2A1FA

Crystal structure of uridylate kinase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
232
Chain Sequence
LSQPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVIFSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLYKNLSYAEVIDKELKVMDLSAFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGTTICEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridylate kinase
publication title Crystal Structure of Uridylate kinase
rcsb
source organism Haemophilus influenzae
total genus 82
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2a1fA00
4NDPB 2OGXA 4KZTA 2J4KA 3QVFA 3QUNA 1Z9DA 2J0WA 1E19A 3EK6A 2BUFA 2AP9A 2BTYA 3C20A 4NDOB 4F6TA 2J4LA 4NDQB 2AKOA 2J5TA 3C1NA 2A1FA 3LL5A 3AB4A 2OGXB 2WE5A 3K56A 4A7WA 3D41A 3QVHA 2R8VA 2BRIA 4JZ8A 3D2MA 3B8GA 3NWYA 2HMFA 4JZ7A 1GS5A 1YBDA 3S6KA 2BNEA 2WE4A 4USJA 3WWNA 2X2WA 3AB2A 3ZZHA 4NDPA 3QURA 4NDRA 1OHAA 3QUOA 2RD5A 2W21A 2VA1A 1GSJA 3WWMA 2R98A 2JJXA 4OLCA 2BNFA 3D40A 4F6TB 4NDOA 3AAWA 2BNDA 2JI5A 2V5HA 4I49A 2J4JA 2CDQA 2IJ9A 3K4OA 3KZFA 3L86A 3K52A 2V4YA 4NDRB 2J5VA 3C1MA 3EK5A 2BMUA 2BRXA 4AXSA 1B7BA 2WXBA 4Q1TA 2E9YA 3S6GA 3K4YA 4AB7A 1OHBA 4JZ9A 2JJ4A 3ZZGA 3LL9A 3ZZFA 3T7BA 3LKKA 2J0XA 3ZZIA 4NDQA 3TVIA 3L76A 3U6UA 3D2PA 1OH9A 3S6HA 4A7XA
chains in the Genus database with same CATH superfamily
4NDPB 2OGXA 4KZTA 2J4KA 3QVFA 3QUNA 1Z9DA 2J0WA 1E19A 3EK6A 2BUFA 2AP9A 2BTYA 3C20A 4NDOB 4F6TA 2J4LA 4NDQB 2AKOA 2J5TA 3C1NA 2A1FA 3LL5A 3AB4A 2OGXB 2WE5A 3K56A 4A7WA 3D41A 3QVHA 2R8VA 2BRIA 4JZ8A 3D2MA 3B8GA 3NWYA 2HMFA 4JZ7A 1GS5A 1YBDA 3S6KA 2BNEA 2WE4A 4USJA 3WWNA 2X2WA 3AB2A 3ZZHA 4NDPA 3QURA 4NDRA 1OHAA 3QUOA 2RD5A 2W21A 2VA1A 1GSJA 3WWMA 2R98A 2JJXA 4OLCA 2BNFA 3D40A 4F6TB 4NDOA 3AAWA 2BNDA 2JI5A 2V5HA 4I49A 2J4JA 2CDQA 2IJ9A 3K4OA 3KZFA 3L86A 3K52A 2V4YA 4NDRB 2J5VA 3C1MA 3EK5A 2BMUA 2BRXA 4AXSA 1B7BA 2WXBA 4Q1TA 2E9YA 3S6GA 3K4YA 4AB7A 1OHBA 4JZ9A 2JJ4A 3ZZGA 3LL9A 3ZZFA 3T7BA 3LKKA 2J0XA 3ZZIA 4NDQA 3TVIA 3L76A 3U6UA 3D2PA 1OH9A 3S6HA 4A7XA
chains in the Genus database with same CATH topology
4NDPB 2OGXA 4KZTA 2J4KA 3QVFA 3QUNA 1Z9DA 2J0WA 1E19A 3EK6A 2BUFA 2AP9A 2BTYA 3C20A 4NDOB 4F6TA 2J4LA 4NDQB 2AKOA 2J5TA 3C1NA 2A1FA 3LL5A 3AB4A 2OGXB 2WE5A 3K56A 4A7WA 3D41A 3QVHA 2R8VA 2BRIA 4JZ8A 3D2MA 3B8GA 3NWYA 2HMFA 4JZ7A 1GS5A 1YBDA 3S6KA 2BNEA 2WE4A 4USJA 3WWNA 2X2WA 3AB2A 3ZZHA 4NDPA 3QURA 4NDRA 1OHAA 3QUOA 2RD5A 2W21A 2VA1A 1GSJA 3WWMA 2R98A 2JJXA 4OLCA 2BNFA 3D40A 4F6TB 4NDOA 3AAWA 2BNDA 2JI5A 2V5HA 4I49A 2J4JA 2CDQA 2IJ9A 3K4OA 3KZFA 3L86A 3K52A 2V4YA 4NDRB 2J5VA 3C1MA 3EK5A 2BMUA 2BRXA 4AXSA 1B7BA 2WXBA 4Q1TA 2E9YA 3S6GA 3K4YA 4AB7A 1OHBA 4JZ9A 2JJ4A 3ZZGA 3LL9A 3ZZFA 3T7BA 3LKKA 2J0XA 3ZZIA 4NDQA 3TVIA 3L76A 3U6UA 3D2PA 1OH9A 3S6HA 4A7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDP B;  2OGX A;  4KZT A;  2J4K A;  3QVF A;  3QUN A;  1Z9D A;  2J0W A;  1E19 A;  3EK6 A;  2BUF A;  2AP9 A;  2BTY A;  3C20 A;  4NDO B;  4F6T A;  2J4L A;  4NDQ B;  2AKO A;  2J5T A;  3C1N A;  2A1F A;  3LL5 A;  3AB4 A;  2OGX B;  2WE5 A;  3K56 A;  4A7W A;  3D41 A;  3QVH A;  2R8V A;  2BRI A;  4JZ8 A;  3D2M A;  3B8G A;  3NWY A;  2HMF A;  4JZ7 A;  1GS5 A;  1YBD A;  3S6K A;  2BNE A;  2WE4 A;  4USJ A;  3WWN A;  2X2W A;  3AB2 A;  3ZZH A;  4NDP A;  3QUR A;  4NDR A;  1OHA A;  3QUO A;  2RD5 A;  2W21 A;  2VA1 A;  1GSJ A;  3WWM A;  2R98 A;  2JJX A;  4OLC A;  2BNF A;  3D40 A;  4F6T B;  4NDO A;  3AAW A;  2BND A;  2JI5 A;  2V5H A;  4I49 A;  2J4J A;  2CDQ A;  2IJ9 A;  3K4O A;  3KZF A;  3L86 A;  3K52 A;  2V4Y A;  4NDR B;  2J5V A;  3C1M A;  3EK5 A;  2BMU A;  2BRX A;  4AXS A;  1B7B A;  2WXB A;  4Q1T A;  2E9Y A;  3S6G A;  3K4Y A;  4AB7 A;  1OHB A;  4JZ9 A;  2JJ4 A;  3ZZG A;  3LL9 A;  3ZZF A;  3T7B A;  3LKK A;  2J0X A;  3ZZI A;  4NDQ A;  3TVI A;  3L76 A;  3U6U A;  3D2P A;  1OH9 A;  3S6H A;  4A7X A; 
#chains in the Genus database with same CATH topology
 4NDP B;  2OGX A;  4KZT A;  2J4K A;  3QVF A;  3QUN A;  1Z9D A;  2J0W A;  1E19 A;  3EK6 A;  2BUF A;  2AP9 A;  2BTY A;  3C20 A;  4NDO B;  4F6T A;  2J4L A;  4NDQ B;  2AKO A;  2J5T A;  3C1N A;  2A1F A;  3LL5 A;  3AB4 A;  2OGX B;  2WE5 A;  3K56 A;  4A7W A;  3D41 A;  3QVH A;  2R8V A;  2BRI A;  4JZ8 A;  3D2M A;  3B8G A;  3NWY A;  2HMF A;  4JZ7 A;  1GS5 A;  1YBD A;  3S6K A;  2BNE A;  2WE4 A;  4USJ A;  3WWN A;  2X2W A;  3AB2 A;  3ZZH A;  4NDP A;  3QUR A;  4NDR A;  1OHA A;  3QUO A;  2RD5 A;  2W21 A;  2VA1 A;  1GSJ A;  3WWM A;  2R98 A;  2JJX A;  4OLC A;  2BNF A;  3D40 A;  4F6T B;  4NDO A;  3AAW A;  2BND A;  2JI5 A;  2V5H A;  4I49 A;  2J4J A;  2CDQ A;  2IJ9 A;  3K4O A;  3KZF A;  3L86 A;  3K52 A;  2V4Y A;  4NDR B;  2J5V A;  3C1M A;  3EK5 A;  2BMU A;  2BRX A;  4AXS A;  1B7B A;  2WXB A;  4Q1T A;  2E9Y A;  3S6G A;  3K4Y A;  4AB7 A;  1OHB A;  4JZ9 A;  2JJ4 A;  3ZZG A;  3LL9 A;  3ZZF A;  3T7B A;  3LKK A;  2J0X A;  3ZZI A;  4NDQ A;  3TVI A;  3L76 A;  3U6U A;  3D2P A;  1OH9 A;  3S6H A;  4A7X A; 
#chains in the Genus database with same CATH homology
 4NDP B;  2OGX A;  4KZT A;  2J4K A;  3QVF A;  3QUN A;  1Z9D A;  2J0W A;  1E19 A;  3EK6 A;  2BUF A;  2AP9 A;  2BTY A;  3C20 A;  4NDO B;  4F6T A;  2J4L A;  4NDQ B;  2AKO A;  2J5T A;  3C1N A;  2A1F A;  3LL5 A;  3AB4 A;  2OGX B;  2WE5 A;  3K56 A;  4A7W A;  3D41 A;  3QVH A;  2R8V A;  2BRI A;  4JZ8 A;  3D2M A;  3B8G A;  3NWY A;  2HMF A;  4JZ7 A;  1GS5 A;  1YBD A;  3S6K A;  2BNE A;  2WE4 A;  4USJ A;  3WWN A;  2X2W A;  3AB2 A;  3ZZH A;  4NDP A;  3QUR A;  4NDR A;  1OHA A;  3QUO A;  2RD5 A;  2W21 A;  2VA1 A;  1GSJ A;  3WWM A;  2R98 A;  2JJX A;  4OLC A;  2BNF A;  3D40 A;  4F6T B;  4NDO A;  3AAW A;  2BND A;  2JI5 A;  2V5H A;  4I49 A;  2J4J A;  2CDQ A;  2IJ9 A;  3K4O A;  3KZF A;  3L86 A;  3K52 A;  2V4Y A;  4NDR B;  2J5V A;  3C1M A;  3EK5 A;  2BMU A;  2BRX A;  4AXS A;  1B7B A;  2WXB A;  4Q1T A;  2E9Y A;  3S6G A;  3K4Y A;  4AB7 A;  1OHB A;  4JZ9 A;  2JJ4 A;  3ZZG A;  3LL9 A;  3ZZF A;  3T7B A;  3LKK A;  2J0X A;  3ZZI A;  4NDQ A;  3TVI A;  3L76 A;  3U6U A;  3D2P A;  1OH9 A;  3S6H A;  4A7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...