2BNFA

The structure of e. coli ump kinase in complex with utp
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
237
structure length
236
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 69
structure length 236
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bnfA00
2VA1A 1GSJA 4I49A 2WE4A 1B7BA 3ZZFA 2BNDA 2CDQA 3K4YA 2E9YA 3S6HA 4NDRB 2J0WA 2BRXA 3EK5A 2HMFA 3K52A 4NDPB 3K56A 3ZZGA 3L86A 2J5VA 2JJ4A 3QURA 4NDOB 2W21A 2A1FA 3C1MA 2JJXA 2JI5A 4JZ7A 3S6GA 1OH9A 4F6TB 4OLCA 4NDOA 4F6TA 2R8VA 2J5TA 3WWNA 3LL5A 2AKOA 1YBDA 2BUFA 3AB2A 2RD5A 3L76A 2J0XA 2V5HA 3TVIA 3KZFA 4A7XA 4A7WA 3QUNA 3AAWA 2BNEA 2BTYA 1Z9DA 4AXSA 2OGXA 3AB4A 2WXBA 3EK6A 2BNFA 3D40A 4NDPA 3S6KA 3LKKA 4NDQB 1E19A 4KZTA 1OHBA 2IJ9A 2X2WA 1OHAA 2J4LA 3D2PA 2BMUA 3D2MA 2OGXB 1GS5A 3U6UA 4AB7A 4JZ8A 4NDQA 4USJA 2WE5A 3LL9A 3C1NA 2R98A 3ZZIA 3B8GA 4Q1TA 2J4JA 3QVHA 4JZ9A 3NWYA 4NDRA 3WWMA 2J4KA 3QUOA 3C20A 3ZZHA 3K4OA 3QVFA 3T7BA 2V4YA 2BRIA 3D41A 2AP9A
chains in the Genus database with same CATH superfamily
2VA1A 1GSJA 4I49A 2WE4A 1B7BA 3ZZFA 2BNDA 2CDQA 3K4YA 2E9YA 3S6HA 4NDRB 2J0WA 2BRXA 3EK5A 2HMFA 3K52A 4NDPB 3K56A 3ZZGA 3L86A 2J5VA 2JJ4A 3QURA 4NDOB 2W21A 2A1FA 3C1MA 2JJXA 2JI5A 4JZ7A 3S6GA 1OH9A 4F6TB 4OLCA 4NDOA 4F6TA 2R8VA 2J5TA 3WWNA 3LL5A 2AKOA 1YBDA 2BUFA 3AB2A 2RD5A 3L76A 2J0XA 2V5HA 3TVIA 3KZFA 4A7XA 4A7WA 3QUNA 3AAWA 2BNEA 2BTYA 1Z9DA 4AXSA 2OGXA 3AB4A 2WXBA 3EK6A 2BNFA 3D40A 4NDPA 3S6KA 3LKKA 4NDQB 1E19A 4KZTA 1OHBA 2IJ9A 2X2WA 1OHAA 2J4LA 3D2PA 2BMUA 3D2MA 2OGXB 1GS5A 3U6UA 4AB7A 4JZ8A 4NDQA 4USJA 2WE5A 3LL9A 3C1NA 2R98A 3ZZIA 3B8GA 4Q1TA 2J4JA 3QVHA 4JZ9A 3NWYA 4NDRA 3WWMA 2J4KA 3QUOA 3C20A 3ZZHA 3K4OA 3QVFA 3T7BA 2V4YA 2BRIA 3D41A 2AP9A
chains in the Genus database with same CATH topology
2VA1A 1GSJA 4I49A 2WE4A 1B7BA 3ZZFA 2BNDA 2CDQA 3K4YA 2E9YA 3S6HA 4NDRB 2J0WA 2BRXA 3EK5A 2HMFA 3K52A 4NDPB 3K56A 3ZZGA 3L86A 2J5VA 2JJ4A 3QURA 4NDOB 2W21A 2A1FA 3C1MA 2JJXA 2JI5A 4JZ7A 3S6GA 1OH9A 4F6TB 4OLCA 4NDOA 4F6TA 2R8VA 2J5TA 3WWNA 3LL5A 2AKOA 1YBDA 2BUFA 3AB2A 2RD5A 3L76A 2J0XA 2V5HA 3TVIA 3KZFA 4A7XA 4A7WA 3QUNA 3AAWA 2BNEA 2BTYA 1Z9DA 4AXSA 2OGXA 3AB4A 2WXBA 3EK6A 2BNFA 3D40A 4NDPA 3S6KA 3LKKA 4NDQB 1E19A 4KZTA 1OHBA 2IJ9A 2X2WA 1OHAA 2J4LA 3D2PA 2BMUA 3D2MA 2OGXB 1GS5A 3U6UA 4AB7A 4JZ8A 4NDQA 4USJA 2WE5A 3LL9A 3C1NA 2R98A 3ZZIA 3B8GA 4Q1TA 2J4JA 3QVHA 4JZ9A 3NWYA 4NDRA 3WWMA 2J4KA 3QUOA 3C20A 3ZZHA 3K4OA 3QVFA 3T7BA 2V4YA 2BRIA 3D41A 2AP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VA1 A;  1GSJ A;  4I49 A;  2WE4 A;  1B7B A;  3ZZF A;  2BND A;  2CDQ A;  3K4Y A;  2E9Y A;  3S6H A;  4NDR B;  2J0W A;  2BRX A;  3EK5 A;  2HMF A;  3K52 A;  4NDP B;  3K56 A;  3ZZG A;  3L86 A;  2J5V A;  2JJ4 A;  3QUR A;  4NDO B;  2W21 A;  2A1F A;  3C1M A;  2JJX A;  2JI5 A;  4JZ7 A;  3S6G A;  1OH9 A;  4F6T B;  4OLC A;  4NDO A;  4F6T A;  2R8V A;  2J5T A;  3WWN A;  3LL5 A;  2AKO A;  1YBD A;  2BUF A;  3AB2 A;  2RD5 A;  3L76 A;  2J0X A;  2V5H A;  3TVI A;  3KZF A;  4A7X A;  4A7W A;  3QUN A;  3AAW A;  2BNE A;  2BTY A;  1Z9D A;  4AXS A;  2OGX A;  3AB4 A;  2WXB A;  3EK6 A;  2BNF A;  3D40 A;  4NDP A;  3S6K A;  3LKK A;  4NDQ B;  1E19 A;  4KZT A;  1OHB A;  2IJ9 A;  2X2W A;  1OHA A;  2J4L A;  3D2P A;  2BMU A;  3D2M A;  2OGX B;  1GS5 A;  3U6U A;  4AB7 A;  4JZ8 A;  4NDQ A;  4USJ A;  2WE5 A;  3LL9 A;  3C1N A;  2R98 A;  3ZZI A;  3B8G A;  4Q1T A;  2J4J A;  3QVH A;  4JZ9 A;  3NWY A;  4NDR A;  3WWM A;  2J4K A;  3QUO A;  3C20 A;  3ZZH A;  3K4O A;  3QVF A;  3T7B A;  2V4Y A;  2BRI A;  3D41 A;  2AP9 A; 
#chains in the Genus database with same CATH topology
 2VA1 A;  1GSJ A;  4I49 A;  2WE4 A;  1B7B A;  3ZZF A;  2BND A;  2CDQ A;  3K4Y A;  2E9Y A;  3S6H A;  4NDR B;  2J0W A;  2BRX A;  3EK5 A;  2HMF A;  3K52 A;  4NDP B;  3K56 A;  3ZZG A;  3L86 A;  2J5V A;  2JJ4 A;  3QUR A;  4NDO B;  2W21 A;  2A1F A;  3C1M A;  2JJX A;  2JI5 A;  4JZ7 A;  3S6G A;  1OH9 A;  4F6T B;  4OLC A;  4NDO A;  4F6T A;  2R8V A;  2J5T A;  3WWN A;  3LL5 A;  2AKO A;  1YBD A;  2BUF A;  3AB2 A;  2RD5 A;  3L76 A;  2J0X A;  2V5H A;  3TVI A;  3KZF A;  4A7X A;  4A7W A;  3QUN A;  3AAW A;  2BNE A;  2BTY A;  1Z9D A;  4AXS A;  2OGX A;  3AB4 A;  2WXB A;  3EK6 A;  2BNF A;  3D40 A;  4NDP A;  3S6K A;  3LKK A;  4NDQ B;  1E19 A;  4KZT A;  1OHB A;  2IJ9 A;  2X2W A;  1OHA A;  2J4L A;  3D2P A;  2BMU A;  3D2M A;  2OGX B;  1GS5 A;  3U6U A;  4AB7 A;  4JZ8 A;  4NDQ A;  4USJ A;  2WE5 A;  3LL9 A;  3C1N A;  2R98 A;  3ZZI A;  3B8G A;  4Q1T A;  2J4J A;  3QVH A;  4JZ9 A;  3NWY A;  4NDR A;  3WWM A;  2J4K A;  3QUO A;  3C20 A;  3ZZH A;  3K4O A;  3QVF A;  3T7B A;  2V4Y A;  2BRI A;  3D41 A;  2AP9 A; 
#chains in the Genus database with same CATH homology
 2VA1 A;  1GSJ A;  4I49 A;  2WE4 A;  1B7B A;  3ZZF A;  2BND A;  2CDQ A;  3K4Y A;  2E9Y A;  3S6H A;  4NDR B;  2J0W A;  2BRX A;  3EK5 A;  2HMF A;  3K52 A;  4NDP B;  3K56 A;  3ZZG A;  3L86 A;  2J5V A;  2JJ4 A;  3QUR A;  4NDO B;  2W21 A;  2A1F A;  3C1M A;  2JJX A;  2JI5 A;  4JZ7 A;  3S6G A;  1OH9 A;  4F6T B;  4OLC A;  4NDO A;  4F6T A;  2R8V A;  2J5T A;  3WWN A;  3LL5 A;  2AKO A;  1YBD A;  2BUF A;  3AB2 A;  2RD5 A;  3L76 A;  2J0X A;  2V5H A;  3TVI A;  3KZF A;  4A7X A;  4A7W A;  3QUN A;  3AAW A;  2BNE A;  2BTY A;  1Z9D A;  4AXS A;  2OGX A;  3AB4 A;  2WXB A;  3EK6 A;  2BNF A;  3D40 A;  4NDP A;  3S6K A;  3LKK A;  4NDQ B;  1E19 A;  4KZT A;  1OHB A;  2IJ9 A;  2X2W A;  1OHA A;  2J4L A;  3D2P A;  2BMU A;  3D2M A;  2OGX B;  1GS5 A;  3U6U A;  4AB7 A;  4JZ8 A;  4NDQ A;  4USJ A;  2WE5 A;  3LL9 A;  3C1N A;  2R98 A;  3ZZI A;  3B8G A;  4Q1T A;  2J4J A;  3QVH A;  4JZ9 A;  3NWY A;  4NDR A;  3WWM A;  2J4K A;  3QUO A;  3C20 A;  3ZZH A;  3K4O A;  3QVF A;  3T7B A;  2V4Y A;  2BRI A;  3D41 A;  2AP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...