2BNFA

The structure of e. coli ump kinase in complex with utp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
236
Chain Sequence
b'AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 69
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bnfA00
2WE5A 4NDPA 1OHAA 1OHBA 3T7BA 3S6HA 3EK6A 2AP9A 4OLCA 2J4JA 2E9YA 3LL5A 2BNDA 2J0XA 2BMUA 2WXBA 2W21A 3L86A 2OGXB 3ZZHA 4AXSA 3AB2A 3D40A 2RD5A 3AAWA 2J4KA 2J5TA 3D2MA 1E19A 3C1NA 4A7WA 3K56A 4NDQB 2BTYA 4NDPB 3ZZFA 3L76A 4AB7A 3C20A 1B7BA 2CDQA 3WWMA 2VA1A 3WWNA 2BNFA 3S6KA 2A1FA 3LKKA 2BUFA 3ZZIA 1OH9A 3QUNA 2JI5A 3C1MA 2JJXA 2HMFA 3K4YA 3LL9A 2R8VA 4NDOA 2J0WA 2IJ9A 3D2PA 2BNEA 2J4LA 4USJA 3K52A 1GS5A 4F6TA 3QVFA 3B8GA 3TVIA 4I49A 1GSJA 2AKOA 2WE4A 2X2WA 1YBDA 3K4OA 1Z9DA 3ZZGA 3QURA 2V4YA 4A7XA 4Q1TA 3S6GA 2BRIA 4JZ7A 4JZ9A 3NWYA 4NDOB 4JZ8A 4NDRA 4NDRB 3AB4A 3QVHA 3D41A 4F6TB 2JJ4A 3KZFA 2BRXA 3U6UA 2R98A 2OGXA 3QUOA 4KZTA 2V5HA 2J5VA 3EK5A 4NDQA
chains in the Genus database with same CATH superfamily
2WE5A 4NDPA 1OHAA 1OHBA 3T7BA 3S6HA 3EK6A 2AP9A 4OLCA 2J4JA 2E9YA 3LL5A 2BNDA 2J0XA 2BMUA 2WXBA 2W21A 3L86A 2OGXB 3ZZHA 4AXSA 3AB2A 3D40A 2RD5A 3AAWA 2J4KA 2J5TA 3D2MA 1E19A 3C1NA 4A7WA 3K56A 4NDQB 2BTYA 4NDPB 3ZZFA 3L76A 4AB7A 3C20A 1B7BA 2CDQA 3WWMA 2VA1A 3WWNA 2BNFA 3S6KA 2A1FA 3LKKA 2BUFA 3ZZIA 1OH9A 3QUNA 2JI5A 3C1MA 2JJXA 2HMFA 3K4YA 3LL9A 2R8VA 4NDOA 2J0WA 2IJ9A 3D2PA 2BNEA 2J4LA 4USJA 3K52A 1GS5A 4F6TA 3QVFA 3B8GA 3TVIA 4I49A 1GSJA 2AKOA 2WE4A 2X2WA 1YBDA 3K4OA 1Z9DA 3ZZGA 3QURA 2V4YA 4A7XA 4Q1TA 3S6GA 2BRIA 4JZ7A 4JZ9A 3NWYA 4NDOB 4JZ8A 4NDRA 4NDRB 3AB4A 3QVHA 3D41A 4F6TB 2JJ4A 3KZFA 2BRXA 3U6UA 2R98A 2OGXA 3QUOA 4KZTA 2V5HA 2J5VA 3EK5A 4NDQA
chains in the Genus database with same CATH topology
2WE5A 4NDPA 1OHAA 1OHBA 3T7BA 3S6HA 3EK6A 2AP9A 4OLCA 2J4JA 2E9YA 3LL5A 2BNDA 2J0XA 2BMUA 2WXBA 2W21A 3L86A 2OGXB 3ZZHA 4AXSA 3AB2A 3D40A 2RD5A 3AAWA 2J4KA 2J5TA 3D2MA 1E19A 3C1NA 4A7WA 3K56A 4NDQB 2BTYA 4NDPB 3ZZFA 3L76A 4AB7A 3C20A 1B7BA 2CDQA 3WWMA 2VA1A 3WWNA 2BNFA 3S6KA 2A1FA 3LKKA 2BUFA 3ZZIA 1OH9A 3QUNA 2JI5A 3C1MA 2JJXA 2HMFA 3K4YA 3LL9A 2R8VA 4NDOA 2J0WA 2IJ9A 3D2PA 2BNEA 2J4LA 4USJA 3K52A 1GS5A 4F6TA 3QVFA 3B8GA 3TVIA 4I49A 1GSJA 2AKOA 2WE4A 2X2WA 1YBDA 3K4OA 1Z9DA 3ZZGA 3QURA 2V4YA 4A7XA 4Q1TA 3S6GA 2BRIA 4JZ7A 4JZ9A 3NWYA 4NDOB 4JZ8A 4NDRA 4NDRB 3AB4A 3QVHA 3D41A 4F6TB 2JJ4A 3KZFA 2BRXA 3U6UA 2R98A 2OGXA 3QUOA 4KZTA 2V5HA 2J5VA 3EK5A 4NDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WE5 A;  4NDP A;  1OHA A;  1OHB A;  3T7B A;  3S6H A;  3EK6 A;  2AP9 A;  4OLC A;  2J4J A;  2E9Y A;  3LL5 A;  2BND A;  2J0X A;  2BMU A;  2WXB A;  2W21 A;  3L86 A;  2OGX B;  3ZZH A;  4AXS A;  3AB2 A;  3D40 A;  2RD5 A;  3AAW A;  2J4K A;  2J5T A;  3D2M A;  1E19 A;  3C1N A;  4A7W A;  3K56 A;  4NDQ B;  2BTY A;  4NDP B;  3ZZF A;  3L76 A;  4AB7 A;  3C20 A;  1B7B A;  2CDQ A;  3WWM A;  2VA1 A;  3WWN A;  2BNF A;  3S6K A;  2A1F A;  3LKK A;  2BUF A;  3ZZI A;  1OH9 A;  3QUN A;  2JI5 A;  3C1M A;  2JJX A;  2HMF A;  3K4Y A;  3LL9 A;  2R8V A;  4NDO A;  2J0W A;  2IJ9 A;  3D2P A;  2BNE A;  2J4L A;  4USJ A;  3K52 A;  1GS5 A;  4F6T A;  3QVF A;  3B8G A;  3TVI A;  4I49 A;  1GSJ A;  2AKO A;  2WE4 A;  2X2W A;  1YBD A;  3K4O A;  1Z9D A;  3ZZG A;  3QUR A;  2V4Y A;  4A7X A;  4Q1T A;  3S6G A;  2BRI A;  4JZ7 A;  4JZ9 A;  3NWY A;  4NDO B;  4JZ8 A;  4NDR A;  4NDR B;  3AB4 A;  3QVH A;  3D41 A;  4F6T B;  2JJ4 A;  3KZF A;  2BRX A;  3U6U A;  2R98 A;  2OGX A;  3QUO A;  4KZT A;  2V5H A;  2J5V A;  3EK5 A;  4NDQ A; 
#chains in the Genus database with same CATH topology
 2WE5 A;  4NDP A;  1OHA A;  1OHB A;  3T7B A;  3S6H A;  3EK6 A;  2AP9 A;  4OLC A;  2J4J A;  2E9Y A;  3LL5 A;  2BND A;  2J0X A;  2BMU A;  2WXB A;  2W21 A;  3L86 A;  2OGX B;  3ZZH A;  4AXS A;  3AB2 A;  3D40 A;  2RD5 A;  3AAW A;  2J4K A;  2J5T A;  3D2M A;  1E19 A;  3C1N A;  4A7W A;  3K56 A;  4NDQ B;  2BTY A;  4NDP B;  3ZZF A;  3L76 A;  4AB7 A;  3C20 A;  1B7B A;  2CDQ A;  3WWM A;  2VA1 A;  3WWN A;  2BNF A;  3S6K A;  2A1F A;  3LKK A;  2BUF A;  3ZZI A;  1OH9 A;  3QUN A;  2JI5 A;  3C1M A;  2JJX A;  2HMF A;  3K4Y A;  3LL9 A;  2R8V A;  4NDO A;  2J0W A;  2IJ9 A;  3D2P A;  2BNE A;  2J4L A;  4USJ A;  3K52 A;  1GS5 A;  4F6T A;  3QVF A;  3B8G A;  3TVI A;  4I49 A;  1GSJ A;  2AKO A;  2WE4 A;  2X2W A;  1YBD A;  3K4O A;  1Z9D A;  3ZZG A;  3QUR A;  2V4Y A;  4A7X A;  4Q1T A;  3S6G A;  2BRI A;  4JZ7 A;  4JZ9 A;  3NWY A;  4NDO B;  4JZ8 A;  4NDR A;  4NDR B;  3AB4 A;  3QVH A;  3D41 A;  4F6T B;  2JJ4 A;  3KZF A;  2BRX A;  3U6U A;  2R98 A;  2OGX A;  3QUO A;  4KZT A;  2V5H A;  2J5V A;  3EK5 A;  4NDQ A; 
#chains in the Genus database with same CATH homology
 2WE5 A;  4NDP A;  1OHA A;  1OHB A;  3T7B A;  3S6H A;  3EK6 A;  2AP9 A;  4OLC A;  2J4J A;  2E9Y A;  3LL5 A;  2BND A;  2J0X A;  2BMU A;  2WXB A;  2W21 A;  3L86 A;  2OGX B;  3ZZH A;  4AXS A;  3AB2 A;  3D40 A;  2RD5 A;  3AAW A;  2J4K A;  2J5T A;  3D2M A;  1E19 A;  3C1N A;  4A7W A;  3K56 A;  4NDQ B;  2BTY A;  4NDP B;  3ZZF A;  3L76 A;  4AB7 A;  3C20 A;  1B7B A;  2CDQ A;  3WWM A;  2VA1 A;  3WWN A;  2BNF A;  3S6K A;  2A1F A;  3LKK A;  2BUF A;  3ZZI A;  1OH9 A;  3QUN A;  2JI5 A;  3C1M A;  2JJX A;  2HMF A;  3K4Y A;  3LL9 A;  2R8V A;  4NDO A;  2J0W A;  2IJ9 A;  3D2P A;  2BNE A;  2J4L A;  4USJ A;  3K52 A;  1GS5 A;  4F6T A;  3QVF A;  3B8G A;  3TVI A;  4I49 A;  1GSJ A;  2AKO A;  2WE4 A;  2X2W A;  1YBD A;  3K4O A;  1Z9D A;  3ZZG A;  3QUR A;  2V4Y A;  4A7X A;  4Q1T A;  3S6G A;  2BRI A;  4JZ7 A;  4JZ9 A;  3NWY A;  4NDO B;  4JZ8 A;  4NDR A;  4NDR B;  3AB4 A;  3QVH A;  3D41 A;  4F6T B;  2JJ4 A;  3KZF A;  2BRX A;  3U6U A;  2R98 A;  2OGX A;  3QUO A;  4KZT A;  2V5H A;  2J5V A;  3EK5 A;  4NDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...