2BNEA

The structure of e. coli ump kinase in complex with ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
237
structure length
234
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 85
structure length 234
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bneA00
2AP9A 4F6TB 3ZZIA 3WWNA 3K52A 2JJXA 3B8GA 4AB7A 3WWMA 2J4LA 2J0WA 2E9YA 3L86A 2BUFA 2R8VA 4NDPA 3T7BA 2J5TA 3K4YA 2WXBA 2VA1A 3D40A 3C1MA 2W21A 4NDQB 4Q1TA 2J4JA 1Z9DA 3AB2A 2BTYA 3QUNA 4AXSA 4I49A 2J0XA 3TVIA 3NWYA 3D2MA 2IJ9A 3QVFA 1OHBA 2BMUA 2OGXB 2V5HA 2HMFA 4A7XA 2BNEA 3ZZFA 4F6TA 3KZFA 1E19A 4NDOB 1YBDA 1GS5A 4NDRA 2CDQA 2JI5A 3K4OA 3LL9A 2J4KA 2BRIA 3ZZGA 3S6HA 2RD5A 4JZ8A 2AKOA 3D41A 2X2WA 2V4YA 3AAWA 3LKKA 2R98A 3EK6A 2BNFA 2BNDA 3C20A 4JZ7A 3EK5A 4USJA 1OH9A 1OHAA 2BRXA 4NDPB 4A7WA 2OGXA 4OLCA 4KZTA 2J5VA 2JJ4A 4NDRB 4NDOA 3ZZHA 3QURA 3QVHA 3C1NA 2WE5A 4NDQA 3AB4A 3QUOA 1GSJA 3D2PA 3K56A 1B7BA 4JZ9A 3S6KA 2A1FA 3U6UA 3S6GA 3LL5A 3L76A 2WE4A
chains in the Genus database with same CATH superfamily
2AP9A 4F6TB 3ZZIA 3WWNA 3K52A 2JJXA 3B8GA 4AB7A 3WWMA 2J4LA 2J0WA 2E9YA 3L86A 2BUFA 2R8VA 4NDPA 3T7BA 2J5TA 3K4YA 2WXBA 2VA1A 3D40A 3C1MA 2W21A 4NDQB 4Q1TA 2J4JA 1Z9DA 3AB2A 2BTYA 3QUNA 4AXSA 4I49A 2J0XA 3TVIA 3NWYA 3D2MA 2IJ9A 3QVFA 1OHBA 2BMUA 2OGXB 2V5HA 2HMFA 4A7XA 2BNEA 3ZZFA 4F6TA 3KZFA 1E19A 4NDOB 1YBDA 1GS5A 4NDRA 2CDQA 2JI5A 3K4OA 3LL9A 2J4KA 2BRIA 3ZZGA 3S6HA 2RD5A 4JZ8A 2AKOA 3D41A 2X2WA 2V4YA 3AAWA 3LKKA 2R98A 3EK6A 2BNFA 2BNDA 3C20A 4JZ7A 3EK5A 4USJA 1OH9A 1OHAA 2BRXA 4NDPB 4A7WA 2OGXA 4OLCA 4KZTA 2J5VA 2JJ4A 4NDRB 4NDOA 3ZZHA 3QURA 3QVHA 3C1NA 2WE5A 4NDQA 3AB4A 3QUOA 1GSJA 3D2PA 3K56A 1B7BA 4JZ9A 3S6KA 2A1FA 3U6UA 3S6GA 3LL5A 3L76A 2WE4A
chains in the Genus database with same CATH topology
2AP9A 4F6TB 3ZZIA 3WWNA 3K52A 2JJXA 3B8GA 4AB7A 3WWMA 2J4LA 2J0WA 2E9YA 3L86A 2BUFA 2R8VA 4NDPA 3T7BA 2J5TA 3K4YA 2WXBA 2VA1A 3D40A 3C1MA 2W21A 4NDQB 4Q1TA 2J4JA 1Z9DA 3AB2A 2BTYA 3QUNA 4AXSA 4I49A 2J0XA 3TVIA 3NWYA 3D2MA 2IJ9A 3QVFA 1OHBA 2BMUA 2OGXB 2V5HA 2HMFA 4A7XA 2BNEA 3ZZFA 4F6TA 3KZFA 1E19A 4NDOB 1YBDA 1GS5A 4NDRA 2CDQA 2JI5A 3K4OA 3LL9A 2J4KA 2BRIA 3ZZGA 3S6HA 2RD5A 4JZ8A 2AKOA 3D41A 2X2WA 2V4YA 3AAWA 3LKKA 2R98A 3EK6A 2BNFA 2BNDA 3C20A 4JZ7A 3EK5A 4USJA 1OH9A 1OHAA 2BRXA 4NDPB 4A7WA 2OGXA 4OLCA 4KZTA 2J5VA 2JJ4A 4NDRB 4NDOA 3ZZHA 3QURA 3QVHA 3C1NA 2WE5A 4NDQA 3AB4A 3QUOA 1GSJA 3D2PA 3K56A 1B7BA 4JZ9A 3S6KA 2A1FA 3U6UA 3S6GA 3LL5A 3L76A 2WE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AP9 A;  4F6T B;  3ZZI A;  3WWN A;  3K52 A;  2JJX A;  3B8G A;  4AB7 A;  3WWM A;  2J4L A;  2J0W A;  2E9Y A;  3L86 A;  2BUF A;  2R8V A;  4NDP A;  3T7B A;  2J5T A;  3K4Y A;  2WXB A;  2VA1 A;  3D40 A;  3C1M A;  2W21 A;  4NDQ B;  4Q1T A;  2J4J A;  1Z9D A;  3AB2 A;  2BTY A;  3QUN A;  4AXS A;  4I49 A;  2J0X A;  3TVI A;  3NWY A;  3D2M A;  2IJ9 A;  3QVF A;  1OHB A;  2BMU A;  2OGX B;  2V5H A;  2HMF A;  4A7X A;  2BNE A;  3ZZF A;  4F6T A;  3KZF A;  1E19 A;  4NDO B;  1YBD A;  1GS5 A;  4NDR A;  2CDQ A;  2JI5 A;  3K4O A;  3LL9 A;  2J4K A;  2BRI A;  3ZZG A;  3S6H A;  2RD5 A;  4JZ8 A;  2AKO A;  3D41 A;  2X2W A;  2V4Y A;  3AAW A;  3LKK A;  2R98 A;  3EK6 A;  2BNF A;  2BND A;  3C20 A;  4JZ7 A;  3EK5 A;  4USJ A;  1OH9 A;  1OHA A;  2BRX A;  4NDP B;  4A7W A;  2OGX A;  4OLC A;  4KZT A;  2J5V A;  2JJ4 A;  4NDR B;  4NDO A;  3ZZH A;  3QUR A;  3QVH A;  3C1N A;  2WE5 A;  4NDQ A;  3AB4 A;  3QUO A;  1GSJ A;  3D2P A;  3K56 A;  1B7B A;  4JZ9 A;  3S6K A;  2A1F A;  3U6U A;  3S6G A;  3LL5 A;  3L76 A;  2WE4 A; 
#chains in the Genus database with same CATH topology
 2AP9 A;  4F6T B;  3ZZI A;  3WWN A;  3K52 A;  2JJX A;  3B8G A;  4AB7 A;  3WWM A;  2J4L A;  2J0W A;  2E9Y A;  3L86 A;  2BUF A;  2R8V A;  4NDP A;  3T7B A;  2J5T A;  3K4Y A;  2WXB A;  2VA1 A;  3D40 A;  3C1M A;  2W21 A;  4NDQ B;  4Q1T A;  2J4J A;  1Z9D A;  3AB2 A;  2BTY A;  3QUN A;  4AXS A;  4I49 A;  2J0X A;  3TVI A;  3NWY A;  3D2M A;  2IJ9 A;  3QVF A;  1OHB A;  2BMU A;  2OGX B;  2V5H A;  2HMF A;  4A7X A;  2BNE A;  3ZZF A;  4F6T A;  3KZF A;  1E19 A;  4NDO B;  1YBD A;  1GS5 A;  4NDR A;  2CDQ A;  2JI5 A;  3K4O A;  3LL9 A;  2J4K A;  2BRI A;  3ZZG A;  3S6H A;  2RD5 A;  4JZ8 A;  2AKO A;  3D41 A;  2X2W A;  2V4Y A;  3AAW A;  3LKK A;  2R98 A;  3EK6 A;  2BNF A;  2BND A;  3C20 A;  4JZ7 A;  3EK5 A;  4USJ A;  1OH9 A;  1OHA A;  2BRX A;  4NDP B;  4A7W A;  2OGX A;  4OLC A;  4KZT A;  2J5V A;  2JJ4 A;  4NDR B;  4NDO A;  3ZZH A;  3QUR A;  3QVH A;  3C1N A;  2WE5 A;  4NDQ A;  3AB4 A;  3QUO A;  1GSJ A;  3D2P A;  3K56 A;  1B7B A;  4JZ9 A;  3S6K A;  2A1F A;  3U6U A;  3S6G A;  3LL5 A;  3L76 A;  2WE4 A; 
#chains in the Genus database with same CATH homology
 2AP9 A;  4F6T B;  3ZZI A;  3WWN A;  3K52 A;  2JJX A;  3B8G A;  4AB7 A;  3WWM A;  2J4L A;  2J0W A;  2E9Y A;  3L86 A;  2BUF A;  2R8V A;  4NDP A;  3T7B A;  2J5T A;  3K4Y A;  2WXB A;  2VA1 A;  3D40 A;  3C1M A;  2W21 A;  4NDQ B;  4Q1T A;  2J4J A;  1Z9D A;  3AB2 A;  2BTY A;  3QUN A;  4AXS A;  4I49 A;  2J0X A;  3TVI A;  3NWY A;  3D2M A;  2IJ9 A;  3QVF A;  1OHB A;  2BMU A;  2OGX B;  2V5H A;  2HMF A;  4A7X A;  2BNE A;  3ZZF A;  4F6T A;  3KZF A;  1E19 A;  4NDO B;  1YBD A;  1GS5 A;  4NDR A;  2CDQ A;  2JI5 A;  3K4O A;  3LL9 A;  2J4K A;  2BRI A;  3ZZG A;  3S6H A;  2RD5 A;  4JZ8 A;  2AKO A;  3D41 A;  2X2W A;  2V4Y A;  3AAW A;  3LKK A;  2R98 A;  3EK6 A;  2BNF A;  2BND A;  3C20 A;  4JZ7 A;  3EK5 A;  4USJ A;  1OH9 A;  1OHA A;  2BRX A;  4NDP B;  4A7W A;  2OGX A;  4OLC A;  4KZT A;  2J5V A;  2JJ4 A;  4NDR B;  4NDO A;  3ZZH A;  3QUR A;  3QVH A;  3C1N A;  2WE5 A;  4NDQ A;  3AB4 A;  3QUO A;  1GSJ A;  3D2P A;  3K56 A;  1B7B A;  4JZ9 A;  3S6K A;  2A1F A;  3U6U A;  3S6G A;  3LL5 A;  3L76 A;  2WE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...