2BNFA

The structure of e. coli ump kinase in complex with utp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
236
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 69
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bnfA00
1B7BA 3D2PA 2CDQA 3K52A 2HMFA 2J5VA 2AP9A 2OGXB 1OH9A 4NDPA 4JZ9A 2JJ4A 2BTYA 3D41A 3QUOA 3T7BA 3ZZIA 1GS5A 4Q1TA 2X2WA 3D2MA 3WWNA 2BMUA 3C1NA 2R8VA 3ZZFA 4NDQB 3U6UA 2OGXA 1E19A 3ZZHA 4F6TB 3AAWA 2R98A 2J4LA 3QVFA 3QUNA 3AB2A 4A7XA 4OLCA 2JI5A 2J0WA 3L76A 4NDQA 2BUFA 2J5TA 2V5HA 2J4KA 3KZFA 2JJXA 1GSJA 3B8GA 3S6HA 4F6TA 4NDOB 4NDRB 3S6KA 2VA1A 3LL5A 4JZ7A 2WE5A 4AB7A 3WWMA 3EK6A 3S6GA 2IJ9A 4A7WA 3D40A 2V4YA 3NWYA 3TVIA 2A1FA 2AKOA 2WXBA 1OHAA 3L86A 3EK5A 2WE4A 3K56A 3QVHA 3C1MA 1YBDA 3QURA 3K4OA 2J0XA 2RD5A 4NDOA 2BRIA 2BNEA 4NDRA 2W21A 4KZTA 2BNFA 1Z9DA 3LL9A 3K4YA 1OHBA 3C20A 4USJA 4NDPB 4AXSA 2E9YA 3ZZGA 4JZ8A 3LKKA 4I49A 2BRXA 2BNDA 2J4JA 3AB4A
chains in the Genus database with same CATH superfamily
1B7BA 3D2PA 2CDQA 3K52A 2HMFA 2J5VA 2AP9A 2OGXB 1OH9A 4NDPA 4JZ9A 2JJ4A 2BTYA 3D41A 3QUOA 3T7BA 3ZZIA 1GS5A 4Q1TA 2X2WA 3D2MA 3WWNA 2BMUA 3C1NA 2R8VA 3ZZFA 4NDQB 3U6UA 2OGXA 1E19A 3ZZHA 4F6TB 3AAWA 2R98A 2J4LA 3QVFA 3QUNA 3AB2A 4A7XA 4OLCA 2JI5A 2J0WA 3L76A 4NDQA 2BUFA 2J5TA 2V5HA 2J4KA 3KZFA 2JJXA 1GSJA 3B8GA 3S6HA 4F6TA 4NDOB 4NDRB 3S6KA 2VA1A 3LL5A 4JZ7A 2WE5A 4AB7A 3WWMA 3EK6A 3S6GA 2IJ9A 4A7WA 3D40A 2V4YA 3NWYA 3TVIA 2A1FA 2AKOA 2WXBA 1OHAA 3L86A 3EK5A 2WE4A 3K56A 3QVHA 3C1MA 1YBDA 3QURA 3K4OA 2J0XA 2RD5A 4NDOA 2BRIA 2BNEA 4NDRA 2W21A 4KZTA 2BNFA 1Z9DA 3LL9A 3K4YA 1OHBA 3C20A 4USJA 4NDPB 4AXSA 2E9YA 3ZZGA 4JZ8A 3LKKA 4I49A 2BRXA 2BNDA 2J4JA 3AB4A
chains in the Genus database with same CATH topology
1B7BA 3D2PA 2CDQA 3K52A 2HMFA 2J5VA 2AP9A 2OGXB 1OH9A 4NDPA 4JZ9A 2JJ4A 2BTYA 3D41A 3QUOA 3T7BA 3ZZIA 1GS5A 4Q1TA 2X2WA 3D2MA 3WWNA 2BMUA 3C1NA 2R8VA 3ZZFA 4NDQB 3U6UA 2OGXA 1E19A 3ZZHA 4F6TB 3AAWA 2R98A 2J4LA 3QVFA 3QUNA 3AB2A 4A7XA 4OLCA 2JI5A 2J0WA 3L76A 4NDQA 2BUFA 2J5TA 2V5HA 2J4KA 3KZFA 2JJXA 1GSJA 3B8GA 3S6HA 4F6TA 4NDOB 4NDRB 3S6KA 2VA1A 3LL5A 4JZ7A 2WE5A 4AB7A 3WWMA 3EK6A 3S6GA 2IJ9A 4A7WA 3D40A 2V4YA 3NWYA 3TVIA 2A1FA 2AKOA 2WXBA 1OHAA 3L86A 3EK5A 2WE4A 3K56A 3QVHA 3C1MA 1YBDA 3QURA 3K4OA 2J0XA 2RD5A 4NDOA 2BRIA 2BNEA 4NDRA 2W21A 4KZTA 2BNFA 1Z9DA 3LL9A 3K4YA 1OHBA 3C20A 4USJA 4NDPB 4AXSA 2E9YA 3ZZGA 4JZ8A 3LKKA 4I49A 2BRXA 2BNDA 2J4JA 3AB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7B A;  3D2P A;  2CDQ A;  3K52 A;  2HMF A;  2J5V A;  2AP9 A;  2OGX B;  1OH9 A;  4NDP A;  4JZ9 A;  2JJ4 A;  2BTY A;  3D41 A;  3QUO A;  3T7B A;  3ZZI A;  1GS5 A;  4Q1T A;  2X2W A;  3D2M A;  3WWN A;  2BMU A;  3C1N A;  2R8V A;  3ZZF A;  4NDQ B;  3U6U A;  2OGX A;  1E19 A;  3ZZH A;  4F6T B;  3AAW A;  2R98 A;  2J4L A;  3QVF A;  3QUN A;  3AB2 A;  4A7X A;  4OLC A;  2JI5 A;  2J0W A;  3L76 A;  4NDQ A;  2BUF A;  2J5T A;  2V5H A;  2J4K A;  3KZF A;  2JJX A;  1GSJ A;  3B8G A;  3S6H A;  4F6T A;  4NDO B;  4NDR B;  3S6K A;  2VA1 A;  3LL5 A;  4JZ7 A;  2WE5 A;  4AB7 A;  3WWM A;  3EK6 A;  3S6G A;  2IJ9 A;  4A7W A;  3D40 A;  2V4Y A;  3NWY A;  3TVI A;  2A1F A;  2AKO A;  2WXB A;  1OHA A;  3L86 A;  3EK5 A;  2WE4 A;  3K56 A;  3QVH A;  3C1M A;  1YBD A;  3QUR A;  3K4O A;  2J0X A;  2RD5 A;  4NDO A;  2BRI A;  2BNE A;  4NDR A;  2W21 A;  4KZT A;  2BNF A;  1Z9D A;  3LL9 A;  3K4Y A;  1OHB A;  3C20 A;  4USJ A;  4NDP B;  4AXS A;  2E9Y A;  3ZZG A;  4JZ8 A;  3LKK A;  4I49 A;  2BRX A;  2BND A;  2J4J A;  3AB4 A; 
#chains in the Genus database with same CATH topology
 1B7B A;  3D2P A;  2CDQ A;  3K52 A;  2HMF A;  2J5V A;  2AP9 A;  2OGX B;  1OH9 A;  4NDP A;  4JZ9 A;  2JJ4 A;  2BTY A;  3D41 A;  3QUO A;  3T7B A;  3ZZI A;  1GS5 A;  4Q1T A;  2X2W A;  3D2M A;  3WWN A;  2BMU A;  3C1N A;  2R8V A;  3ZZF A;  4NDQ B;  3U6U A;  2OGX A;  1E19 A;  3ZZH A;  4F6T B;  3AAW A;  2R98 A;  2J4L A;  3QVF A;  3QUN A;  3AB2 A;  4A7X A;  4OLC A;  2JI5 A;  2J0W A;  3L76 A;  4NDQ A;  2BUF A;  2J5T A;  2V5H A;  2J4K A;  3KZF A;  2JJX A;  1GSJ A;  3B8G A;  3S6H A;  4F6T A;  4NDO B;  4NDR B;  3S6K A;  2VA1 A;  3LL5 A;  4JZ7 A;  2WE5 A;  4AB7 A;  3WWM A;  3EK6 A;  3S6G A;  2IJ9 A;  4A7W A;  3D40 A;  2V4Y A;  3NWY A;  3TVI A;  2A1F A;  2AKO A;  2WXB A;  1OHA A;  3L86 A;  3EK5 A;  2WE4 A;  3K56 A;  3QVH A;  3C1M A;  1YBD A;  3QUR A;  3K4O A;  2J0X A;  2RD5 A;  4NDO A;  2BRI A;  2BNE A;  4NDR A;  2W21 A;  4KZT A;  2BNF A;  1Z9D A;  3LL9 A;  3K4Y A;  1OHB A;  3C20 A;  4USJ A;  4NDP B;  4AXS A;  2E9Y A;  3ZZG A;  4JZ8 A;  3LKK A;  4I49 A;  2BRX A;  2BND A;  2J4J A;  3AB4 A; 
#chains in the Genus database with same CATH homology
 1B7B A;  3D2P A;  2CDQ A;  3K52 A;  2HMF A;  2J5V A;  2AP9 A;  2OGX B;  1OH9 A;  4NDP A;  4JZ9 A;  2JJ4 A;  2BTY A;  3D41 A;  3QUO A;  3T7B A;  3ZZI A;  1GS5 A;  4Q1T A;  2X2W A;  3D2M A;  3WWN A;  2BMU A;  3C1N A;  2R8V A;  3ZZF A;  4NDQ B;  3U6U A;  2OGX A;  1E19 A;  3ZZH A;  4F6T B;  3AAW A;  2R98 A;  2J4L A;  3QVF A;  3QUN A;  3AB2 A;  4A7X A;  4OLC A;  2JI5 A;  2J0W A;  3L76 A;  4NDQ A;  2BUF A;  2J5T A;  2V5H A;  2J4K A;  3KZF A;  2JJX A;  1GSJ A;  3B8G A;  3S6H A;  4F6T A;  4NDO B;  4NDR B;  3S6K A;  2VA1 A;  3LL5 A;  4JZ7 A;  2WE5 A;  4AB7 A;  3WWM A;  3EK6 A;  3S6G A;  2IJ9 A;  4A7W A;  3D40 A;  2V4Y A;  3NWY A;  3TVI A;  2A1F A;  2AKO A;  2WXB A;  1OHA A;  3L86 A;  3EK5 A;  2WE4 A;  3K56 A;  3QVH A;  3C1M A;  1YBD A;  3QUR A;  3K4O A;  2J0X A;  2RD5 A;  4NDO A;  2BRI A;  2BNE A;  4NDR A;  2W21 A;  4KZT A;  2BNF A;  1Z9D A;  3LL9 A;  3K4Y A;  1OHB A;  3C20 A;  4USJ A;  4NDP B;  4AXS A;  2E9Y A;  3ZZG A;  4JZ8 A;  3LKK A;  4I49 A;  2BRX A;  2BND A;  2J4J A;  3AB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...