2BNEA

The structure of e. coli ump kinase in complex with ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
237
structure length
234
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
total genus 85
structure length 234
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bneA00
3U6UA 3WWNA 3S6KA 4Q1TA 2WE4A 2OGXB 4NDQA 2BMUA 3QUOA 2V4YA 3LKKA 2R98A 3QUNA 4NDQB 3K52A 4NDPA 2BNDA 2J4JA 1E19A 3ZZHA 2AP9A 2RD5A 1OH9A 2JJXA 3TVIA 2BRXA 3L86A 4JZ9A 3LL5A 3D2PA 4OLCA 3D41A 3C20A 1GSJA 2V5HA 1OHBA 2X2WA 3EK6A 2J4KA 3D40A 3WWMA 1YBDA 2J4LA 4JZ7A 3ZZGA 2WXBA 4NDPB 2BUFA 3ZZFA 2HMFA 4I49A 4AB7A 2JI5A 2BTYA 3D2MA 4NDRA 3KZFA 4NDOA 2AKOA 4AXSA 3AB2A 3S6HA 2VA1A 2J0XA 3L76A 3AB4A 4NDRB 2E9YA 3EK5A 3NWYA 3AAWA 1B7BA 4F6TA 3QVHA 3ZZIA 1GS5A 2A1FA 2BRIA 2IJ9A 3K4YA 3QVFA 4KZTA 2BNFA 4A7WA 4F6TB 3T7BA 3K56A 3K4OA 3B8GA 3LL9A 1OHAA 1Z9DA 2BNEA 4A7XA 4JZ8A 2J5TA 3C1NA 3QURA 2JJ4A 3S6GA 3C1MA 2WE5A 2CDQA 2W21A 4USJA 2OGXA 2R8VA 4NDOB 2J5VA 2J0WA
chains in the Genus database with same CATH superfamily
3U6UA 3WWNA 3S6KA 4Q1TA 2WE4A 2OGXB 4NDQA 2BMUA 3QUOA 2V4YA 3LKKA 2R98A 3QUNA 4NDQB 3K52A 4NDPA 2BNDA 2J4JA 1E19A 3ZZHA 2AP9A 2RD5A 1OH9A 2JJXA 3TVIA 2BRXA 3L86A 4JZ9A 3LL5A 3D2PA 4OLCA 3D41A 3C20A 1GSJA 2V5HA 1OHBA 2X2WA 3EK6A 2J4KA 3D40A 3WWMA 1YBDA 2J4LA 4JZ7A 3ZZGA 2WXBA 4NDPB 2BUFA 3ZZFA 2HMFA 4I49A 4AB7A 2JI5A 2BTYA 3D2MA 4NDRA 3KZFA 4NDOA 2AKOA 4AXSA 3AB2A 3S6HA 2VA1A 2J0XA 3L76A 3AB4A 4NDRB 2E9YA 3EK5A 3NWYA 3AAWA 1B7BA 4F6TA 3QVHA 3ZZIA 1GS5A 2A1FA 2BRIA 2IJ9A 3K4YA 3QVFA 4KZTA 2BNFA 4A7WA 4F6TB 3T7BA 3K56A 3K4OA 3B8GA 3LL9A 1OHAA 1Z9DA 2BNEA 4A7XA 4JZ8A 2J5TA 3C1NA 3QURA 2JJ4A 3S6GA 3C1MA 2WE5A 2CDQA 2W21A 4USJA 2OGXA 2R8VA 4NDOB 2J5VA 2J0WA
chains in the Genus database with same CATH topology
3U6UA 3WWNA 3S6KA 4Q1TA 2WE4A 2OGXB 4NDQA 2BMUA 3QUOA 2V4YA 3LKKA 2R98A 3QUNA 4NDQB 3K52A 4NDPA 2BNDA 2J4JA 1E19A 3ZZHA 2AP9A 2RD5A 1OH9A 2JJXA 3TVIA 2BRXA 3L86A 4JZ9A 3LL5A 3D2PA 4OLCA 3D41A 3C20A 1GSJA 2V5HA 1OHBA 2X2WA 3EK6A 2J4KA 3D40A 3WWMA 1YBDA 2J4LA 4JZ7A 3ZZGA 2WXBA 4NDPB 2BUFA 3ZZFA 2HMFA 4I49A 4AB7A 2JI5A 2BTYA 3D2MA 4NDRA 3KZFA 4NDOA 2AKOA 4AXSA 3AB2A 3S6HA 2VA1A 2J0XA 3L76A 3AB4A 4NDRB 2E9YA 3EK5A 3NWYA 3AAWA 1B7BA 4F6TA 3QVHA 3ZZIA 1GS5A 2A1FA 2BRIA 2IJ9A 3K4YA 3QVFA 4KZTA 2BNFA 4A7WA 4F6TB 3T7BA 3K56A 3K4OA 3B8GA 3LL9A 1OHAA 1Z9DA 2BNEA 4A7XA 4JZ8A 2J5TA 3C1NA 3QURA 2JJ4A 3S6GA 3C1MA 2WE5A 2CDQA 2W21A 4USJA 2OGXA 2R8VA 4NDOB 2J5VA 2J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6U A;  3WWN A;  3S6K A;  4Q1T A;  2WE4 A;  2OGX B;  4NDQ A;  2BMU A;  3QUO A;  2V4Y A;  3LKK A;  2R98 A;  3QUN A;  4NDQ B;  3K52 A;  4NDP A;  2BND A;  2J4J A;  1E19 A;  3ZZH A;  2AP9 A;  2RD5 A;  1OH9 A;  2JJX A;  3TVI A;  2BRX A;  3L86 A;  4JZ9 A;  3LL5 A;  3D2P A;  4OLC A;  3D41 A;  3C20 A;  1GSJ A;  2V5H A;  1OHB A;  2X2W A;  3EK6 A;  2J4K A;  3D40 A;  3WWM A;  1YBD A;  2J4L A;  4JZ7 A;  3ZZG A;  2WXB A;  4NDP B;  2BUF A;  3ZZF A;  2HMF A;  4I49 A;  4AB7 A;  2JI5 A;  2BTY A;  3D2M A;  4NDR A;  3KZF A;  4NDO A;  2AKO A;  4AXS A;  3AB2 A;  3S6H A;  2VA1 A;  2J0X A;  3L76 A;  3AB4 A;  4NDR B;  2E9Y A;  3EK5 A;  3NWY A;  3AAW A;  1B7B A;  4F6T A;  3QVH A;  3ZZI A;  1GS5 A;  2A1F A;  2BRI A;  2IJ9 A;  3K4Y A;  3QVF A;  4KZT A;  2BNF A;  4A7W A;  4F6T B;  3T7B A;  3K56 A;  3K4O A;  3B8G A;  3LL9 A;  1OHA A;  1Z9D A;  2BNE A;  4A7X A;  4JZ8 A;  2J5T A;  3C1N A;  3QUR A;  2JJ4 A;  3S6G A;  3C1M A;  2WE5 A;  2CDQ A;  2W21 A;  4USJ A;  2OGX A;  2R8V A;  4NDO B;  2J5V A;  2J0W A; 
#chains in the Genus database with same CATH topology
 3U6U A;  3WWN A;  3S6K A;  4Q1T A;  2WE4 A;  2OGX B;  4NDQ A;  2BMU A;  3QUO A;  2V4Y A;  3LKK A;  2R98 A;  3QUN A;  4NDQ B;  3K52 A;  4NDP A;  2BND A;  2J4J A;  1E19 A;  3ZZH A;  2AP9 A;  2RD5 A;  1OH9 A;  2JJX A;  3TVI A;  2BRX A;  3L86 A;  4JZ9 A;  3LL5 A;  3D2P A;  4OLC A;  3D41 A;  3C20 A;  1GSJ A;  2V5H A;  1OHB A;  2X2W A;  3EK6 A;  2J4K A;  3D40 A;  3WWM A;  1YBD A;  2J4L A;  4JZ7 A;  3ZZG A;  2WXB A;  4NDP B;  2BUF A;  3ZZF A;  2HMF A;  4I49 A;  4AB7 A;  2JI5 A;  2BTY A;  3D2M A;  4NDR A;  3KZF A;  4NDO A;  2AKO A;  4AXS A;  3AB2 A;  3S6H A;  2VA1 A;  2J0X A;  3L76 A;  3AB4 A;  4NDR B;  2E9Y A;  3EK5 A;  3NWY A;  3AAW A;  1B7B A;  4F6T A;  3QVH A;  3ZZI A;  1GS5 A;  2A1F A;  2BRI A;  2IJ9 A;  3K4Y A;  3QVF A;  4KZT A;  2BNF A;  4A7W A;  4F6T B;  3T7B A;  3K56 A;  3K4O A;  3B8G A;  3LL9 A;  1OHA A;  1Z9D A;  2BNE A;  4A7X A;  4JZ8 A;  2J5T A;  3C1N A;  3QUR A;  2JJ4 A;  3S6G A;  3C1M A;  2WE5 A;  2CDQ A;  2W21 A;  4USJ A;  2OGX A;  2R8V A;  4NDO B;  2J5V A;  2J0W A; 
#chains in the Genus database with same CATH homology
 3U6U A;  3WWN A;  3S6K A;  4Q1T A;  2WE4 A;  2OGX B;  4NDQ A;  2BMU A;  3QUO A;  2V4Y A;  3LKK A;  2R98 A;  3QUN A;  4NDQ B;  3K52 A;  4NDP A;  2BND A;  2J4J A;  1E19 A;  3ZZH A;  2AP9 A;  2RD5 A;  1OH9 A;  2JJX A;  3TVI A;  2BRX A;  3L86 A;  4JZ9 A;  3LL5 A;  3D2P A;  4OLC A;  3D41 A;  3C20 A;  1GSJ A;  2V5H A;  1OHB A;  2X2W A;  3EK6 A;  2J4K A;  3D40 A;  3WWM A;  1YBD A;  2J4L A;  4JZ7 A;  3ZZG A;  2WXB A;  4NDP B;  2BUF A;  3ZZF A;  2HMF A;  4I49 A;  4AB7 A;  2JI5 A;  2BTY A;  3D2M A;  4NDR A;  3KZF A;  4NDO A;  2AKO A;  4AXS A;  3AB2 A;  3S6H A;  2VA1 A;  2J0X A;  3L76 A;  3AB4 A;  4NDR B;  2E9Y A;  3EK5 A;  3NWY A;  3AAW A;  1B7B A;  4F6T A;  3QVH A;  3ZZI A;  1GS5 A;  2A1F A;  2BRI A;  2IJ9 A;  3K4Y A;  3QVF A;  4KZT A;  2BNF A;  4A7W A;  4F6T B;  3T7B A;  3K56 A;  3K4O A;  3B8G A;  3LL9 A;  1OHA A;  1Z9D A;  2BNE A;  4A7X A;  4JZ8 A;  2J5T A;  3C1N A;  3QUR A;  2JJ4 A;  3S6G A;  3C1M A;  2WE5 A;  2CDQ A;  2W21 A;  4USJ A;  2OGX A;  2R8V A;  4NDO B;  2J5V A;  2J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...