4F6TB

The crystal structure of the molybdenum storage protein (mosto) from azotobacter vinelandii loaded with various polyoxometalates
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
268
structure length
268
Chain Sequence
NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRGRAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQLGSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPYKLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTSKDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPGNLTRALAGEHVGTIITAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum storage protein subunit beta
publication title Nature's Polyoxometalate Chemistry: X-ray Structure of the Mo Storage Protein Loaded with Discrete Polynuclear Mo-O Clusters.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 90
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4f6tB00
3S6KA 1GSJA 3WWNA 2WE5A 3WWMA 2J4KA 3ZZHA 2BNEA 1OHBA 2BNFA 4JZ9A 3K56A 4AB7A 2CDQA 2HMFA 1GS5A 1E19A 3QURA 2BNDA 2J4LA 2IJ9A 2A1FA 3EK5A 3C1NA 2BRIA 2J0XA 3LL9A 4NDRA 2BTYA 4A7XA 2AKOA 2JJXA 2OGXA 2AP9A 2BMUA 3QUOA 3S6HA 4F6TA 3QVFA 2BRXA 3NWYA 4NDOA 1Z9DA 3K4OA 3D41A 4NDPB 1B7BA 4NDQB 3L76A 4AXSA 2E9YA 1YBDA 3QVHA 2JI5A 3C20A 4Q1TA 3AB4A 1OH9A 3LL5A 3KZFA 3ZZFA 3TVIA 4I49A 2WXBA 4NDRB 3ZZIA 3C1MA 2BUFA 4A7WA 3EK6A 2W21A 4KZTA 3U6UA 4USJA 3D2MA 4OLCA 2J4JA 3QUNA 3ZZGA 2J5VA 3K52A 4NDPA 2X2WA 3K4YA 3B8GA 2V4YA 4JZ8A 4NDQA 2OGXB 2J5TA 3D40A 3L86A 3LKKA 2J0WA 2JJ4A 3D2PA 4JZ7A 4F6TB 2R8VA 3T7BA 4NDOB 2V5HA 2VA1A 3AB2A 1OHAA 2R98A 3AAWA 3S6GA 2RD5A 2WE4A
chains in the Genus database with same CATH superfamily
3S6KA 1GSJA 3WWNA 2WE5A 3WWMA 2J4KA 3ZZHA 2BNEA 1OHBA 2BNFA 4JZ9A 3K56A 4AB7A 2CDQA 2HMFA 1GS5A 1E19A 3QURA 2BNDA 2J4LA 2IJ9A 2A1FA 3EK5A 3C1NA 2BRIA 2J0XA 3LL9A 4NDRA 2BTYA 4A7XA 2AKOA 2JJXA 2OGXA 2AP9A 2BMUA 3QUOA 3S6HA 4F6TA 3QVFA 2BRXA 3NWYA 4NDOA 1Z9DA 3K4OA 3D41A 4NDPB 1B7BA 4NDQB 3L76A 4AXSA 2E9YA 1YBDA 3QVHA 2JI5A 3C20A 4Q1TA 3AB4A 1OH9A 3LL5A 3KZFA 3ZZFA 3TVIA 4I49A 2WXBA 4NDRB 3ZZIA 3C1MA 2BUFA 4A7WA 3EK6A 2W21A 4KZTA 3U6UA 4USJA 3D2MA 4OLCA 2J4JA 3QUNA 3ZZGA 2J5VA 3K52A 4NDPA 2X2WA 3K4YA 3B8GA 2V4YA 4JZ8A 4NDQA 2OGXB 2J5TA 3D40A 3L86A 3LKKA 2J0WA 2JJ4A 3D2PA 4JZ7A 4F6TB 2R8VA 3T7BA 4NDOB 2V5HA 2VA1A 3AB2A 1OHAA 2R98A 3AAWA 3S6GA 2RD5A 2WE4A
chains in the Genus database with same CATH topology
3S6KA 1GSJA 3WWNA 2WE5A 3WWMA 2J4KA 3ZZHA 2BNEA 1OHBA 2BNFA 4JZ9A 3K56A 4AB7A 2CDQA 2HMFA 1GS5A 1E19A 3QURA 2BNDA 2J4LA 2IJ9A 2A1FA 3EK5A 3C1NA 2BRIA 2J0XA 3LL9A 4NDRA 2BTYA 4A7XA 2AKOA 2JJXA 2OGXA 2AP9A 2BMUA 3QUOA 3S6HA 4F6TA 3QVFA 2BRXA 3NWYA 4NDOA 1Z9DA 3K4OA 3D41A 4NDPB 1B7BA 4NDQB 3L76A 4AXSA 2E9YA 1YBDA 3QVHA 2JI5A 3C20A 4Q1TA 3AB4A 1OH9A 3LL5A 3KZFA 3ZZFA 3TVIA 4I49A 2WXBA 4NDRB 3ZZIA 3C1MA 2BUFA 4A7WA 3EK6A 2W21A 4KZTA 3U6UA 4USJA 3D2MA 4OLCA 2J4JA 3QUNA 3ZZGA 2J5VA 3K52A 4NDPA 2X2WA 3K4YA 3B8GA 2V4YA 4JZ8A 4NDQA 2OGXB 2J5TA 3D40A 3L86A 3LKKA 2J0WA 2JJ4A 3D2PA 4JZ7A 4F6TB 2R8VA 3T7BA 4NDOB 2V5HA 2VA1A 3AB2A 1OHAA 2R98A 3AAWA 3S6GA 2RD5A 2WE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6K A;  1GSJ A;  3WWN A;  2WE5 A;  3WWM A;  2J4K A;  3ZZH A;  2BNE A;  1OHB A;  2BNF A;  4JZ9 A;  3K56 A;  4AB7 A;  2CDQ A;  2HMF A;  1GS5 A;  1E19 A;  3QUR A;  2BND A;  2J4L A;  2IJ9 A;  2A1F A;  3EK5 A;  3C1N A;  2BRI A;  2J0X A;  3LL9 A;  4NDR A;  2BTY A;  4A7X A;  2AKO A;  2JJX A;  2OGX A;  2AP9 A;  2BMU A;  3QUO A;  3S6H A;  4F6T A;  3QVF A;  2BRX A;  3NWY A;  4NDO A;  1Z9D A;  3K4O A;  3D41 A;  4NDP B;  1B7B A;  4NDQ B;  3L76 A;  4AXS A;  2E9Y A;  1YBD A;  3QVH A;  2JI5 A;  3C20 A;  4Q1T A;  3AB4 A;  1OH9 A;  3LL5 A;  3KZF A;  3ZZF A;  3TVI A;  4I49 A;  2WXB A;  4NDR B;  3ZZI A;  3C1M A;  2BUF A;  4A7W A;  3EK6 A;  2W21 A;  4KZT A;  3U6U A;  4USJ A;  3D2M A;  4OLC A;  2J4J A;  3QUN A;  3ZZG A;  2J5V A;  3K52 A;  4NDP A;  2X2W A;  3K4Y A;  3B8G A;  2V4Y A;  4JZ8 A;  4NDQ A;  2OGX B;  2J5T A;  3D40 A;  3L86 A;  3LKK A;  2J0W A;  2JJ4 A;  3D2P A;  4JZ7 A;  4F6T B;  2R8V A;  3T7B A;  4NDO B;  2V5H A;  2VA1 A;  3AB2 A;  1OHA A;  2R98 A;  3AAW A;  3S6G A;  2RD5 A;  2WE4 A; 
#chains in the Genus database with same CATH topology
 3S6K A;  1GSJ A;  3WWN A;  2WE5 A;  3WWM A;  2J4K A;  3ZZH A;  2BNE A;  1OHB A;  2BNF A;  4JZ9 A;  3K56 A;  4AB7 A;  2CDQ A;  2HMF A;  1GS5 A;  1E19 A;  3QUR A;  2BND A;  2J4L A;  2IJ9 A;  2A1F A;  3EK5 A;  3C1N A;  2BRI A;  2J0X A;  3LL9 A;  4NDR A;  2BTY A;  4A7X A;  2AKO A;  2JJX A;  2OGX A;  2AP9 A;  2BMU A;  3QUO A;  3S6H A;  4F6T A;  3QVF A;  2BRX A;  3NWY A;  4NDO A;  1Z9D A;  3K4O A;  3D41 A;  4NDP B;  1B7B A;  4NDQ B;  3L76 A;  4AXS A;  2E9Y A;  1YBD A;  3QVH A;  2JI5 A;  3C20 A;  4Q1T A;  3AB4 A;  1OH9 A;  3LL5 A;  3KZF A;  3ZZF A;  3TVI A;  4I49 A;  2WXB A;  4NDR B;  3ZZI A;  3C1M A;  2BUF A;  4A7W A;  3EK6 A;  2W21 A;  4KZT A;  3U6U A;  4USJ A;  3D2M A;  4OLC A;  2J4J A;  3QUN A;  3ZZG A;  2J5V A;  3K52 A;  4NDP A;  2X2W A;  3K4Y A;  3B8G A;  2V4Y A;  4JZ8 A;  4NDQ A;  2OGX B;  2J5T A;  3D40 A;  3L86 A;  3LKK A;  2J0W A;  2JJ4 A;  3D2P A;  4JZ7 A;  4F6T B;  2R8V A;  3T7B A;  4NDO B;  2V5H A;  2VA1 A;  3AB2 A;  1OHA A;  2R98 A;  3AAW A;  3S6G A;  2RD5 A;  2WE4 A; 
#chains in the Genus database with same CATH homology
 3S6K A;  1GSJ A;  3WWN A;  2WE5 A;  3WWM A;  2J4K A;  3ZZH A;  2BNE A;  1OHB A;  2BNF A;  4JZ9 A;  3K56 A;  4AB7 A;  2CDQ A;  2HMF A;  1GS5 A;  1E19 A;  3QUR A;  2BND A;  2J4L A;  2IJ9 A;  2A1F A;  3EK5 A;  3C1N A;  2BRI A;  2J0X A;  3LL9 A;  4NDR A;  2BTY A;  4A7X A;  2AKO A;  2JJX A;  2OGX A;  2AP9 A;  2BMU A;  3QUO A;  3S6H A;  4F6T A;  3QVF A;  2BRX A;  3NWY A;  4NDO A;  1Z9D A;  3K4O A;  3D41 A;  4NDP B;  1B7B A;  4NDQ B;  3L76 A;  4AXS A;  2E9Y A;  1YBD A;  3QVH A;  2JI5 A;  3C20 A;  4Q1T A;  3AB4 A;  1OH9 A;  3LL5 A;  3KZF A;  3ZZF A;  3TVI A;  4I49 A;  2WXB A;  4NDR B;  3ZZI A;  3C1M A;  2BUF A;  4A7W A;  3EK6 A;  2W21 A;  4KZT A;  3U6U A;  4USJ A;  3D2M A;  4OLC A;  2J4J A;  3QUN A;  3ZZG A;  2J5V A;  3K52 A;  4NDP A;  2X2W A;  3K4Y A;  3B8G A;  2V4Y A;  4JZ8 A;  4NDQ A;  2OGX B;  2J5T A;  3D40 A;  3L86 A;  3LKK A;  2J0W A;  2JJ4 A;  3D2P A;  4JZ7 A;  4F6T B;  2R8V A;  3T7B A;  4NDO B;  2V5H A;  2VA1 A;  3AB2 A;  1OHA A;  2R98 A;  3AAW A;  3S6G A;  2RD5 A;  2WE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...