2BNFA

The structure of e. coli ump kinase in complex with utp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
236
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bnfA00
2WXBA 3K4YA 2HMFA 2IJ9A 2R8VA 3C20A 1GS5A 2V5HA 2OGXA 3EK6A 2J0XA 2J4LA 3QURA 1B7BA 4Q1TA 3K52A 2RD5A 2J0WA 1Z9DA 4JZ7A 1YBDA 2W21A 3QVFA 2AKOA 3U6UA 2A1FA 2JJXA 2CDQA 2BNFA 1OHBA 4NDRA 2BNEA 3C1NA 2BRXA 2J5TA 3KZFA 3D2MA 2OGXB 3D41A 4NDOA 4NDQA 3S6KA 4AB7A 4I49A 3NWYA 3ZZFA 3D40A 2J4KA 1OH9A 3LL5A 4KZTA 2J4JA 3L76A 4OLCA 3K4OA 2V4YA 4USJA 2E9YA 3TVIA 3D2PA 2J5VA 4NDRB 3AAWA 4NDPA 4F6TA 2BNDA 3EK5A 3WWMA 2R98A 4NDOB 4NDQB 2WE4A 4A7XA 3S6HA 1OHAA 1E19A 4JZ8A 3QUNA 2X2WA 2JI5A 3B8GA 3K56A 4AXSA 3S6GA 3AB2A 4A7WA 3QUOA 2WE5A 2AP9A 2VA1A 4NDPB 4JZ9A 3C1MA 4F6TB 2BTYA 2JJ4A 3L86A 2BRIA 3ZZHA 3AB4A 3T7BA 3ZZGA 2BMUA 3LKKA 3QVHA 3WWNA 3LL9A 3ZZIA 1GSJA 2BUFA
chains in the Genus database with same CATH superfamily
2WXBA 3K4YA 2HMFA 2IJ9A 2R8VA 3C20A 1GS5A 2V5HA 2OGXA 3EK6A 2J0XA 2J4LA 3QURA 1B7BA 4Q1TA 3K52A 2RD5A 2J0WA 1Z9DA 4JZ7A 1YBDA 2W21A 3QVFA 2AKOA 3U6UA 2A1FA 2JJXA 2CDQA 2BNFA 1OHBA 4NDRA 2BNEA 3C1NA 2BRXA 2J5TA 3KZFA 3D2MA 2OGXB 3D41A 4NDOA 4NDQA 3S6KA 4AB7A 4I49A 3NWYA 3ZZFA 3D40A 2J4KA 1OH9A 3LL5A 4KZTA 2J4JA 3L76A 4OLCA 3K4OA 2V4YA 4USJA 2E9YA 3TVIA 3D2PA 2J5VA 4NDRB 3AAWA 4NDPA 4F6TA 2BNDA 3EK5A 3WWMA 2R98A 4NDOB 4NDQB 2WE4A 4A7XA 3S6HA 1OHAA 1E19A 4JZ8A 3QUNA 2X2WA 2JI5A 3B8GA 3K56A 4AXSA 3S6GA 3AB2A 4A7WA 3QUOA 2WE5A 2AP9A 2VA1A 4NDPB 4JZ9A 3C1MA 4F6TB 2BTYA 2JJ4A 3L86A 2BRIA 3ZZHA 3AB4A 3T7BA 3ZZGA 2BMUA 3LKKA 3QVHA 3WWNA 3LL9A 3ZZIA 1GSJA 2BUFA
chains in the Genus database with same CATH topology
2WXBA 3K4YA 2HMFA 2IJ9A 2R8VA 3C20A 1GS5A 2V5HA 2OGXA 3EK6A 2J0XA 2J4LA 3QURA 1B7BA 4Q1TA 3K52A 2RD5A 2J0WA 1Z9DA 4JZ7A 1YBDA 2W21A 3QVFA 2AKOA 3U6UA 2A1FA 2JJXA 2CDQA 2BNFA 1OHBA 4NDRA 2BNEA 3C1NA 2BRXA 2J5TA 3KZFA 3D2MA 2OGXB 3D41A 4NDOA 4NDQA 3S6KA 4AB7A 4I49A 3NWYA 3ZZFA 3D40A 2J4KA 1OH9A 3LL5A 4KZTA 2J4JA 3L76A 4OLCA 3K4OA 2V4YA 4USJA 2E9YA 3TVIA 3D2PA 2J5VA 4NDRB 3AAWA 4NDPA 4F6TA 2BNDA 3EK5A 3WWMA 2R98A 4NDOB 4NDQB 2WE4A 4A7XA 3S6HA 1OHAA 1E19A 4JZ8A 3QUNA 2X2WA 2JI5A 3B8GA 3K56A 4AXSA 3S6GA 3AB2A 4A7WA 3QUOA 2WE5A 2AP9A 2VA1A 4NDPB 4JZ9A 3C1MA 4F6TB 2BTYA 2JJ4A 3L86A 2BRIA 3ZZHA 3AB4A 3T7BA 3ZZGA 2BMUA 3LKKA 3QVHA 3WWNA 3LL9A 3ZZIA 1GSJA 2BUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WXB A;  3K4Y A;  2HMF A;  2IJ9 A;  2R8V A;  3C20 A;  1GS5 A;  2V5H A;  2OGX A;  3EK6 A;  2J0X A;  2J4L A;  3QUR A;  1B7B A;  4Q1T A;  3K52 A;  2RD5 A;  2J0W A;  1Z9D A;  4JZ7 A;  1YBD A;  2W21 A;  3QVF A;  2AKO A;  3U6U A;  2A1F A;  2JJX A;  2CDQ A;  2BNF A;  1OHB A;  4NDR A;  2BNE A;  3C1N A;  2BRX A;  2J5T A;  3KZF A;  3D2M A;  2OGX B;  3D41 A;  4NDO A;  4NDQ A;  3S6K A;  4AB7 A;  4I49 A;  3NWY A;  3ZZF A;  3D40 A;  2J4K A;  1OH9 A;  3LL5 A;  4KZT A;  2J4J A;  3L76 A;  4OLC A;  3K4O A;  2V4Y A;  4USJ A;  2E9Y A;  3TVI A;  3D2P A;  2J5V A;  4NDR B;  3AAW A;  4NDP A;  4F6T A;  2BND A;  3EK5 A;  3WWM A;  2R98 A;  4NDO B;  4NDQ B;  2WE4 A;  4A7X A;  3S6H A;  1OHA A;  1E19 A;  4JZ8 A;  3QUN A;  2X2W A;  2JI5 A;  3B8G A;  3K56 A;  4AXS A;  3S6G A;  3AB2 A;  4A7W A;  3QUO A;  2WE5 A;  2AP9 A;  2VA1 A;  4NDP B;  4JZ9 A;  3C1M A;  4F6T B;  2BTY A;  2JJ4 A;  3L86 A;  2BRI A;  3ZZH A;  3AB4 A;  3T7B A;  3ZZG A;  2BMU A;  3LKK A;  3QVH A;  3WWN A;  3LL9 A;  3ZZI A;  1GSJ A;  2BUF A; 
#chains in the Genus database with same CATH topology
 2WXB A;  3K4Y A;  2HMF A;  2IJ9 A;  2R8V A;  3C20 A;  1GS5 A;  2V5H A;  2OGX A;  3EK6 A;  2J0X A;  2J4L A;  3QUR A;  1B7B A;  4Q1T A;  3K52 A;  2RD5 A;  2J0W A;  1Z9D A;  4JZ7 A;  1YBD A;  2W21 A;  3QVF A;  2AKO A;  3U6U A;  2A1F A;  2JJX A;  2CDQ A;  2BNF A;  1OHB A;  4NDR A;  2BNE A;  3C1N A;  2BRX A;  2J5T A;  3KZF A;  3D2M A;  2OGX B;  3D41 A;  4NDO A;  4NDQ A;  3S6K A;  4AB7 A;  4I49 A;  3NWY A;  3ZZF A;  3D40 A;  2J4K A;  1OH9 A;  3LL5 A;  4KZT A;  2J4J A;  3L76 A;  4OLC A;  3K4O A;  2V4Y A;  4USJ A;  2E9Y A;  3TVI A;  3D2P A;  2J5V A;  4NDR B;  3AAW A;  4NDP A;  4F6T A;  2BND A;  3EK5 A;  3WWM A;  2R98 A;  4NDO B;  4NDQ B;  2WE4 A;  4A7X A;  3S6H A;  1OHA A;  1E19 A;  4JZ8 A;  3QUN A;  2X2W A;  2JI5 A;  3B8G A;  3K56 A;  4AXS A;  3S6G A;  3AB2 A;  4A7W A;  3QUO A;  2WE5 A;  2AP9 A;  2VA1 A;  4NDP B;  4JZ9 A;  3C1M A;  4F6T B;  2BTY A;  2JJ4 A;  3L86 A;  2BRI A;  3ZZH A;  3AB4 A;  3T7B A;  3ZZG A;  2BMU A;  3LKK A;  3QVH A;  3WWN A;  3LL9 A;  3ZZI A;  1GSJ A;  2BUF A; 
#chains in the Genus database with same CATH homology
 2WXB A;  3K4Y A;  2HMF A;  2IJ9 A;  2R8V A;  3C20 A;  1GS5 A;  2V5H A;  2OGX A;  3EK6 A;  2J0X A;  2J4L A;  3QUR A;  1B7B A;  4Q1T A;  3K52 A;  2RD5 A;  2J0W A;  1Z9D A;  4JZ7 A;  1YBD A;  2W21 A;  3QVF A;  2AKO A;  3U6U A;  2A1F A;  2JJX A;  2CDQ A;  2BNF A;  1OHB A;  4NDR A;  2BNE A;  3C1N A;  2BRX A;  2J5T A;  3KZF A;  3D2M A;  2OGX B;  3D41 A;  4NDO A;  4NDQ A;  3S6K A;  4AB7 A;  4I49 A;  3NWY A;  3ZZF A;  3D40 A;  2J4K A;  1OH9 A;  3LL5 A;  4KZT A;  2J4J A;  3L76 A;  4OLC A;  3K4O A;  2V4Y A;  4USJ A;  2E9Y A;  3TVI A;  3D2P A;  2J5V A;  4NDR B;  3AAW A;  4NDP A;  4F6T A;  2BND A;  3EK5 A;  3WWM A;  2R98 A;  4NDO B;  4NDQ B;  2WE4 A;  4A7X A;  3S6H A;  1OHA A;  1E19 A;  4JZ8 A;  3QUN A;  2X2W A;  2JI5 A;  3B8G A;  3K56 A;  4AXS A;  3S6G A;  3AB2 A;  4A7W A;  3QUO A;  2WE5 A;  2AP9 A;  2VA1 A;  4NDP B;  4JZ9 A;  3C1M A;  4F6T B;  2BTY A;  2JJ4 A;  3L86 A;  2BRI A;  3ZZH A;  3AB4 A;  3T7B A;  3ZZG A;  2BMU A;  3LKK A;  3QVH A;  3WWN A;  3LL9 A;  3ZZI A;  1GSJ A;  2BUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...