4F6TB

The crystal structure of the molybdenum storage protein (mosto) from azotobacter vinelandii loaded with various polyoxometalates
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Molybdenum storage protein subunit beta
publication title Nature's Polyoxometalate Chemistry: X-ray Structure of the Mo Storage Protein Loaded with Discrete Polynuclear Mo-O Clusters.
pubmed doi rcsb
total genus 90
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4f6tB00
4NDRB 3C1MA 2R8VA 2V4YA 4KZTA 3QVHA 2CDQA 4F6TB 3D40A 3S6HA 3AB4A 3LL9A 4NDRA 2E9YA 3K56A 3S6GA 3K52A 4NDOB 3AB2A 4JZ8A 2BNDA 3ZZIA 2BRXA 4F6TA 4Q1TA 3ZZGA 1OH9A 2VA1A 1GS5A 1B7BA 3NWYA 3QVFA 2V5HA 4NDPB 3EK5A 2W21A 2J5TA 2A1FA 4AB7A 3LL5A 2J4JA 4NDOA 3B8GA 3WWMA 4A7XA 1OHAA 2BMUA 2OGXB 3D2PA 2AP9A 4NDPA 3C20A 3K4YA 2WE4A 3D41A 3AAWA 2IJ9A 2WE5A 4OLCA 3U6UA 2BNFA 2AKOA 2OGXA 4I49A 2J0WA 3KZFA 1E19A 1YBDA 3ZZHA 4NDQB 3QUOA 4AXSA 2J0XA 2RD5A 3WWNA 3QUNA 4JZ7A 2BTYA 2JJ4A 2HMFA 2WXBA 4JZ9A 3L76A 3EK6A 4NDQA 3ZZFA 2J4KA 1GSJA 3S6KA 3QURA 2JI5A 4USJA 4A7WA 2J5VA 1Z9DA 3TVIA 2BRIA 2X2WA 1OHBA 2BNEA 2JJXA 2R98A 3LKKA 2J4LA 3C1NA 3K4OA 3L86A 3T7BA 2BUFA 3D2MA
chains in the Genus database with same CATH superfamily
4NDRB 3C1MA 2R8VA 2V4YA 4KZTA 3QVHA 2CDQA 4F6TB 3D40A 3S6HA 3AB4A 3LL9A 4NDRA 2E9YA 3K56A 3S6GA 3K52A 4NDOB 3AB2A 4JZ8A 2BNDA 3ZZIA 2BRXA 4F6TA 4Q1TA 3ZZGA 1OH9A 2VA1A 1GS5A 1B7BA 3NWYA 3QVFA 2V5HA 4NDPB 3EK5A 2W21A 2J5TA 2A1FA 4AB7A 3LL5A 2J4JA 4NDOA 3B8GA 3WWMA 4A7XA 1OHAA 2BMUA 2OGXB 3D2PA 2AP9A 4NDPA 3C20A 3K4YA 2WE4A 3D41A 3AAWA 2IJ9A 2WE5A 4OLCA 3U6UA 2BNFA 2AKOA 2OGXA 4I49A 2J0WA 3KZFA 1E19A 1YBDA 3ZZHA 4NDQB 3QUOA 4AXSA 2J0XA 2RD5A 3WWNA 3QUNA 4JZ7A 2BTYA 2JJ4A 2HMFA 2WXBA 4JZ9A 3L76A 3EK6A 4NDQA 3ZZFA 2J4KA 1GSJA 3S6KA 3QURA 2JI5A 4USJA 4A7WA 2J5VA 1Z9DA 3TVIA 2BRIA 2X2WA 1OHBA 2BNEA 2JJXA 2R98A 3LKKA 2J4LA 3C1NA 3K4OA 3L86A 3T7BA 2BUFA 3D2MA
chains in the Genus database with same CATH topology
4NDRB 3C1MA 2R8VA 2V4YA 4KZTA 3QVHA 2CDQA 4F6TB 3D40A 3S6HA 3AB4A 3LL9A 4NDRA 2E9YA 3K56A 3S6GA 3K52A 4NDOB 3AB2A 4JZ8A 2BNDA 3ZZIA 2BRXA 4F6TA 4Q1TA 3ZZGA 1OH9A 2VA1A 1GS5A 1B7BA 3NWYA 3QVFA 2V5HA 4NDPB 3EK5A 2W21A 2J5TA 2A1FA 4AB7A 3LL5A 2J4JA 4NDOA 3B8GA 3WWMA 4A7XA 1OHAA 2BMUA 2OGXB 3D2PA 2AP9A 4NDPA 3C20A 3K4YA 2WE4A 3D41A 3AAWA 2IJ9A 2WE5A 4OLCA 3U6UA 2BNFA 2AKOA 2OGXA 4I49A 2J0WA 3KZFA 1E19A 1YBDA 3ZZHA 4NDQB 3QUOA 4AXSA 2J0XA 2RD5A 3WWNA 3QUNA 4JZ7A 2BTYA 2JJ4A 2HMFA 2WXBA 4JZ9A 3L76A 3EK6A 4NDQA 3ZZFA 2J4KA 1GSJA 3S6KA 3QURA 2JI5A 4USJA 4A7WA 2J5VA 1Z9DA 3TVIA 2BRIA 2X2WA 1OHBA 2BNEA 2JJXA 2R98A 3LKKA 2J4LA 3C1NA 3K4OA 3L86A 3T7BA 2BUFA 3D2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDR B;  3C1M A;  2R8V A;  2V4Y A;  4KZT A;  3QVH A;  2CDQ A;  4F6T B;  3D40 A;  3S6H A;  3AB4 A;  3LL9 A;  4NDR A;  2E9Y A;  3K56 A;  3S6G A;  3K52 A;  4NDO B;  3AB2 A;  4JZ8 A;  2BND A;  3ZZI A;  2BRX A;  4F6T A;  4Q1T A;  3ZZG A;  1OH9 A;  2VA1 A;  1GS5 A;  1B7B A;  3NWY A;  3QVF A;  2V5H A;  4NDP B;  3EK5 A;  2W21 A;  2J5T A;  2A1F A;  4AB7 A;  3LL5 A;  2J4J A;  4NDO A;  3B8G A;  3WWM A;  4A7X A;  1OHA A;  2BMU A;  2OGX B;  3D2P A;  2AP9 A;  4NDP A;  3C20 A;  3K4Y A;  2WE4 A;  3D41 A;  3AAW A;  2IJ9 A;  2WE5 A;  4OLC A;  3U6U A;  2BNF A;  2AKO A;  2OGX A;  4I49 A;  2J0W A;  3KZF A;  1E19 A;  1YBD A;  3ZZH A;  4NDQ B;  3QUO A;  4AXS A;  2J0X A;  2RD5 A;  3WWN A;  3QUN A;  4JZ7 A;  2BTY A;  2JJ4 A;  2HMF A;  2WXB A;  4JZ9 A;  3L76 A;  3EK6 A;  4NDQ A;  3ZZF A;  2J4K A;  1GSJ A;  3S6K A;  3QUR A;  2JI5 A;  4USJ A;  4A7W A;  2J5V A;  1Z9D A;  3TVI A;  2BRI A;  2X2W A;  1OHB A;  2BNE A;  2JJX A;  2R98 A;  3LKK A;  2J4L A;  3C1N A;  3K4O A;  3L86 A;  3T7B A;  2BUF A;  3D2M A; 
#chains in the Genus database with same CATH topology
 4NDR B;  3C1M A;  2R8V A;  2V4Y A;  4KZT A;  3QVH A;  2CDQ A;  4F6T B;  3D40 A;  3S6H A;  3AB4 A;  3LL9 A;  4NDR A;  2E9Y A;  3K56 A;  3S6G A;  3K52 A;  4NDO B;  3AB2 A;  4JZ8 A;  2BND A;  3ZZI A;  2BRX A;  4F6T A;  4Q1T A;  3ZZG A;  1OH9 A;  2VA1 A;  1GS5 A;  1B7B A;  3NWY A;  3QVF A;  2V5H A;  4NDP B;  3EK5 A;  2W21 A;  2J5T A;  2A1F A;  4AB7 A;  3LL5 A;  2J4J A;  4NDO A;  3B8G A;  3WWM A;  4A7X A;  1OHA A;  2BMU A;  2OGX B;  3D2P A;  2AP9 A;  4NDP A;  3C20 A;  3K4Y A;  2WE4 A;  3D41 A;  3AAW A;  2IJ9 A;  2WE5 A;  4OLC A;  3U6U A;  2BNF A;  2AKO A;  2OGX A;  4I49 A;  2J0W A;  3KZF A;  1E19 A;  1YBD A;  3ZZH A;  4NDQ B;  3QUO A;  4AXS A;  2J0X A;  2RD5 A;  3WWN A;  3QUN A;  4JZ7 A;  2BTY A;  2JJ4 A;  2HMF A;  2WXB A;  4JZ9 A;  3L76 A;  3EK6 A;  4NDQ A;  3ZZF A;  2J4K A;  1GSJ A;  3S6K A;  3QUR A;  2JI5 A;  4USJ A;  4A7W A;  2J5V A;  1Z9D A;  3TVI A;  2BRI A;  2X2W A;  1OHB A;  2BNE A;  2JJX A;  2R98 A;  3LKK A;  2J4L A;  3C1N A;  3K4O A;  3L86 A;  3T7B A;  2BUF A;  3D2M A; 
#chains in the Genus database with same CATH homology
 4NDR B;  3C1M A;  2R8V A;  2V4Y A;  4KZT A;  3QVH A;  2CDQ A;  4F6T B;  3D40 A;  3S6H A;  3AB4 A;  3LL9 A;  4NDR A;  2E9Y A;  3K56 A;  3S6G A;  3K52 A;  4NDO B;  3AB2 A;  4JZ8 A;  2BND A;  3ZZI A;  2BRX A;  4F6T A;  4Q1T A;  3ZZG A;  1OH9 A;  2VA1 A;  1GS5 A;  1B7B A;  3NWY A;  3QVF A;  2V5H A;  4NDP B;  3EK5 A;  2W21 A;  2J5T A;  2A1F A;  4AB7 A;  3LL5 A;  2J4J A;  4NDO A;  3B8G A;  3WWM A;  4A7X A;  1OHA A;  2BMU A;  2OGX B;  3D2P A;  2AP9 A;  4NDP A;  3C20 A;  3K4Y A;  2WE4 A;  3D41 A;  3AAW A;  2IJ9 A;  2WE5 A;  4OLC A;  3U6U A;  2BNF A;  2AKO A;  2OGX A;  4I49 A;  2J0W A;  3KZF A;  1E19 A;  1YBD A;  3ZZH A;  4NDQ B;  3QUO A;  4AXS A;  2J0X A;  2RD5 A;  3WWN A;  3QUN A;  4JZ7 A;  2BTY A;  2JJ4 A;  2HMF A;  2WXB A;  4JZ9 A;  3L76 A;  3EK6 A;  4NDQ A;  3ZZF A;  2J4K A;  1GSJ A;  3S6K A;  3QUR A;  2JI5 A;  4USJ A;  4A7W A;  2J5V A;  1Z9D A;  3TVI A;  2BRI A;  2X2W A;  1OHB A;  2BNE A;  2JJX A;  2R98 A;  3LKK A;  2J4L A;  3C1N A;  3K4O A;  3L86 A;  3T7B A;  2BUF A;  3D2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...