2A1FA

Crystal structure of uridylate kinase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
232
Chain Sequence
LSQPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVIFSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLYKNLSYAEVIDKELKVMDLSAFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGTTICEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate kinase
publication title Crystal Structure of Uridylate kinase
rcsb
source organism Haemophilus influenzae
molecule tags Transferase
total genus 82
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2a1fA00
3S6GA 3QURA 4NDPB 4NDQA 2VA1A 3T7BA 2J4LA 2J5TA 2CDQA 2AKOA 2J5VA 4NDOB 4Q1TA 3LL5A 2JJ4A 2X2WA 1OH9A 1E19A 4USJA 3QUOA 3TVIA 3QVHA 2W21A 3U6UA 4JZ8A 4NDRB 3AB2A 2V4YA 2J0WA 3LKKA 3AB4A 4KZTA 3EK6A 3D2PA 2J4KA 2R8VA 1GS5A 3ZZGA 4F6TB 3ZZFA 1GSJA 4JZ7A 4NDPA 2JI5A 4AB7A 2A1FA 3B8GA 2AP9A 3ZZHA 2BRXA 4F6TA 2OGXB 2BRIA 3K4OA 3AAWA 4NDOA 1Z9DA 2BNDA 2BUFA 4AXSA 3QVFA 2BTYA 2JJXA 1YBDA 3KZFA 3K56A 1B7BA 2J0XA 3EK5A 2WXBA 4A7WA 1OHAA 3D2MA 3QUNA 4NDQB 2J4JA 3D40A 2RD5A 4JZ9A 3S6HA 3WWNA 2BNFA 3D41A 3S6KA 3K52A 3C1NA 3LL9A 3ZZIA 2OGXA 2HMFA 4I49A 3L86A 2WE4A 1OHBA 2V5HA 4NDRA 2WE5A 3C1MA 2E9YA 3K4YA 3C20A 4A7XA 3WWMA 3L76A 2R98A 2IJ9A 3NWYA 2BMUA 2BNEA 4OLCA
chains in the Genus database with same CATH superfamily
3S6GA 3QURA 4NDPB 4NDQA 2VA1A 3T7BA 2J4LA 2J5TA 2CDQA 2AKOA 2J5VA 4NDOB 4Q1TA 3LL5A 2JJ4A 2X2WA 1OH9A 1E19A 4USJA 3QUOA 3TVIA 3QVHA 2W21A 3U6UA 4JZ8A 4NDRB 3AB2A 2V4YA 2J0WA 3LKKA 3AB4A 4KZTA 3EK6A 3D2PA 2J4KA 2R8VA 1GS5A 3ZZGA 4F6TB 3ZZFA 1GSJA 4JZ7A 4NDPA 2JI5A 4AB7A 2A1FA 3B8GA 2AP9A 3ZZHA 2BRXA 4F6TA 2OGXB 2BRIA 3K4OA 3AAWA 4NDOA 1Z9DA 2BNDA 2BUFA 4AXSA 3QVFA 2BTYA 2JJXA 1YBDA 3KZFA 3K56A 1B7BA 2J0XA 3EK5A 2WXBA 4A7WA 1OHAA 3D2MA 3QUNA 4NDQB 2J4JA 3D40A 2RD5A 4JZ9A 3S6HA 3WWNA 2BNFA 3D41A 3S6KA 3K52A 3C1NA 3LL9A 3ZZIA 2OGXA 2HMFA 4I49A 3L86A 2WE4A 1OHBA 2V5HA 4NDRA 2WE5A 3C1MA 2E9YA 3K4YA 3C20A 4A7XA 3WWMA 3L76A 2R98A 2IJ9A 3NWYA 2BMUA 2BNEA 4OLCA
chains in the Genus database with same CATH topology
3S6GA 3QURA 4NDPB 4NDQA 2VA1A 3T7BA 2J4LA 2J5TA 2CDQA 2AKOA 2J5VA 4NDOB 4Q1TA 3LL5A 2JJ4A 2X2WA 1OH9A 1E19A 4USJA 3QUOA 3TVIA 3QVHA 2W21A 3U6UA 4JZ8A 4NDRB 3AB2A 2V4YA 2J0WA 3LKKA 3AB4A 4KZTA 3EK6A 3D2PA 2J4KA 2R8VA 1GS5A 3ZZGA 4F6TB 3ZZFA 1GSJA 4JZ7A 4NDPA 2JI5A 4AB7A 2A1FA 3B8GA 2AP9A 3ZZHA 2BRXA 4F6TA 2OGXB 2BRIA 3K4OA 3AAWA 4NDOA 1Z9DA 2BNDA 2BUFA 4AXSA 3QVFA 2BTYA 2JJXA 1YBDA 3KZFA 3K56A 1B7BA 2J0XA 3EK5A 2WXBA 4A7WA 1OHAA 3D2MA 3QUNA 4NDQB 2J4JA 3D40A 2RD5A 4JZ9A 3S6HA 3WWNA 2BNFA 3D41A 3S6KA 3K52A 3C1NA 3LL9A 3ZZIA 2OGXA 2HMFA 4I49A 3L86A 2WE4A 1OHBA 2V5HA 4NDRA 2WE5A 3C1MA 2E9YA 3K4YA 3C20A 4A7XA 3WWMA 3L76A 2R98A 2IJ9A 3NWYA 2BMUA 2BNEA 4OLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6G A;  3QUR A;  4NDP B;  4NDQ A;  2VA1 A;  3T7B A;  2J4L A;  2J5T A;  2CDQ A;  2AKO A;  2J5V A;  4NDO B;  4Q1T A;  3LL5 A;  2JJ4 A;  2X2W A;  1OH9 A;  1E19 A;  4USJ A;  3QUO A;  3TVI A;  3QVH A;  2W21 A;  3U6U A;  4JZ8 A;  4NDR B;  3AB2 A;  2V4Y A;  2J0W A;  3LKK A;  3AB4 A;  4KZT A;  3EK6 A;  3D2P A;  2J4K A;  2R8V A;  1GS5 A;  3ZZG A;  4F6T B;  3ZZF A;  1GSJ A;  4JZ7 A;  4NDP A;  2JI5 A;  4AB7 A;  2A1F A;  3B8G A;  2AP9 A;  3ZZH A;  2BRX A;  4F6T A;  2OGX B;  2BRI A;  3K4O A;  3AAW A;  4NDO A;  1Z9D A;  2BND A;  2BUF A;  4AXS A;  3QVF A;  2BTY A;  2JJX A;  1YBD A;  3KZF A;  3K56 A;  1B7B A;  2J0X A;  3EK5 A;  2WXB A;  4A7W A;  1OHA A;  3D2M A;  3QUN A;  4NDQ B;  2J4J A;  3D40 A;  2RD5 A;  4JZ9 A;  3S6H A;  3WWN A;  2BNF A;  3D41 A;  3S6K A;  3K52 A;  3C1N A;  3LL9 A;  3ZZI A;  2OGX A;  2HMF A;  4I49 A;  3L86 A;  2WE4 A;  1OHB A;  2V5H A;  4NDR A;  2WE5 A;  3C1M A;  2E9Y A;  3K4Y A;  3C20 A;  4A7X A;  3WWM A;  3L76 A;  2R98 A;  2IJ9 A;  3NWY A;  2BMU A;  2BNE A;  4OLC A; 
#chains in the Genus database with same CATH topology
 3S6G A;  3QUR A;  4NDP B;  4NDQ A;  2VA1 A;  3T7B A;  2J4L A;  2J5T A;  2CDQ A;  2AKO A;  2J5V A;  4NDO B;  4Q1T A;  3LL5 A;  2JJ4 A;  2X2W A;  1OH9 A;  1E19 A;  4USJ A;  3QUO A;  3TVI A;  3QVH A;  2W21 A;  3U6U A;  4JZ8 A;  4NDR B;  3AB2 A;  2V4Y A;  2J0W A;  3LKK A;  3AB4 A;  4KZT A;  3EK6 A;  3D2P A;  2J4K A;  2R8V A;  1GS5 A;  3ZZG A;  4F6T B;  3ZZF A;  1GSJ A;  4JZ7 A;  4NDP A;  2JI5 A;  4AB7 A;  2A1F A;  3B8G A;  2AP9 A;  3ZZH A;  2BRX A;  4F6T A;  2OGX B;  2BRI A;  3K4O A;  3AAW A;  4NDO A;  1Z9D A;  2BND A;  2BUF A;  4AXS A;  3QVF A;  2BTY A;  2JJX A;  1YBD A;  3KZF A;  3K56 A;  1B7B A;  2J0X A;  3EK5 A;  2WXB A;  4A7W A;  1OHA A;  3D2M A;  3QUN A;  4NDQ B;  2J4J A;  3D40 A;  2RD5 A;  4JZ9 A;  3S6H A;  3WWN A;  2BNF A;  3D41 A;  3S6K A;  3K52 A;  3C1N A;  3LL9 A;  3ZZI A;  2OGX A;  2HMF A;  4I49 A;  3L86 A;  2WE4 A;  1OHB A;  2V5H A;  4NDR A;  2WE5 A;  3C1M A;  2E9Y A;  3K4Y A;  3C20 A;  4A7X A;  3WWM A;  3L76 A;  2R98 A;  2IJ9 A;  3NWY A;  2BMU A;  2BNE A;  4OLC A; 
#chains in the Genus database with same CATH homology
 3S6G A;  3QUR A;  4NDP B;  4NDQ A;  2VA1 A;  3T7B A;  2J4L A;  2J5T A;  2CDQ A;  2AKO A;  2J5V A;  4NDO B;  4Q1T A;  3LL5 A;  2JJ4 A;  2X2W A;  1OH9 A;  1E19 A;  4USJ A;  3QUO A;  3TVI A;  3QVH A;  2W21 A;  3U6U A;  4JZ8 A;  4NDR B;  3AB2 A;  2V4Y A;  2J0W A;  3LKK A;  3AB4 A;  4KZT A;  3EK6 A;  3D2P A;  2J4K A;  2R8V A;  1GS5 A;  3ZZG A;  4F6T B;  3ZZF A;  1GSJ A;  4JZ7 A;  4NDP A;  2JI5 A;  4AB7 A;  2A1F A;  3B8G A;  2AP9 A;  3ZZH A;  2BRX A;  4F6T A;  2OGX B;  2BRI A;  3K4O A;  3AAW A;  4NDO A;  1Z9D A;  2BND A;  2BUF A;  4AXS A;  3QVF A;  2BTY A;  2JJX A;  1YBD A;  3KZF A;  3K56 A;  1B7B A;  2J0X A;  3EK5 A;  2WXB A;  4A7W A;  1OHA A;  3D2M A;  3QUN A;  4NDQ B;  2J4J A;  3D40 A;  2RD5 A;  4JZ9 A;  3S6H A;  3WWN A;  2BNF A;  3D41 A;  3S6K A;  3K52 A;  3C1N A;  3LL9 A;  3ZZI A;  2OGX A;  2HMF A;  4I49 A;  3L86 A;  2WE4 A;  1OHB A;  2V5H A;  4NDR A;  2WE5 A;  3C1M A;  2E9Y A;  3K4Y A;  3C20 A;  4A7X A;  3WWM A;  3L76 A;  2R98 A;  2IJ9 A;  3NWY A;  2BMU A;  2BNE A;  4OLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...