2BNEA

The structure of e. coli ump kinase in complex with ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
237
structure length
234
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 85
structure length 234
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bneA00
1GS5A 2J4JA 2A1FA 2WE5A 2W21A 1OH9A 2E9YA 2BNDA 4AXSA 3L86A 1YBDA 3L76A 3ZZGA 2JJXA 4F6TB 4JZ8A 1GSJA 4NDOA 2R98A 3B8GA 4I49A 2J5VA 2WXBA 2X2WA 2J4LA 2OGXB 1B7BA 3D41A 3LL5A 3S6GA 1Z9DA 4JZ9A 4OLCA 3C1NA 3AB4A 3AAWA 3C1MA 3S6HA 2V4YA 3LL9A 2JI5A 4NDQA 3QURA 4A7XA 2RD5A 4NDQB 2AKOA 4NDPA 3LKKA 3QVHA 4F6TA 1OHAA 3KZFA 4Q1TA 4NDOB 4A7WA 4AB7A 3K4OA 3T7BA 2IJ9A 4USJA 3QUOA 3QUNA 3S6KA 1OHBA 3K4YA 2BTYA 3D40A 4KZTA 2J5TA 3K52A 4NDPB 2BMUA 4JZ7A 2WE4A 3NWYA 2BNFA 2J0XA 3WWNA 1E19A 2BRIA 3EK5A 3U6UA 3EK6A 2AP9A 3QVFA 3D2PA 2CDQA 3WWMA 2OGXA 3ZZIA 3ZZHA 4NDRB 2VA1A 3AB2A 2JJ4A 2R8VA 4NDRA 3TVIA 2V5HA 3K56A 3ZZFA 2BUFA 2BNEA 3C20A 2J0WA 2HMFA 3D2MA 2J4KA 2BRXA
chains in the Genus database with same CATH superfamily
1GS5A 2J4JA 2A1FA 2WE5A 2W21A 1OH9A 2E9YA 2BNDA 4AXSA 3L86A 1YBDA 3L76A 3ZZGA 2JJXA 4F6TB 4JZ8A 1GSJA 4NDOA 2R98A 3B8GA 4I49A 2J5VA 2WXBA 2X2WA 2J4LA 2OGXB 1B7BA 3D41A 3LL5A 3S6GA 1Z9DA 4JZ9A 4OLCA 3C1NA 3AB4A 3AAWA 3C1MA 3S6HA 2V4YA 3LL9A 2JI5A 4NDQA 3QURA 4A7XA 2RD5A 4NDQB 2AKOA 4NDPA 3LKKA 3QVHA 4F6TA 1OHAA 3KZFA 4Q1TA 4NDOB 4A7WA 4AB7A 3K4OA 3T7BA 2IJ9A 4USJA 3QUOA 3QUNA 3S6KA 1OHBA 3K4YA 2BTYA 3D40A 4KZTA 2J5TA 3K52A 4NDPB 2BMUA 4JZ7A 2WE4A 3NWYA 2BNFA 2J0XA 3WWNA 1E19A 2BRIA 3EK5A 3U6UA 3EK6A 2AP9A 3QVFA 3D2PA 2CDQA 3WWMA 2OGXA 3ZZIA 3ZZHA 4NDRB 2VA1A 3AB2A 2JJ4A 2R8VA 4NDRA 3TVIA 2V5HA 3K56A 3ZZFA 2BUFA 2BNEA 3C20A 2J0WA 2HMFA 3D2MA 2J4KA 2BRXA
chains in the Genus database with same CATH topology
1GS5A 2J4JA 2A1FA 2WE5A 2W21A 1OH9A 2E9YA 2BNDA 4AXSA 3L86A 1YBDA 3L76A 3ZZGA 2JJXA 4F6TB 4JZ8A 1GSJA 4NDOA 2R98A 3B8GA 4I49A 2J5VA 2WXBA 2X2WA 2J4LA 2OGXB 1B7BA 3D41A 3LL5A 3S6GA 1Z9DA 4JZ9A 4OLCA 3C1NA 3AB4A 3AAWA 3C1MA 3S6HA 2V4YA 3LL9A 2JI5A 4NDQA 3QURA 4A7XA 2RD5A 4NDQB 2AKOA 4NDPA 3LKKA 3QVHA 4F6TA 1OHAA 3KZFA 4Q1TA 4NDOB 4A7WA 4AB7A 3K4OA 3T7BA 2IJ9A 4USJA 3QUOA 3QUNA 3S6KA 1OHBA 3K4YA 2BTYA 3D40A 4KZTA 2J5TA 3K52A 4NDPB 2BMUA 4JZ7A 2WE4A 3NWYA 2BNFA 2J0XA 3WWNA 1E19A 2BRIA 3EK5A 3U6UA 3EK6A 2AP9A 3QVFA 3D2PA 2CDQA 3WWMA 2OGXA 3ZZIA 3ZZHA 4NDRB 2VA1A 3AB2A 2JJ4A 2R8VA 4NDRA 3TVIA 2V5HA 3K56A 3ZZFA 2BUFA 2BNEA 3C20A 2J0WA 2HMFA 3D2MA 2J4KA 2BRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS5 A;  2J4J A;  2A1F A;  2WE5 A;  2W21 A;  1OH9 A;  2E9Y A;  2BND A;  4AXS A;  3L86 A;  1YBD A;  3L76 A;  3ZZG A;  2JJX A;  4F6T B;  4JZ8 A;  1GSJ A;  4NDO A;  2R98 A;  3B8G A;  4I49 A;  2J5V A;  2WXB A;  2X2W A;  2J4L A;  2OGX B;  1B7B A;  3D41 A;  3LL5 A;  3S6G A;  1Z9D A;  4JZ9 A;  4OLC A;  3C1N A;  3AB4 A;  3AAW A;  3C1M A;  3S6H A;  2V4Y A;  3LL9 A;  2JI5 A;  4NDQ A;  3QUR A;  4A7X A;  2RD5 A;  4NDQ B;  2AKO A;  4NDP A;  3LKK A;  3QVH A;  4F6T A;  1OHA A;  3KZF A;  4Q1T A;  4NDO B;  4A7W A;  4AB7 A;  3K4O A;  3T7B A;  2IJ9 A;  4USJ A;  3QUO A;  3QUN A;  3S6K A;  1OHB A;  3K4Y A;  2BTY A;  3D40 A;  4KZT A;  2J5T A;  3K52 A;  4NDP B;  2BMU A;  4JZ7 A;  2WE4 A;  3NWY A;  2BNF A;  2J0X A;  3WWN A;  1E19 A;  2BRI A;  3EK5 A;  3U6U A;  3EK6 A;  2AP9 A;  3QVF A;  3D2P A;  2CDQ A;  3WWM A;  2OGX A;  3ZZI A;  3ZZH A;  4NDR B;  2VA1 A;  3AB2 A;  2JJ4 A;  2R8V A;  4NDR A;  3TVI A;  2V5H A;  3K56 A;  3ZZF A;  2BUF A;  2BNE A;  3C20 A;  2J0W A;  2HMF A;  3D2M A;  2J4K A;  2BRX A; 
#chains in the Genus database with same CATH topology
 1GS5 A;  2J4J A;  2A1F A;  2WE5 A;  2W21 A;  1OH9 A;  2E9Y A;  2BND A;  4AXS A;  3L86 A;  1YBD A;  3L76 A;  3ZZG A;  2JJX A;  4F6T B;  4JZ8 A;  1GSJ A;  4NDO A;  2R98 A;  3B8G A;  4I49 A;  2J5V A;  2WXB A;  2X2W A;  2J4L A;  2OGX B;  1B7B A;  3D41 A;  3LL5 A;  3S6G A;  1Z9D A;  4JZ9 A;  4OLC A;  3C1N A;  3AB4 A;  3AAW A;  3C1M A;  3S6H A;  2V4Y A;  3LL9 A;  2JI5 A;  4NDQ A;  3QUR A;  4A7X A;  2RD5 A;  4NDQ B;  2AKO A;  4NDP A;  3LKK A;  3QVH A;  4F6T A;  1OHA A;  3KZF A;  4Q1T A;  4NDO B;  4A7W A;  4AB7 A;  3K4O A;  3T7B A;  2IJ9 A;  4USJ A;  3QUO A;  3QUN A;  3S6K A;  1OHB A;  3K4Y A;  2BTY A;  3D40 A;  4KZT A;  2J5T A;  3K52 A;  4NDP B;  2BMU A;  4JZ7 A;  2WE4 A;  3NWY A;  2BNF A;  2J0X A;  3WWN A;  1E19 A;  2BRI A;  3EK5 A;  3U6U A;  3EK6 A;  2AP9 A;  3QVF A;  3D2P A;  2CDQ A;  3WWM A;  2OGX A;  3ZZI A;  3ZZH A;  4NDR B;  2VA1 A;  3AB2 A;  2JJ4 A;  2R8V A;  4NDR A;  3TVI A;  2V5H A;  3K56 A;  3ZZF A;  2BUF A;  2BNE A;  3C20 A;  2J0W A;  2HMF A;  3D2M A;  2J4K A;  2BRX A; 
#chains in the Genus database with same CATH homology
 1GS5 A;  2J4J A;  2A1F A;  2WE5 A;  2W21 A;  1OH9 A;  2E9Y A;  2BND A;  4AXS A;  3L86 A;  1YBD A;  3L76 A;  3ZZG A;  2JJX A;  4F6T B;  4JZ8 A;  1GSJ A;  4NDO A;  2R98 A;  3B8G A;  4I49 A;  2J5V A;  2WXB A;  2X2W A;  2J4L A;  2OGX B;  1B7B A;  3D41 A;  3LL5 A;  3S6G A;  1Z9D A;  4JZ9 A;  4OLC A;  3C1N A;  3AB4 A;  3AAW A;  3C1M A;  3S6H A;  2V4Y A;  3LL9 A;  2JI5 A;  4NDQ A;  3QUR A;  4A7X A;  2RD5 A;  4NDQ B;  2AKO A;  4NDP A;  3LKK A;  3QVH A;  4F6T A;  1OHA A;  3KZF A;  4Q1T A;  4NDO B;  4A7W A;  4AB7 A;  3K4O A;  3T7B A;  2IJ9 A;  4USJ A;  3QUO A;  3QUN A;  3S6K A;  1OHB A;  3K4Y A;  2BTY A;  3D40 A;  4KZT A;  2J5T A;  3K52 A;  4NDP B;  2BMU A;  4JZ7 A;  2WE4 A;  3NWY A;  2BNF A;  2J0X A;  3WWN A;  1E19 A;  2BRI A;  3EK5 A;  3U6U A;  3EK6 A;  2AP9 A;  3QVF A;  3D2P A;  2CDQ A;  3WWM A;  2OGX A;  3ZZI A;  3ZZH A;  4NDR B;  2VA1 A;  3AB2 A;  2JJ4 A;  2R8V A;  4NDR A;  3TVI A;  2V5H A;  3K56 A;  3ZZF A;  2BUF A;  2BNE A;  3C20 A;  2J0W A;  2HMF A;  3D2M A;  2J4K A;  2BRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...