2BNFA

The structure of e. coli ump kinase in complex with utp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
236
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 69
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bnfA00
3L76A 3S6HA 3KZFA 2AKOA 2JI5A 2RD5A 2BNEA 4OLCA 2J5TA 3D2PA 3WWMA 3C1MA 4I49A 2V4YA 2J4LA 3K52A 3B8GA 2J4KA 3LL9A 2R98A 4NDOA 2JJXA 1OHBA 2JJ4A 2AP9A 2J5VA 4NDPB 4NDQB 2HMFA 3C1NA 2BNFA 4AB7A 2W21A 4NDRA 2BMUA 3QURA 2BUFA 2J4JA 3AB4A 4NDOB 3EK6A 3QUNA 3EK5A 1E19A 1B7BA 3K4OA 3S6GA 2X2WA 4F6TA 3S6KA 3L86A 1Z9DA 3LL5A 4NDRB 2OGXA 1OH9A 1OHAA 4A7WA 2BRIA 3D41A 4JZ7A 3K56A 3U6UA 2WE5A 3D40A 3ZZGA 2WXBA 4Q1TA 2CDQA 3D2MA 4JZ9A 2BTYA 3AB2A 3QUOA 1YBDA 3AAWA 4AXSA 2E9YA 2IJ9A 2OGXB 2BNDA 3TVIA 3ZZFA 2J0WA 4KZTA 3QVFA 3C20A 4NDQA 1GSJA 4NDPA 2A1FA 2R8VA 2WE4A 3LKKA 2V5HA 3T7BA 3NWYA 2BRXA 2VA1A 4JZ8A 4F6TB 4USJA 3K4YA 3ZZHA 3QVHA 3WWNA 1GS5A 2J0XA 3ZZIA 4A7XA
chains in the Genus database with same CATH superfamily
3L76A 3S6HA 3KZFA 2AKOA 2JI5A 2RD5A 2BNEA 4OLCA 2J5TA 3D2PA 3WWMA 3C1MA 4I49A 2V4YA 2J4LA 3K52A 3B8GA 2J4KA 3LL9A 2R98A 4NDOA 2JJXA 1OHBA 2JJ4A 2AP9A 2J5VA 4NDPB 4NDQB 2HMFA 3C1NA 2BNFA 4AB7A 2W21A 4NDRA 2BMUA 3QURA 2BUFA 2J4JA 3AB4A 4NDOB 3EK6A 3QUNA 3EK5A 1E19A 1B7BA 3K4OA 3S6GA 2X2WA 4F6TA 3S6KA 3L86A 1Z9DA 3LL5A 4NDRB 2OGXA 1OH9A 1OHAA 4A7WA 2BRIA 3D41A 4JZ7A 3K56A 3U6UA 2WE5A 3D40A 3ZZGA 2WXBA 4Q1TA 2CDQA 3D2MA 4JZ9A 2BTYA 3AB2A 3QUOA 1YBDA 3AAWA 4AXSA 2E9YA 2IJ9A 2OGXB 2BNDA 3TVIA 3ZZFA 2J0WA 4KZTA 3QVFA 3C20A 4NDQA 1GSJA 4NDPA 2A1FA 2R8VA 2WE4A 3LKKA 2V5HA 3T7BA 3NWYA 2BRXA 2VA1A 4JZ8A 4F6TB 4USJA 3K4YA 3ZZHA 3QVHA 3WWNA 1GS5A 2J0XA 3ZZIA 4A7XA
chains in the Genus database with same CATH topology
3L76A 3S6HA 3KZFA 2AKOA 2JI5A 2RD5A 2BNEA 4OLCA 2J5TA 3D2PA 3WWMA 3C1MA 4I49A 2V4YA 2J4LA 3K52A 3B8GA 2J4KA 3LL9A 2R98A 4NDOA 2JJXA 1OHBA 2JJ4A 2AP9A 2J5VA 4NDPB 4NDQB 2HMFA 3C1NA 2BNFA 4AB7A 2W21A 4NDRA 2BMUA 3QURA 2BUFA 2J4JA 3AB4A 4NDOB 3EK6A 3QUNA 3EK5A 1E19A 1B7BA 3K4OA 3S6GA 2X2WA 4F6TA 3S6KA 3L86A 1Z9DA 3LL5A 4NDRB 2OGXA 1OH9A 1OHAA 4A7WA 2BRIA 3D41A 4JZ7A 3K56A 3U6UA 2WE5A 3D40A 3ZZGA 2WXBA 4Q1TA 2CDQA 3D2MA 4JZ9A 2BTYA 3AB2A 3QUOA 1YBDA 3AAWA 4AXSA 2E9YA 2IJ9A 2OGXB 2BNDA 3TVIA 3ZZFA 2J0WA 4KZTA 3QVFA 3C20A 4NDQA 1GSJA 4NDPA 2A1FA 2R8VA 2WE4A 3LKKA 2V5HA 3T7BA 3NWYA 2BRXA 2VA1A 4JZ8A 4F6TB 4USJA 3K4YA 3ZZHA 3QVHA 3WWNA 1GS5A 2J0XA 3ZZIA 4A7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L76 A;  3S6H A;  3KZF A;  2AKO A;  2JI5 A;  2RD5 A;  2BNE A;  4OLC A;  2J5T A;  3D2P A;  3WWM A;  3C1M A;  4I49 A;  2V4Y A;  2J4L A;  3K52 A;  3B8G A;  2J4K A;  3LL9 A;  2R98 A;  4NDO A;  2JJX A;  1OHB A;  2JJ4 A;  2AP9 A;  2J5V A;  4NDP B;  4NDQ B;  2HMF A;  3C1N A;  2BNF A;  4AB7 A;  2W21 A;  4NDR A;  2BMU A;  3QUR A;  2BUF A;  2J4J A;  3AB4 A;  4NDO B;  3EK6 A;  3QUN A;  3EK5 A;  1E19 A;  1B7B A;  3K4O A;  3S6G A;  2X2W A;  4F6T A;  3S6K A;  3L86 A;  1Z9D A;  3LL5 A;  4NDR B;  2OGX A;  1OH9 A;  1OHA A;  4A7W A;  2BRI A;  3D41 A;  4JZ7 A;  3K56 A;  3U6U A;  2WE5 A;  3D40 A;  3ZZG A;  2WXB A;  4Q1T A;  2CDQ A;  3D2M A;  4JZ9 A;  2BTY A;  3AB2 A;  3QUO A;  1YBD A;  3AAW A;  4AXS A;  2E9Y A;  2IJ9 A;  2OGX B;  2BND A;  3TVI A;  3ZZF A;  2J0W A;  4KZT A;  3QVF A;  3C20 A;  4NDQ A;  1GSJ A;  4NDP A;  2A1F A;  2R8V A;  2WE4 A;  3LKK A;  2V5H A;  3T7B A;  3NWY A;  2BRX A;  2VA1 A;  4JZ8 A;  4F6T B;  4USJ A;  3K4Y A;  3ZZH A;  3QVH A;  3WWN A;  1GS5 A;  2J0X A;  3ZZI A;  4A7X A; 
#chains in the Genus database with same CATH topology
 3L76 A;  3S6H A;  3KZF A;  2AKO A;  2JI5 A;  2RD5 A;  2BNE A;  4OLC A;  2J5T A;  3D2P A;  3WWM A;  3C1M A;  4I49 A;  2V4Y A;  2J4L A;  3K52 A;  3B8G A;  2J4K A;  3LL9 A;  2R98 A;  4NDO A;  2JJX A;  1OHB A;  2JJ4 A;  2AP9 A;  2J5V A;  4NDP B;  4NDQ B;  2HMF A;  3C1N A;  2BNF A;  4AB7 A;  2W21 A;  4NDR A;  2BMU A;  3QUR A;  2BUF A;  2J4J A;  3AB4 A;  4NDO B;  3EK6 A;  3QUN A;  3EK5 A;  1E19 A;  1B7B A;  3K4O A;  3S6G A;  2X2W A;  4F6T A;  3S6K A;  3L86 A;  1Z9D A;  3LL5 A;  4NDR B;  2OGX A;  1OH9 A;  1OHA A;  4A7W A;  2BRI A;  3D41 A;  4JZ7 A;  3K56 A;  3U6U A;  2WE5 A;  3D40 A;  3ZZG A;  2WXB A;  4Q1T A;  2CDQ A;  3D2M A;  4JZ9 A;  2BTY A;  3AB2 A;  3QUO A;  1YBD A;  3AAW A;  4AXS A;  2E9Y A;  2IJ9 A;  2OGX B;  2BND A;  3TVI A;  3ZZF A;  2J0W A;  4KZT A;  3QVF A;  3C20 A;  4NDQ A;  1GSJ A;  4NDP A;  2A1F A;  2R8V A;  2WE4 A;  3LKK A;  2V5H A;  3T7B A;  3NWY A;  2BRX A;  2VA1 A;  4JZ8 A;  4F6T B;  4USJ A;  3K4Y A;  3ZZH A;  3QVH A;  3WWN A;  1GS5 A;  2J0X A;  3ZZI A;  4A7X A; 
#chains in the Genus database with same CATH homology
 3L76 A;  3S6H A;  3KZF A;  2AKO A;  2JI5 A;  2RD5 A;  2BNE A;  4OLC A;  2J5T A;  3D2P A;  3WWM A;  3C1M A;  4I49 A;  2V4Y A;  2J4L A;  3K52 A;  3B8G A;  2J4K A;  3LL9 A;  2R98 A;  4NDO A;  2JJX A;  1OHB A;  2JJ4 A;  2AP9 A;  2J5V A;  4NDP B;  4NDQ B;  2HMF A;  3C1N A;  2BNF A;  4AB7 A;  2W21 A;  4NDR A;  2BMU A;  3QUR A;  2BUF A;  2J4J A;  3AB4 A;  4NDO B;  3EK6 A;  3QUN A;  3EK5 A;  1E19 A;  1B7B A;  3K4O A;  3S6G A;  2X2W A;  4F6T A;  3S6K A;  3L86 A;  1Z9D A;  3LL5 A;  4NDR B;  2OGX A;  1OH9 A;  1OHA A;  4A7W A;  2BRI A;  3D41 A;  4JZ7 A;  3K56 A;  3U6U A;  2WE5 A;  3D40 A;  3ZZG A;  2WXB A;  4Q1T A;  2CDQ A;  3D2M A;  4JZ9 A;  2BTY A;  3AB2 A;  3QUO A;  1YBD A;  3AAW A;  4AXS A;  2E9Y A;  2IJ9 A;  2OGX B;  2BND A;  3TVI A;  3ZZF A;  2J0W A;  4KZT A;  3QVF A;  3C20 A;  4NDQ A;  1GSJ A;  4NDP A;  2A1F A;  2R8V A;  2WE4 A;  3LKK A;  2V5H A;  3T7B A;  3NWY A;  2BRX A;  2VA1 A;  4JZ8 A;  4F6T B;  4USJ A;  3K4Y A;  3ZZH A;  3QVH A;  3WWN A;  1GS5 A;  2J0X A;  3ZZI A;  4A7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...