2BNEA

The structure of e. coli ump kinase in complex with ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
237
structure length
234
Chain Sequence
b'AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 85
structure length 234
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bneA00
2X2WA 3AB4A 3ZZIA 2J0WA 3LL5A 4NDOB 3K4OA 2WXBA 2HMFA 3AAWA 3L76A 3L86A 4JZ8A 3ZZFA 1E19A 4KZTA 4JZ7A 2BNEA 3QVFA 2IJ9A 3S6GA 2BNFA 4JZ9A 1OHBA 2OGXB 2RD5A 4A7WA 1OH9A 2VA1A 4NDOA 2J0XA 3D41A 2J4JA 2AP9A 3D2PA 3WWNA 1GSJA 3K52A 2J5VA 2WE5A 2V4YA 2R8VA 2J4LA 1B7BA 4NDRB 3EK5A 3EK6A 2CDQA 3S6KA 3C1MA 4NDPA 3U6UA 2A1FA 4F6TA 3D2MA 2JI5A 2R98A 3WWMA 3KZFA 4AB7A 3K4YA 1Z9DA 2JJXA 2AKOA 3T7BA 1GS5A 2J5TA 3LL9A 3D40A 2BRIA 3QURA 4OLCA 4I49A 3QUNA 4NDQB 3K56A 2BRXA 2V5HA 1OHAA 4Q1TA 2JJ4A 3NWYA 2E9YA 3AB2A 4USJA 3C20A 2OGXA 2BMUA 1YBDA 2BTYA 4AXSA 3B8GA 3LKKA 2BNDA 3QVHA 3S6HA 2BUFA 2J4KA 2WE4A 3TVIA 4NDQA 3ZZHA 4NDRA 4A7XA 3ZZGA 3QUOA 4NDPB 2W21A 3C1NA 4F6TB
chains in the Genus database with same CATH superfamily
2X2WA 3AB4A 3ZZIA 2J0WA 3LL5A 4NDOB 3K4OA 2WXBA 2HMFA 3AAWA 3L76A 3L86A 4JZ8A 3ZZFA 1E19A 4KZTA 4JZ7A 2BNEA 3QVFA 2IJ9A 3S6GA 2BNFA 4JZ9A 1OHBA 2OGXB 2RD5A 4A7WA 1OH9A 2VA1A 4NDOA 2J0XA 3D41A 2J4JA 2AP9A 3D2PA 3WWNA 1GSJA 3K52A 2J5VA 2WE5A 2V4YA 2R8VA 2J4LA 1B7BA 4NDRB 3EK5A 3EK6A 2CDQA 3S6KA 3C1MA 4NDPA 3U6UA 2A1FA 4F6TA 3D2MA 2JI5A 2R98A 3WWMA 3KZFA 4AB7A 3K4YA 1Z9DA 2JJXA 2AKOA 3T7BA 1GS5A 2J5TA 3LL9A 3D40A 2BRIA 3QURA 4OLCA 4I49A 3QUNA 4NDQB 3K56A 2BRXA 2V5HA 1OHAA 4Q1TA 2JJ4A 3NWYA 2E9YA 3AB2A 4USJA 3C20A 2OGXA 2BMUA 1YBDA 2BTYA 4AXSA 3B8GA 3LKKA 2BNDA 3QVHA 3S6HA 2BUFA 2J4KA 2WE4A 3TVIA 4NDQA 3ZZHA 4NDRA 4A7XA 3ZZGA 3QUOA 4NDPB 2W21A 3C1NA 4F6TB
chains in the Genus database with same CATH topology
2X2WA 3AB4A 3ZZIA 2J0WA 3LL5A 4NDOB 3K4OA 2WXBA 2HMFA 3AAWA 3L76A 3L86A 4JZ8A 3ZZFA 1E19A 4KZTA 4JZ7A 2BNEA 3QVFA 2IJ9A 3S6GA 2BNFA 4JZ9A 1OHBA 2OGXB 2RD5A 4A7WA 1OH9A 2VA1A 4NDOA 2J0XA 3D41A 2J4JA 2AP9A 3D2PA 3WWNA 1GSJA 3K52A 2J5VA 2WE5A 2V4YA 2R8VA 2J4LA 1B7BA 4NDRB 3EK5A 3EK6A 2CDQA 3S6KA 3C1MA 4NDPA 3U6UA 2A1FA 4F6TA 3D2MA 2JI5A 2R98A 3WWMA 3KZFA 4AB7A 3K4YA 1Z9DA 2JJXA 2AKOA 3T7BA 1GS5A 2J5TA 3LL9A 3D40A 2BRIA 3QURA 4OLCA 4I49A 3QUNA 4NDQB 3K56A 2BRXA 2V5HA 1OHAA 4Q1TA 2JJ4A 3NWYA 2E9YA 3AB2A 4USJA 3C20A 2OGXA 2BMUA 1YBDA 2BTYA 4AXSA 3B8GA 3LKKA 2BNDA 3QVHA 3S6HA 2BUFA 2J4KA 2WE4A 3TVIA 4NDQA 3ZZHA 4NDRA 4A7XA 3ZZGA 3QUOA 4NDPB 2W21A 3C1NA 4F6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2W A;  3AB4 A;  3ZZI A;  2J0W A;  3LL5 A;  4NDO B;  3K4O A;  2WXB A;  2HMF A;  3AAW A;  3L76 A;  3L86 A;  4JZ8 A;  3ZZF A;  1E19 A;  4KZT A;  4JZ7 A;  2BNE A;  3QVF A;  2IJ9 A;  3S6G A;  2BNF A;  4JZ9 A;  1OHB A;  2OGX B;  2RD5 A;  4A7W A;  1OH9 A;  2VA1 A;  4NDO A;  2J0X A;  3D41 A;  2J4J A;  2AP9 A;  3D2P A;  3WWN A;  1GSJ A;  3K52 A;  2J5V A;  2WE5 A;  2V4Y A;  2R8V A;  2J4L A;  1B7B A;  4NDR B;  3EK5 A;  3EK6 A;  2CDQ A;  3S6K A;  3C1M A;  4NDP A;  3U6U A;  2A1F A;  4F6T A;  3D2M A;  2JI5 A;  2R98 A;  3WWM A;  3KZF A;  4AB7 A;  3K4Y A;  1Z9D A;  2JJX A;  2AKO A;  3T7B A;  1GS5 A;  2J5T A;  3LL9 A;  3D40 A;  2BRI A;  3QUR A;  4OLC A;  4I49 A;  3QUN A;  4NDQ B;  3K56 A;  2BRX A;  2V5H A;  1OHA A;  4Q1T A;  2JJ4 A;  3NWY A;  2E9Y A;  3AB2 A;  4USJ A;  3C20 A;  2OGX A;  2BMU A;  1YBD A;  2BTY A;  4AXS A;  3B8G A;  3LKK A;  2BND A;  3QVH A;  3S6H A;  2BUF A;  2J4K A;  2WE4 A;  3TVI A;  4NDQ A;  3ZZH A;  4NDR A;  4A7X A;  3ZZG A;  3QUO A;  4NDP B;  2W21 A;  3C1N A;  4F6T B; 
#chains in the Genus database with same CATH topology
 2X2W A;  3AB4 A;  3ZZI A;  2J0W A;  3LL5 A;  4NDO B;  3K4O A;  2WXB A;  2HMF A;  3AAW A;  3L76 A;  3L86 A;  4JZ8 A;  3ZZF A;  1E19 A;  4KZT A;  4JZ7 A;  2BNE A;  3QVF A;  2IJ9 A;  3S6G A;  2BNF A;  4JZ9 A;  1OHB A;  2OGX B;  2RD5 A;  4A7W A;  1OH9 A;  2VA1 A;  4NDO A;  2J0X A;  3D41 A;  2J4J A;  2AP9 A;  3D2P A;  3WWN A;  1GSJ A;  3K52 A;  2J5V A;  2WE5 A;  2V4Y A;  2R8V A;  2J4L A;  1B7B A;  4NDR B;  3EK5 A;  3EK6 A;  2CDQ A;  3S6K A;  3C1M A;  4NDP A;  3U6U A;  2A1F A;  4F6T A;  3D2M A;  2JI5 A;  2R98 A;  3WWM A;  3KZF A;  4AB7 A;  3K4Y A;  1Z9D A;  2JJX A;  2AKO A;  3T7B A;  1GS5 A;  2J5T A;  3LL9 A;  3D40 A;  2BRI A;  3QUR A;  4OLC A;  4I49 A;  3QUN A;  4NDQ B;  3K56 A;  2BRX A;  2V5H A;  1OHA A;  4Q1T A;  2JJ4 A;  3NWY A;  2E9Y A;  3AB2 A;  4USJ A;  3C20 A;  2OGX A;  2BMU A;  1YBD A;  2BTY A;  4AXS A;  3B8G A;  3LKK A;  2BND A;  3QVH A;  3S6H A;  2BUF A;  2J4K A;  2WE4 A;  3TVI A;  4NDQ A;  3ZZH A;  4NDR A;  4A7X A;  3ZZG A;  3QUO A;  4NDP B;  2W21 A;  3C1N A;  4F6T B; 
#chains in the Genus database with same CATH homology
 2X2W A;  3AB4 A;  3ZZI A;  2J0W A;  3LL5 A;  4NDO B;  3K4O A;  2WXB A;  2HMF A;  3AAW A;  3L76 A;  3L86 A;  4JZ8 A;  3ZZF A;  1E19 A;  4KZT A;  4JZ7 A;  2BNE A;  3QVF A;  2IJ9 A;  3S6G A;  2BNF A;  4JZ9 A;  1OHB A;  2OGX B;  2RD5 A;  4A7W A;  1OH9 A;  2VA1 A;  4NDO A;  2J0X A;  3D41 A;  2J4J A;  2AP9 A;  3D2P A;  3WWN A;  1GSJ A;  3K52 A;  2J5V A;  2WE5 A;  2V4Y A;  2R8V A;  2J4L A;  1B7B A;  4NDR B;  3EK5 A;  3EK6 A;  2CDQ A;  3S6K A;  3C1M A;  4NDP A;  3U6U A;  2A1F A;  4F6T A;  3D2M A;  2JI5 A;  2R98 A;  3WWM A;  3KZF A;  4AB7 A;  3K4Y A;  1Z9D A;  2JJX A;  2AKO A;  3T7B A;  1GS5 A;  2J5T A;  3LL9 A;  3D40 A;  2BRI A;  3QUR A;  4OLC A;  4I49 A;  3QUN A;  4NDQ B;  3K56 A;  2BRX A;  2V5H A;  1OHA A;  4Q1T A;  2JJ4 A;  3NWY A;  2E9Y A;  3AB2 A;  4USJ A;  3C20 A;  2OGX A;  2BMU A;  1YBD A;  2BTY A;  4AXS A;  3B8G A;  3LKK A;  2BND A;  3QVH A;  3S6H A;  2BUF A;  2J4K A;  2WE4 A;  3TVI A;  4NDQ A;  3ZZH A;  4NDR A;  4A7X A;  3ZZG A;  3QUO A;  4NDP B;  2W21 A;  3C1N A;  4F6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...