2BNEA

The structure of e. coli ump kinase in complex with ump
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
237
structure length
234
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 85
structure length 234
sequence length 237
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bneA00
1OHAA 2V4YA 1OHBA 3K56A 3LKKA 3QVHA 2HMFA 4I49A 4NDRA 2W21A 4A7WA 2IJ9A 2BNDA 4NDPA 4JZ8A 3S6KA 3S6GA 2J0XA 2R98A 2J4LA 1OH9A 4A7XA 3EK6A 2CDQA 4KZTA 4NDQA 2BUFA 3K4OA 3WWMA 3AB2A 2A1FA 3ZZFA 2WXBA 4USJA 3LL9A 3B8GA 3TVIA 4AXSA 4F6TB 3NWYA 3L86A 3QUNA 3ZZGA 3S6HA 3AB4A 3L76A 3C20A 2JJXA 1B7BA 3C1MA 2J5TA 3K4YA 3EK5A 2X2WA 3K52A 1GS5A 2AP9A 3LL5A 4Q1TA 1GSJA 2BNEA 2J0WA 3QUOA 3AAWA 4NDOB 2BNFA 2OGXB 3T7BA 4NDPB 4JZ9A 3D41A 4OLCA 1YBDA 2WE4A 3QURA 3QVFA 4AB7A 3ZZHA 2V5HA 2BMUA 2JJ4A 2J4KA 3U6UA 4F6TA 4NDOA 2BRXA 2OGXA 4NDRB 2J5VA 2RD5A 3KZFA 4JZ7A 3D40A 3WWNA 4NDQB 3ZZIA 2J4JA 3D2PA 2VA1A 1Z9DA 2JI5A 2R8VA 3C1NA 2BTYA 3D2MA 1E19A 2AKOA 2BRIA 2WE5A 2E9YA
chains in the Genus database with same CATH superfamily
1OHAA 2V4YA 1OHBA 3K56A 3LKKA 3QVHA 2HMFA 4I49A 4NDRA 2W21A 4A7WA 2IJ9A 2BNDA 4NDPA 4JZ8A 3S6KA 3S6GA 2J0XA 2R98A 2J4LA 1OH9A 4A7XA 3EK6A 2CDQA 4KZTA 4NDQA 2BUFA 3K4OA 3WWMA 3AB2A 2A1FA 3ZZFA 2WXBA 4USJA 3LL9A 3B8GA 3TVIA 4AXSA 4F6TB 3NWYA 3L86A 3QUNA 3ZZGA 3S6HA 3AB4A 3L76A 3C20A 2JJXA 1B7BA 3C1MA 2J5TA 3K4YA 3EK5A 2X2WA 3K52A 1GS5A 2AP9A 3LL5A 4Q1TA 1GSJA 2BNEA 2J0WA 3QUOA 3AAWA 4NDOB 2BNFA 2OGXB 3T7BA 4NDPB 4JZ9A 3D41A 4OLCA 1YBDA 2WE4A 3QURA 3QVFA 4AB7A 3ZZHA 2V5HA 2BMUA 2JJ4A 2J4KA 3U6UA 4F6TA 4NDOA 2BRXA 2OGXA 4NDRB 2J5VA 2RD5A 3KZFA 4JZ7A 3D40A 3WWNA 4NDQB 3ZZIA 2J4JA 3D2PA 2VA1A 1Z9DA 2JI5A 2R8VA 3C1NA 2BTYA 3D2MA 1E19A 2AKOA 2BRIA 2WE5A 2E9YA
chains in the Genus database with same CATH topology
1OHAA 2V4YA 1OHBA 3K56A 3LKKA 3QVHA 2HMFA 4I49A 4NDRA 2W21A 4A7WA 2IJ9A 2BNDA 4NDPA 4JZ8A 3S6KA 3S6GA 2J0XA 2R98A 2J4LA 1OH9A 4A7XA 3EK6A 2CDQA 4KZTA 4NDQA 2BUFA 3K4OA 3WWMA 3AB2A 2A1FA 3ZZFA 2WXBA 4USJA 3LL9A 3B8GA 3TVIA 4AXSA 4F6TB 3NWYA 3L86A 3QUNA 3ZZGA 3S6HA 3AB4A 3L76A 3C20A 2JJXA 1B7BA 3C1MA 2J5TA 3K4YA 3EK5A 2X2WA 3K52A 1GS5A 2AP9A 3LL5A 4Q1TA 1GSJA 2BNEA 2J0WA 3QUOA 3AAWA 4NDOB 2BNFA 2OGXB 3T7BA 4NDPB 4JZ9A 3D41A 4OLCA 1YBDA 2WE4A 3QURA 3QVFA 4AB7A 3ZZHA 2V5HA 2BMUA 2JJ4A 2J4KA 3U6UA 4F6TA 4NDOA 2BRXA 2OGXA 4NDRB 2J5VA 2RD5A 3KZFA 4JZ7A 3D40A 3WWNA 4NDQB 3ZZIA 2J4JA 3D2PA 2VA1A 1Z9DA 2JI5A 2R8VA 3C1NA 2BTYA 3D2MA 1E19A 2AKOA 2BRIA 2WE5A 2E9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHA A;  2V4Y A;  1OHB A;  3K56 A;  3LKK A;  3QVH A;  2HMF A;  4I49 A;  4NDR A;  2W21 A;  4A7W A;  2IJ9 A;  2BND A;  4NDP A;  4JZ8 A;  3S6K A;  3S6G A;  2J0X A;  2R98 A;  2J4L A;  1OH9 A;  4A7X A;  3EK6 A;  2CDQ A;  4KZT A;  4NDQ A;  2BUF A;  3K4O A;  3WWM A;  3AB2 A;  2A1F A;  3ZZF A;  2WXB A;  4USJ A;  3LL9 A;  3B8G A;  3TVI A;  4AXS A;  4F6T B;  3NWY A;  3L86 A;  3QUN A;  3ZZG A;  3S6H A;  3AB4 A;  3L76 A;  3C20 A;  2JJX A;  1B7B A;  3C1M A;  2J5T A;  3K4Y A;  3EK5 A;  2X2W A;  3K52 A;  1GS5 A;  2AP9 A;  3LL5 A;  4Q1T A;  1GSJ A;  2BNE A;  2J0W A;  3QUO A;  3AAW A;  4NDO B;  2BNF A;  2OGX B;  3T7B A;  4NDP B;  4JZ9 A;  3D41 A;  4OLC A;  1YBD A;  2WE4 A;  3QUR A;  3QVF A;  4AB7 A;  3ZZH A;  2V5H A;  2BMU A;  2JJ4 A;  2J4K A;  3U6U A;  4F6T A;  4NDO A;  2BRX A;  2OGX A;  4NDR B;  2J5V A;  2RD5 A;  3KZF A;  4JZ7 A;  3D40 A;  3WWN A;  4NDQ B;  3ZZI A;  2J4J A;  3D2P A;  2VA1 A;  1Z9D A;  2JI5 A;  2R8V A;  3C1N A;  2BTY A;  3D2M A;  1E19 A;  2AKO A;  2BRI A;  2WE5 A;  2E9Y A; 
#chains in the Genus database with same CATH topology
 1OHA A;  2V4Y A;  1OHB A;  3K56 A;  3LKK A;  3QVH A;  2HMF A;  4I49 A;  4NDR A;  2W21 A;  4A7W A;  2IJ9 A;  2BND A;  4NDP A;  4JZ8 A;  3S6K A;  3S6G A;  2J0X A;  2R98 A;  2J4L A;  1OH9 A;  4A7X A;  3EK6 A;  2CDQ A;  4KZT A;  4NDQ A;  2BUF A;  3K4O A;  3WWM A;  3AB2 A;  2A1F A;  3ZZF A;  2WXB A;  4USJ A;  3LL9 A;  3B8G A;  3TVI A;  4AXS A;  4F6T B;  3NWY A;  3L86 A;  3QUN A;  3ZZG A;  3S6H A;  3AB4 A;  3L76 A;  3C20 A;  2JJX A;  1B7B A;  3C1M A;  2J5T A;  3K4Y A;  3EK5 A;  2X2W A;  3K52 A;  1GS5 A;  2AP9 A;  3LL5 A;  4Q1T A;  1GSJ A;  2BNE A;  2J0W A;  3QUO A;  3AAW A;  4NDO B;  2BNF A;  2OGX B;  3T7B A;  4NDP B;  4JZ9 A;  3D41 A;  4OLC A;  1YBD A;  2WE4 A;  3QUR A;  3QVF A;  4AB7 A;  3ZZH A;  2V5H A;  2BMU A;  2JJ4 A;  2J4K A;  3U6U A;  4F6T A;  4NDO A;  2BRX A;  2OGX A;  4NDR B;  2J5V A;  2RD5 A;  3KZF A;  4JZ7 A;  3D40 A;  3WWN A;  4NDQ B;  3ZZI A;  2J4J A;  3D2P A;  2VA1 A;  1Z9D A;  2JI5 A;  2R8V A;  3C1N A;  2BTY A;  3D2M A;  1E19 A;  2AKO A;  2BRI A;  2WE5 A;  2E9Y A; 
#chains in the Genus database with same CATH homology
 1OHA A;  2V4Y A;  1OHB A;  3K56 A;  3LKK A;  3QVH A;  2HMF A;  4I49 A;  4NDR A;  2W21 A;  4A7W A;  2IJ9 A;  2BND A;  4NDP A;  4JZ8 A;  3S6K A;  3S6G A;  2J0X A;  2R98 A;  2J4L A;  1OH9 A;  4A7X A;  3EK6 A;  2CDQ A;  4KZT A;  4NDQ A;  2BUF A;  3K4O A;  3WWM A;  3AB2 A;  2A1F A;  3ZZF A;  2WXB A;  4USJ A;  3LL9 A;  3B8G A;  3TVI A;  4AXS A;  4F6T B;  3NWY A;  3L86 A;  3QUN A;  3ZZG A;  3S6H A;  3AB4 A;  3L76 A;  3C20 A;  2JJX A;  1B7B A;  3C1M A;  2J5T A;  3K4Y A;  3EK5 A;  2X2W A;  3K52 A;  1GS5 A;  2AP9 A;  3LL5 A;  4Q1T A;  1GSJ A;  2BNE A;  2J0W A;  3QUO A;  3AAW A;  4NDO B;  2BNF A;  2OGX B;  3T7B A;  4NDP B;  4JZ9 A;  3D41 A;  4OLC A;  1YBD A;  2WE4 A;  3QUR A;  3QVF A;  4AB7 A;  3ZZH A;  2V5H A;  2BMU A;  2JJ4 A;  2J4K A;  3U6U A;  4F6T A;  4NDO A;  2BRX A;  2OGX A;  4NDR B;  2J5V A;  2RD5 A;  3KZF A;  4JZ7 A;  3D40 A;  3WWN A;  4NDQ B;  3ZZI A;  2J4J A;  3D2P A;  2VA1 A;  1Z9D A;  2JI5 A;  2R8V A;  3C1N A;  2BTY A;  3D2M A;  1E19 A;  2AKO A;  2BRI A;  2WE5 A;  2E9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...