4F6TB

The crystal structure of the molybdenum storage protein (mosto) from azotobacter vinelandii loaded with various polyoxometalates
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nature's Polyoxometalate Chemistry: X-ray Structure of the Mo Storage Protein Loaded with Discrete Polynuclear Mo-O Clusters.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
total genus 90
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4f6tB00
4AXSA 2WXBA 3K56A 3ZZFA 3EK6A 2R8VA 2RD5A 2X2WA 1B7BA 4F6TB 3NWYA 3C1NA 4OLCA 1GSJA 3B8GA 2OGXA 3C20A 3QUOA 1YBDA 3AAWA 3LL5A 2BNDA 3ZZHA 4NDQB 4AB7A 2BRIA 4NDRA 4A7WA 2WE4A 1GS5A 2IJ9A 2AKOA 4NDPA 3EK5A 2BNEA 2AP9A 2J0XA 1OH9A 2BUFA 3KZFA 2OGXB 1Z9DA 2J4LA 2BMUA 2BRXA 2BTYA 3K52A 2V4YA 2W21A 1OHBA 4NDOA 2R98A 3K4YA 4NDRB 2WE5A 3LKKA 2A1FA 4I49A 3QVHA 3AB2A 4NDPB 3C1MA 3ZZGA 3L86A 4JZ9A 2J4KA 4KZTA 1E19A 2HMFA 3S6KA 2VA1A 3QVFA 3D40A 3D2MA 2JJ4A 4NDOB 3D41A 2J0WA 3TVIA 2CDQA 2J4JA 3LL9A 3S6GA 4USJA 3U6UA 3WWMA 2JJXA 3QURA 4JZ7A 1OHAA 3T7BA 3S6HA 4F6TA 3WWNA 2BNFA 2E9YA 4JZ8A 4Q1TA 4A7XA 2J5TA 3ZZIA 3QUNA 2JI5A 4NDQA 2V5HA 3L76A 3K4OA 3D2PA 3AB4A 2J5VA
chains in the Genus database with same CATH superfamily
4AXSA 2WXBA 3K56A 3ZZFA 3EK6A 2R8VA 2RD5A 2X2WA 1B7BA 4F6TB 3NWYA 3C1NA 4OLCA 1GSJA 3B8GA 2OGXA 3C20A 3QUOA 1YBDA 3AAWA 3LL5A 2BNDA 3ZZHA 4NDQB 4AB7A 2BRIA 4NDRA 4A7WA 2WE4A 1GS5A 2IJ9A 2AKOA 4NDPA 3EK5A 2BNEA 2AP9A 2J0XA 1OH9A 2BUFA 3KZFA 2OGXB 1Z9DA 2J4LA 2BMUA 2BRXA 2BTYA 3K52A 2V4YA 2W21A 1OHBA 4NDOA 2R98A 3K4YA 4NDRB 2WE5A 3LKKA 2A1FA 4I49A 3QVHA 3AB2A 4NDPB 3C1MA 3ZZGA 3L86A 4JZ9A 2J4KA 4KZTA 1E19A 2HMFA 3S6KA 2VA1A 3QVFA 3D40A 3D2MA 2JJ4A 4NDOB 3D41A 2J0WA 3TVIA 2CDQA 2J4JA 3LL9A 3S6GA 4USJA 3U6UA 3WWMA 2JJXA 3QURA 4JZ7A 1OHAA 3T7BA 3S6HA 4F6TA 3WWNA 2BNFA 2E9YA 4JZ8A 4Q1TA 4A7XA 2J5TA 3ZZIA 3QUNA 2JI5A 4NDQA 2V5HA 3L76A 3K4OA 3D2PA 3AB4A 2J5VA
chains in the Genus database with same CATH topology
4AXSA 2WXBA 3K56A 3ZZFA 3EK6A 2R8VA 2RD5A 2X2WA 1B7BA 4F6TB 3NWYA 3C1NA 4OLCA 1GSJA 3B8GA 2OGXA 3C20A 3QUOA 1YBDA 3AAWA 3LL5A 2BNDA 3ZZHA 4NDQB 4AB7A 2BRIA 4NDRA 4A7WA 2WE4A 1GS5A 2IJ9A 2AKOA 4NDPA 3EK5A 2BNEA 2AP9A 2J0XA 1OH9A 2BUFA 3KZFA 2OGXB 1Z9DA 2J4LA 2BMUA 2BRXA 2BTYA 3K52A 2V4YA 2W21A 1OHBA 4NDOA 2R98A 3K4YA 4NDRB 2WE5A 3LKKA 2A1FA 4I49A 3QVHA 3AB2A 4NDPB 3C1MA 3ZZGA 3L86A 4JZ9A 2J4KA 4KZTA 1E19A 2HMFA 3S6KA 2VA1A 3QVFA 3D40A 3D2MA 2JJ4A 4NDOB 3D41A 2J0WA 3TVIA 2CDQA 2J4JA 3LL9A 3S6GA 4USJA 3U6UA 3WWMA 2JJXA 3QURA 4JZ7A 1OHAA 3T7BA 3S6HA 4F6TA 3WWNA 2BNFA 2E9YA 4JZ8A 4Q1TA 4A7XA 2J5TA 3ZZIA 3QUNA 2JI5A 4NDQA 2V5HA 3L76A 3K4OA 3D2PA 3AB4A 2J5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXS A;  2WXB A;  3K56 A;  3ZZF A;  3EK6 A;  2R8V A;  2RD5 A;  2X2W A;  1B7B A;  4F6T B;  3NWY A;  3C1N A;  4OLC A;  1GSJ A;  3B8G A;  2OGX A;  3C20 A;  3QUO A;  1YBD A;  3AAW A;  3LL5 A;  2BND A;  3ZZH A;  4NDQ B;  4AB7 A;  2BRI A;  4NDR A;  4A7W A;  2WE4 A;  1GS5 A;  2IJ9 A;  2AKO A;  4NDP A;  3EK5 A;  2BNE A;  2AP9 A;  2J0X A;  1OH9 A;  2BUF A;  3KZF A;  2OGX B;  1Z9D A;  2J4L A;  2BMU A;  2BRX A;  2BTY A;  3K52 A;  2V4Y A;  2W21 A;  1OHB A;  4NDO A;  2R98 A;  3K4Y A;  4NDR B;  2WE5 A;  3LKK A;  2A1F A;  4I49 A;  3QVH A;  3AB2 A;  4NDP B;  3C1M A;  3ZZG A;  3L86 A;  4JZ9 A;  2J4K A;  4KZT A;  1E19 A;  2HMF A;  3S6K A;  2VA1 A;  3QVF A;  3D40 A;  3D2M A;  2JJ4 A;  4NDO B;  3D41 A;  2J0W A;  3TVI A;  2CDQ A;  2J4J A;  3LL9 A;  3S6G A;  4USJ A;  3U6U A;  3WWM A;  2JJX A;  3QUR A;  4JZ7 A;  1OHA A;  3T7B A;  3S6H A;  4F6T A;  3WWN A;  2BNF A;  2E9Y A;  4JZ8 A;  4Q1T A;  4A7X A;  2J5T A;  3ZZI A;  3QUN A;  2JI5 A;  4NDQ A;  2V5H A;  3L76 A;  3K4O A;  3D2P A;  3AB4 A;  2J5V A; 
#chains in the Genus database with same CATH topology
 4AXS A;  2WXB A;  3K56 A;  3ZZF A;  3EK6 A;  2R8V A;  2RD5 A;  2X2W A;  1B7B A;  4F6T B;  3NWY A;  3C1N A;  4OLC A;  1GSJ A;  3B8G A;  2OGX A;  3C20 A;  3QUO A;  1YBD A;  3AAW A;  3LL5 A;  2BND A;  3ZZH A;  4NDQ B;  4AB7 A;  2BRI A;  4NDR A;  4A7W A;  2WE4 A;  1GS5 A;  2IJ9 A;  2AKO A;  4NDP A;  3EK5 A;  2BNE A;  2AP9 A;  2J0X A;  1OH9 A;  2BUF A;  3KZF A;  2OGX B;  1Z9D A;  2J4L A;  2BMU A;  2BRX A;  2BTY A;  3K52 A;  2V4Y A;  2W21 A;  1OHB A;  4NDO A;  2R98 A;  3K4Y A;  4NDR B;  2WE5 A;  3LKK A;  2A1F A;  4I49 A;  3QVH A;  3AB2 A;  4NDP B;  3C1M A;  3ZZG A;  3L86 A;  4JZ9 A;  2J4K A;  4KZT A;  1E19 A;  2HMF A;  3S6K A;  2VA1 A;  3QVF A;  3D40 A;  3D2M A;  2JJ4 A;  4NDO B;  3D41 A;  2J0W A;  3TVI A;  2CDQ A;  2J4J A;  3LL9 A;  3S6G A;  4USJ A;  3U6U A;  3WWM A;  2JJX A;  3QUR A;  4JZ7 A;  1OHA A;  3T7B A;  3S6H A;  4F6T A;  3WWN A;  2BNF A;  2E9Y A;  4JZ8 A;  4Q1T A;  4A7X A;  2J5T A;  3ZZI A;  3QUN A;  2JI5 A;  4NDQ A;  2V5H A;  3L76 A;  3K4O A;  3D2P A;  3AB4 A;  2J5V A; 
#chains in the Genus database with same CATH homology
 4AXS A;  2WXB A;  3K56 A;  3ZZF A;  3EK6 A;  2R8V A;  2RD5 A;  2X2W A;  1B7B A;  4F6T B;  3NWY A;  3C1N A;  4OLC A;  1GSJ A;  3B8G A;  2OGX A;  3C20 A;  3QUO A;  1YBD A;  3AAW A;  3LL5 A;  2BND A;  3ZZH A;  4NDQ B;  4AB7 A;  2BRI A;  4NDR A;  4A7W A;  2WE4 A;  1GS5 A;  2IJ9 A;  2AKO A;  4NDP A;  3EK5 A;  2BNE A;  2AP9 A;  2J0X A;  1OH9 A;  2BUF A;  3KZF A;  2OGX B;  1Z9D A;  2J4L A;  2BMU A;  2BRX A;  2BTY A;  3K52 A;  2V4Y A;  2W21 A;  1OHB A;  4NDO A;  2R98 A;  3K4Y A;  4NDR B;  2WE5 A;  3LKK A;  2A1F A;  4I49 A;  3QVH A;  3AB2 A;  4NDP B;  3C1M A;  3ZZG A;  3L86 A;  4JZ9 A;  2J4K A;  4KZT A;  1E19 A;  2HMF A;  3S6K A;  2VA1 A;  3QVF A;  3D40 A;  3D2M A;  2JJ4 A;  4NDO B;  3D41 A;  2J0W A;  3TVI A;  2CDQ A;  2J4J A;  3LL9 A;  3S6G A;  4USJ A;  3U6U A;  3WWM A;  2JJX A;  3QUR A;  4JZ7 A;  1OHA A;  3T7B A;  3S6H A;  4F6T A;  3WWN A;  2BNF A;  2E9Y A;  4JZ8 A;  4Q1T A;  4A7X A;  2J5T A;  3ZZI A;  3QUN A;  2JI5 A;  4NDQ A;  2V5H A;  3L76 A;  3K4O A;  3D2P A;  3AB4 A;  2J5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...