4F6TB

The crystal structure of the molybdenum storage protein (mosto) from azotobacter vinelandii loaded with various polyoxometalates
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
b'NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Nature's Polyoxometalate Chemistry: X-ray Structure of the Mo Storage Protein Loaded with Discrete Polynuclear Mo-O Clusters.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 90
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4f6tB00
4AXSA 2AKOA 3K4OA 3NWYA 3LKKA 3K4YA 4NDPA 4NDRA 2J5TA 3QVHA 4NDPB 4NDRB 2WE5A 2R8VA 2WXBA 3T7BA 2J4LA 4KZTA 2BRIA 2A1FA 3K52A 3ZZHA 3AAWA 2HMFA 2X2WA 2V5HA 2BNFA 3AB2A 3L86A 3LL9A 2J0XA 3WWMA 2BRXA 2BNEA 1GS5A 2RD5A 4NDOB 2W21A 2E9YA 2J4KA 1B7BA 4A7XA 3ZZIA 2J4JA 2R98A 3B8GA 2J5VA 4USJA 3QUOA 2OGXB 3K56A 3D2MA 3QUNA 4A7WA 3QVFA 4JZ7A 3C20A 3ZZGA 2WE4A 3EK5A 3KZFA 4NDQB 3U6UA 2BNDA 4NDOA 4F6TA 3WWNA 2AP9A 4JZ8A 2J0WA 2IJ9A 4F6TB 2BTYA 4JZ9A 2CDQA 2BMUA 2JI5A 3ZZFA 4AB7A 1OHAA 3S6GA 2OGXA 1OH9A 3TVIA 3D40A 1E19A 2BUFA 3QURA 2V4YA 4NDQA 3LL5A 4I49A 1GSJA 1OHBA 3S6HA 3C1MA 3EK6A 4OLCA 2VA1A 4Q1TA 3D2PA 3D41A 3S6KA 3C1NA 1YBDA 3L76A 2JJXA 3AB4A 2JJ4A 1Z9DA
chains in the Genus database with same CATH superfamily
4AXSA 2AKOA 3K4OA 3NWYA 3LKKA 3K4YA 4NDPA 4NDRA 2J5TA 3QVHA 4NDPB 4NDRB 2WE5A 2R8VA 2WXBA 3T7BA 2J4LA 4KZTA 2BRIA 2A1FA 3K52A 3ZZHA 3AAWA 2HMFA 2X2WA 2V5HA 2BNFA 3AB2A 3L86A 3LL9A 2J0XA 3WWMA 2BRXA 2BNEA 1GS5A 2RD5A 4NDOB 2W21A 2E9YA 2J4KA 1B7BA 4A7XA 3ZZIA 2J4JA 2R98A 3B8GA 2J5VA 4USJA 3QUOA 2OGXB 3K56A 3D2MA 3QUNA 4A7WA 3QVFA 4JZ7A 3C20A 3ZZGA 2WE4A 3EK5A 3KZFA 4NDQB 3U6UA 2BNDA 4NDOA 4F6TA 3WWNA 2AP9A 4JZ8A 2J0WA 2IJ9A 4F6TB 2BTYA 4JZ9A 2CDQA 2BMUA 2JI5A 3ZZFA 4AB7A 1OHAA 3S6GA 2OGXA 1OH9A 3TVIA 3D40A 1E19A 2BUFA 3QURA 2V4YA 4NDQA 3LL5A 4I49A 1GSJA 1OHBA 3S6HA 3C1MA 3EK6A 4OLCA 2VA1A 4Q1TA 3D2PA 3D41A 3S6KA 3C1NA 1YBDA 3L76A 2JJXA 3AB4A 2JJ4A 1Z9DA
chains in the Genus database with same CATH topology
4AXSA 2AKOA 3K4OA 3NWYA 3LKKA 3K4YA 4NDPA 4NDRA 2J5TA 3QVHA 4NDPB 4NDRB 2WE5A 2R8VA 2WXBA 3T7BA 2J4LA 4KZTA 2BRIA 2A1FA 3K52A 3ZZHA 3AAWA 2HMFA 2X2WA 2V5HA 2BNFA 3AB2A 3L86A 3LL9A 2J0XA 3WWMA 2BRXA 2BNEA 1GS5A 2RD5A 4NDOB 2W21A 2E9YA 2J4KA 1B7BA 4A7XA 3ZZIA 2J4JA 2R98A 3B8GA 2J5VA 4USJA 3QUOA 2OGXB 3K56A 3D2MA 3QUNA 4A7WA 3QVFA 4JZ7A 3C20A 3ZZGA 2WE4A 3EK5A 3KZFA 4NDQB 3U6UA 2BNDA 4NDOA 4F6TA 3WWNA 2AP9A 4JZ8A 2J0WA 2IJ9A 4F6TB 2BTYA 4JZ9A 2CDQA 2BMUA 2JI5A 3ZZFA 4AB7A 1OHAA 3S6GA 2OGXA 1OH9A 3TVIA 3D40A 1E19A 2BUFA 3QURA 2V4YA 4NDQA 3LL5A 4I49A 1GSJA 1OHBA 3S6HA 3C1MA 3EK6A 4OLCA 2VA1A 4Q1TA 3D2PA 3D41A 3S6KA 3C1NA 1YBDA 3L76A 2JJXA 3AB4A 2JJ4A 1Z9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AXS A;  2AKO A;  3K4O A;  3NWY A;  3LKK A;  3K4Y A;  4NDP A;  4NDR A;  2J5T A;  3QVH A;  4NDP B;  4NDR B;  2WE5 A;  2R8V A;  2WXB A;  3T7B A;  2J4L A;  4KZT A;  2BRI A;  2A1F A;  3K52 A;  3ZZH A;  3AAW A;  2HMF A;  2X2W A;  2V5H A;  2BNF A;  3AB2 A;  3L86 A;  3LL9 A;  2J0X A;  3WWM A;  2BRX A;  2BNE A;  1GS5 A;  2RD5 A;  4NDO B;  2W21 A;  2E9Y A;  2J4K A;  1B7B A;  4A7X A;  3ZZI A;  2J4J A;  2R98 A;  3B8G A;  2J5V A;  4USJ A;  3QUO A;  2OGX B;  3K56 A;  3D2M A;  3QUN A;  4A7W A;  3QVF A;  4JZ7 A;  3C20 A;  3ZZG A;  2WE4 A;  3EK5 A;  3KZF A;  4NDQ B;  3U6U A;  2BND A;  4NDO A;  4F6T A;  3WWN A;  2AP9 A;  4JZ8 A;  2J0W A;  2IJ9 A;  4F6T B;  2BTY A;  4JZ9 A;  2CDQ A;  2BMU A;  2JI5 A;  3ZZF A;  4AB7 A;  1OHA A;  3S6G A;  2OGX A;  1OH9 A;  3TVI A;  3D40 A;  1E19 A;  2BUF A;  3QUR A;  2V4Y A;  4NDQ A;  3LL5 A;  4I49 A;  1GSJ A;  1OHB A;  3S6H A;  3C1M A;  3EK6 A;  4OLC A;  2VA1 A;  4Q1T A;  3D2P A;  3D41 A;  3S6K A;  3C1N A;  1YBD A;  3L76 A;  2JJX A;  3AB4 A;  2JJ4 A;  1Z9D A; 
#chains in the Genus database with same CATH topology
 4AXS A;  2AKO A;  3K4O A;  3NWY A;  3LKK A;  3K4Y A;  4NDP A;  4NDR A;  2J5T A;  3QVH A;  4NDP B;  4NDR B;  2WE5 A;  2R8V A;  2WXB A;  3T7B A;  2J4L A;  4KZT A;  2BRI A;  2A1F A;  3K52 A;  3ZZH A;  3AAW A;  2HMF A;  2X2W A;  2V5H A;  2BNF A;  3AB2 A;  3L86 A;  3LL9 A;  2J0X A;  3WWM A;  2BRX A;  2BNE A;  1GS5 A;  2RD5 A;  4NDO B;  2W21 A;  2E9Y A;  2J4K A;  1B7B A;  4A7X A;  3ZZI A;  2J4J A;  2R98 A;  3B8G A;  2J5V A;  4USJ A;  3QUO A;  2OGX B;  3K56 A;  3D2M A;  3QUN A;  4A7W A;  3QVF A;  4JZ7 A;  3C20 A;  3ZZG A;  2WE4 A;  3EK5 A;  3KZF A;  4NDQ B;  3U6U A;  2BND A;  4NDO A;  4F6T A;  3WWN A;  2AP9 A;  4JZ8 A;  2J0W A;  2IJ9 A;  4F6T B;  2BTY A;  4JZ9 A;  2CDQ A;  2BMU A;  2JI5 A;  3ZZF A;  4AB7 A;  1OHA A;  3S6G A;  2OGX A;  1OH9 A;  3TVI A;  3D40 A;  1E19 A;  2BUF A;  3QUR A;  2V4Y A;  4NDQ A;  3LL5 A;  4I49 A;  1GSJ A;  1OHB A;  3S6H A;  3C1M A;  3EK6 A;  4OLC A;  2VA1 A;  4Q1T A;  3D2P A;  3D41 A;  3S6K A;  3C1N A;  1YBD A;  3L76 A;  2JJX A;  3AB4 A;  2JJ4 A;  1Z9D A; 
#chains in the Genus database with same CATH homology
 4AXS A;  2AKO A;  3K4O A;  3NWY A;  3LKK A;  3K4Y A;  4NDP A;  4NDR A;  2J5T A;  3QVH A;  4NDP B;  4NDR B;  2WE5 A;  2R8V A;  2WXB A;  3T7B A;  2J4L A;  4KZT A;  2BRI A;  2A1F A;  3K52 A;  3ZZH A;  3AAW A;  2HMF A;  2X2W A;  2V5H A;  2BNF A;  3AB2 A;  3L86 A;  3LL9 A;  2J0X A;  3WWM A;  2BRX A;  2BNE A;  1GS5 A;  2RD5 A;  4NDO B;  2W21 A;  2E9Y A;  2J4K A;  1B7B A;  4A7X A;  3ZZI A;  2J4J A;  2R98 A;  3B8G A;  2J5V A;  4USJ A;  3QUO A;  2OGX B;  3K56 A;  3D2M A;  3QUN A;  4A7W A;  3QVF A;  4JZ7 A;  3C20 A;  3ZZG A;  2WE4 A;  3EK5 A;  3KZF A;  4NDQ B;  3U6U A;  2BND A;  4NDO A;  4F6T A;  3WWN A;  2AP9 A;  4JZ8 A;  2J0W A;  2IJ9 A;  4F6T B;  2BTY A;  4JZ9 A;  2CDQ A;  2BMU A;  2JI5 A;  3ZZF A;  4AB7 A;  1OHA A;  3S6G A;  2OGX A;  1OH9 A;  3TVI A;  3D40 A;  1E19 A;  2BUF A;  3QUR A;  2V4Y A;  4NDQ A;  3LL5 A;  4I49 A;  1GSJ A;  1OHB A;  3S6H A;  3C1M A;  3EK6 A;  4OLC A;  2VA1 A;  4Q1T A;  3D2P A;  3D41 A;  3S6K A;  3C1N A;  1YBD A;  3L76 A;  2JJX A;  3AB4 A;  2JJ4 A;  1Z9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...