CATH homology
 1OHA A;  1Z9D A;  3QUR A;  3S6G A;  3QUN A;  2BRX A;  2VA1 A;  2J5V A;  3QVF A;  2RD5 A;  2JI5 A;  4NDQ B;  2V5H A;  1GS5 A;  3LKK A;  4NDP A;  2WE4 A;  2BNE A;  2IJ9 A;  2J0X A;  2J5T A;  4A7W A;  2OGX B;  3LL5 A;  3U6U A;  4KZT A;  2BND A;  4Q1T A;  4NDO A;  4F6T A;  3C20 A;  2V4Y A;  3T7B A;  3D2M A;  2JJ4 A;  4AXS A;  3WWN A;  4JZ8 A;  2X2W A;  4USJ A;  3S6H A;  3EK5 A;  3QUO A;  3B8G A;  3D2P A;  1YBD A;  4JZ7 A;  3KZF A;  3K52 A;  2R8V A;  2AP9 A;  3LL9 A;  2WE5 A;  1GSJ A;  2BMU A;  4I49 A;  3QVH A;  2J4L A;  3ZZG A;  2BNF A;  3ZZH A;  4NDQ A;  2CDQ A;  2J0W A;  3K4Y A;  1E19 A;  3C1M A;  3EK6 A;  1OHB A;  3AB2 A;  3K4O A;  1OH9 A;  4NDP B;  4NDR B;  2W21 A;  3D41 A;  2AKO A;  2OGX A;  4OLC A;  3ZZI A;  3L76 A;  3D40 A;  3S6K A;  4NDO B;  4F6T B;  2BTY A;  4AB7 A;  2J4K A;  2A1F A;  3L86 A;  2HMF A;  2JJX A;  3TVI A;  2J4J A;  2BUF A;  4JZ9 A;  3AAW A;  1B7B A;  3WWM A;  4NDR A;  3NWY A;  2E9Y A;  4A7X A;  3ZZF A;  2WXB A;  2R98 A;  3AB4 A;  3C1N A;  3K56 A;  2BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...