2OGXB

The crystal structure of the molybdenum storage protein from azotobacter vinelandii loaded with polyoxotungstates (wsto)
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit alpha
publication title Towards Biological Supramolecular Chemistry: A Variety of Pocket-Templated, Individual Metal Oxide Cluster Nucleations in the Cavity of a Mo/W-Storage Protein.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 79
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2ogxB00
3U6UA 3S6HA 2VA1A 3K4OA 2IJ9A 3LL9A 3EK5A 3L76A 3QVHA 2CDQA 3ZZIA 3D2PA 1GSJA 4KZTA 3C1NA 3D2MA 2BMUA 2RD5A 4A7WA 1OH9A 3QVFA 2J5TA 3T7BA 2AP9A 3D40A 4JZ9A 4NDQB 4NDQA 4NDRB 2WE4A 2BTYA 4NDRA 3QUOA 2JI5A 3QUNA 4Q1TA 3LL5A 2J4LA 4NDOB 2V5HA 2R8VA 1GS5A 4NDOA 4NDPA 3B8GA 1Z9DA 2R98A 3K52A 3L86A 3TVIA 4JZ8A 3S6GA 2AKOA 3S6KA 3KZFA 2A1FA 3ZZGA 4USJA 3EK6A 1OHBA 2OGXA 4F6TB 3C20A 2BRXA 4F6TA 2BNEA 2WE5A 3AAWA 4NDPB 3ZZHA 2V4YA 4A7XA 3LKKA 2X2WA 3QURA 1OHAA 2HMFA 2E9YA 2BNFA 1B7BA 2BRIA 4AB7A 2JJXA 2J5VA 2OGXB 3WWMA 2J0WA 2WXBA 3K4YA 3WWNA 3AB2A 2BNDA 2JJ4A 3K56A 4JZ7A 2BUFA 2W21A 2J4KA 4OLCA 3C1MA 2J0XA 4AXSA 3ZZFA 2J4JA 3D41A 1E19A 4I49A 3NWYA 1YBDA 3AB4A
chains in the Genus database with same CATH superfamily
3U6UA 3S6HA 2VA1A 3K4OA 2IJ9A 3LL9A 3EK5A 3L76A 3QVHA 2CDQA 3ZZIA 3D2PA 1GSJA 4KZTA 3C1NA 3D2MA 2BMUA 2RD5A 4A7WA 1OH9A 3QVFA 2J5TA 3T7BA 2AP9A 3D40A 4JZ9A 4NDQB 4NDQA 4NDRB 2WE4A 2BTYA 4NDRA 3QUOA 2JI5A 3QUNA 4Q1TA 3LL5A 2J4LA 4NDOB 2V5HA 2R8VA 1GS5A 4NDOA 4NDPA 3B8GA 1Z9DA 2R98A 3K52A 3L86A 3TVIA 4JZ8A 3S6GA 2AKOA 3S6KA 3KZFA 2A1FA 3ZZGA 4USJA 3EK6A 1OHBA 2OGXA 4F6TB 3C20A 2BRXA 4F6TA 2BNEA 2WE5A 3AAWA 4NDPB 3ZZHA 2V4YA 4A7XA 3LKKA 2X2WA 3QURA 1OHAA 2HMFA 2E9YA 2BNFA 1B7BA 2BRIA 4AB7A 2JJXA 2J5VA 2OGXB 3WWMA 2J0WA 2WXBA 3K4YA 3WWNA 3AB2A 2BNDA 2JJ4A 3K56A 4JZ7A 2BUFA 2W21A 2J4KA 4OLCA 3C1MA 2J0XA 4AXSA 3ZZFA 2J4JA 3D41A 1E19A 4I49A 3NWYA 1YBDA 3AB4A
chains in the Genus database with same CATH topology
3U6UA 3S6HA 2VA1A 3K4OA 2IJ9A 3LL9A 3EK5A 3L76A 3QVHA 2CDQA 3ZZIA 3D2PA 1GSJA 4KZTA 3C1NA 3D2MA 2BMUA 2RD5A 4A7WA 1OH9A 3QVFA 2J5TA 3T7BA 2AP9A 3D40A 4JZ9A 4NDQB 4NDQA 4NDRB 2WE4A 2BTYA 4NDRA 3QUOA 2JI5A 3QUNA 4Q1TA 3LL5A 2J4LA 4NDOB 2V5HA 2R8VA 1GS5A 4NDOA 4NDPA 3B8GA 1Z9DA 2R98A 3K52A 3L86A 3TVIA 4JZ8A 3S6GA 2AKOA 3S6KA 3KZFA 2A1FA 3ZZGA 4USJA 3EK6A 1OHBA 2OGXA 4F6TB 3C20A 2BRXA 4F6TA 2BNEA 2WE5A 3AAWA 4NDPB 3ZZHA 2V4YA 4A7XA 3LKKA 2X2WA 3QURA 1OHAA 2HMFA 2E9YA 2BNFA 1B7BA 2BRIA 4AB7A 2JJXA 2J5VA 2OGXB 3WWMA 2J0WA 2WXBA 3K4YA 3WWNA 3AB2A 2BNDA 2JJ4A 3K56A 4JZ7A 2BUFA 2W21A 2J4KA 4OLCA 3C1MA 2J0XA 4AXSA 3ZZFA 2J4JA 3D41A 1E19A 4I49A 3NWYA 1YBDA 3AB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6U A;  3S6H A;  2VA1 A;  3K4O A;  2IJ9 A;  3LL9 A;  3EK5 A;  3L76 A;  3QVH A;  2CDQ A;  3ZZI A;  3D2P A;  1GSJ A;  4KZT A;  3C1N A;  3D2M A;  2BMU A;  2RD5 A;  4A7W A;  1OH9 A;  3QVF A;  2J5T A;  3T7B A;  2AP9 A;  3D40 A;  4JZ9 A;  4NDQ B;  4NDQ A;  4NDR B;  2WE4 A;  2BTY A;  4NDR A;  3QUO A;  2JI5 A;  3QUN A;  4Q1T A;  3LL5 A;  2J4L A;  4NDO B;  2V5H A;  2R8V A;  1GS5 A;  4NDO A;  4NDP A;  3B8G A;  1Z9D A;  2R98 A;  3K52 A;  3L86 A;  3TVI A;  4JZ8 A;  3S6G A;  2AKO A;  3S6K A;  3KZF A;  2A1F A;  3ZZG A;  4USJ A;  3EK6 A;  1OHB A;  2OGX A;  4F6T B;  3C20 A;  2BRX A;  4F6T A;  2BNE A;  2WE5 A;  3AAW A;  4NDP B;  3ZZH A;  2V4Y A;  4A7X A;  3LKK A;  2X2W A;  3QUR A;  1OHA A;  2HMF A;  2E9Y A;  2BNF A;  1B7B A;  2BRI A;  4AB7 A;  2JJX A;  2J5V A;  2OGX B;  3WWM A;  2J0W A;  2WXB A;  3K4Y A;  3WWN A;  3AB2 A;  2BND A;  2JJ4 A;  3K56 A;  4JZ7 A;  2BUF A;  2W21 A;  2J4K A;  4OLC A;  3C1M A;  2J0X A;  4AXS A;  3ZZF A;  2J4J A;  3D41 A;  1E19 A;  4I49 A;  3NWY A;  1YBD A;  3AB4 A; 
#chains in the Genus database with same CATH topology
 3U6U A;  3S6H A;  2VA1 A;  3K4O A;  2IJ9 A;  3LL9 A;  3EK5 A;  3L76 A;  3QVH A;  2CDQ A;  3ZZI A;  3D2P A;  1GSJ A;  4KZT A;  3C1N A;  3D2M A;  2BMU A;  2RD5 A;  4A7W A;  1OH9 A;  3QVF A;  2J5T A;  3T7B A;  2AP9 A;  3D40 A;  4JZ9 A;  4NDQ B;  4NDQ A;  4NDR B;  2WE4 A;  2BTY A;  4NDR A;  3QUO A;  2JI5 A;  3QUN A;  4Q1T A;  3LL5 A;  2J4L A;  4NDO B;  2V5H A;  2R8V A;  1GS5 A;  4NDO A;  4NDP A;  3B8G A;  1Z9D A;  2R98 A;  3K52 A;  3L86 A;  3TVI A;  4JZ8 A;  3S6G A;  2AKO A;  3S6K A;  3KZF A;  2A1F A;  3ZZG A;  4USJ A;  3EK6 A;  1OHB A;  2OGX A;  4F6T B;  3C20 A;  2BRX A;  4F6T A;  2BNE A;  2WE5 A;  3AAW A;  4NDP B;  3ZZH A;  2V4Y A;  4A7X A;  3LKK A;  2X2W A;  3QUR A;  1OHA A;  2HMF A;  2E9Y A;  2BNF A;  1B7B A;  2BRI A;  4AB7 A;  2JJX A;  2J5V A;  2OGX B;  3WWM A;  2J0W A;  2WXB A;  3K4Y A;  3WWN A;  3AB2 A;  2BND A;  2JJ4 A;  3K56 A;  4JZ7 A;  2BUF A;  2W21 A;  2J4K A;  4OLC A;  3C1M A;  2J0X A;  4AXS A;  3ZZF A;  2J4J A;  3D41 A;  1E19 A;  4I49 A;  3NWY A;  1YBD A;  3AB4 A; 
#chains in the Genus database with same CATH homology
 3U6U A;  3S6H A;  2VA1 A;  3K4O A;  2IJ9 A;  3LL9 A;  3EK5 A;  3L76 A;  3QVH A;  2CDQ A;  3ZZI A;  3D2P A;  1GSJ A;  4KZT A;  3C1N A;  3D2M A;  2BMU A;  2RD5 A;  4A7W A;  1OH9 A;  3QVF A;  2J5T A;  3T7B A;  2AP9 A;  3D40 A;  4JZ9 A;  4NDQ B;  4NDQ A;  4NDR B;  2WE4 A;  2BTY A;  4NDR A;  3QUO A;  2JI5 A;  3QUN A;  4Q1T A;  3LL5 A;  2J4L A;  4NDO B;  2V5H A;  2R8V A;  1GS5 A;  4NDO A;  4NDP A;  3B8G A;  1Z9D A;  2R98 A;  3K52 A;  3L86 A;  3TVI A;  4JZ8 A;  3S6G A;  2AKO A;  3S6K A;  3KZF A;  2A1F A;  3ZZG A;  4USJ A;  3EK6 A;  1OHB A;  2OGX A;  4F6T B;  3C20 A;  2BRX A;  4F6T A;  2BNE A;  2WE5 A;  3AAW A;  4NDP B;  3ZZH A;  2V4Y A;  4A7X A;  3LKK A;  2X2W A;  3QUR A;  1OHA A;  2HMF A;  2E9Y A;  2BNF A;  1B7B A;  2BRI A;  4AB7 A;  2JJX A;  2J5V A;  2OGX B;  3WWM A;  2J0W A;  2WXB A;  3K4Y A;  3WWN A;  3AB2 A;  2BND A;  2JJ4 A;  3K56 A;  4JZ7 A;  2BUF A;  2W21 A;  2J4K A;  4OLC A;  3C1M A;  2J0X A;  4AXS A;  3ZZF A;  2J4J A;  3D41 A;  1E19 A;  4I49 A;  3NWY A;  1YBD A;  3AB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...