2A1FA

Crystal structure of uridylate kinase
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
239
structure length
232
Chain Sequence
LSQPIYKRILLKLSGEALQGEDGLGIDPAILDRMAVEIKELVEMGVEVSVVLGGGNLFRGAKLAKAGMNRVVGDHMGMLATVMNGLAMRDSLFRADVNAKLMSAFQLNGICDTYNWSEAIKMLREKRVVIFSAGTGNPFFTTDSTACLRGIEIEADVVLKATKVDGVYDCAKLYKNLSYAEVIDKELKVMDLSAFTLARDHGMPIRVFNMGKPGALRQVVTGTEEGTTICEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uridylate kinase
rcsb
source organism Haemophilus influenzae
molecule tags Transferase
molecule keywords Uridylate kinase
total genus 82
structure length 232
sequence length 239
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2a1fA00
1OHBA 2X2WA 3L86A 3QVFA 4AXSA 2AKOA 2E9YA 1Z9DA 4Q1TA 2J4JA 4A7WA 2BRXA 4NDOA 4JZ8A 4JZ7A 3C1MA 3QURA 4NDQA 2JI5A 3AB4A 3AAWA 2BNFA 2OGXB 2J5TA 1OHAA 2RD5A 3C1NA 4NDRA 4A7XA 2WE4A 2AP9A 3C20A 3EK6A 1GSJA 2WXBA 3WWMA 4NDPB 1YBDA 2W21A 2A1FA 2BTYA 3D2MA 3TVIA 3WWNA 4F6TB 3NWYA 2R8VA 2BRIA 3QUNA 3D2PA 3ZZHA 4JZ9A 2V5HA 3D40A 2R98A 4NDOB 2BUFA 3K4OA 3T7BA 2WE5A 3LKKA 3L76A 2J4KA 2J0WA 2V4YA 3ZZFA 2HMFA 4NDPA 4OLCA 4I49A 2JJ4A 2OGXA 3B8GA 3QUOA 4KZTA 2BMUA 1B7BA 3S6KA 3D41A 3EK5A 3LL5A 3ZZGA 2JJXA 2J0XA 3LL9A 1OH9A 1E19A 2BNEA 2IJ9A 4NDQB 4F6TA 4NDRB 3ZZIA 4AB7A 3KZFA 2VA1A 3K52A 2J4LA 4USJA 3S6HA 2CDQA 3U6UA 2J5VA 2BNDA 3QVHA 3K56A 3AB2A 3S6GA 3K4YA 1GS5A
chains in the Genus database with same CATH superfamily
1OHBA 2X2WA 3L86A 3QVFA 4AXSA 2AKOA 2E9YA 1Z9DA 4Q1TA 2J4JA 4A7WA 2BRXA 4NDOA 4JZ8A 4JZ7A 3C1MA 3QURA 4NDQA 2JI5A 3AB4A 3AAWA 2BNFA 2OGXB 2J5TA 1OHAA 2RD5A 3C1NA 4NDRA 4A7XA 2WE4A 2AP9A 3C20A 3EK6A 1GSJA 2WXBA 3WWMA 4NDPB 1YBDA 2W21A 2A1FA 2BTYA 3D2MA 3TVIA 3WWNA 4F6TB 3NWYA 2R8VA 2BRIA 3QUNA 3D2PA 3ZZHA 4JZ9A 2V5HA 3D40A 2R98A 4NDOB 2BUFA 3K4OA 3T7BA 2WE5A 3LKKA 3L76A 2J4KA 2J0WA 2V4YA 3ZZFA 2HMFA 4NDPA 4OLCA 4I49A 2JJ4A 2OGXA 3B8GA 3QUOA 4KZTA 2BMUA 1B7BA 3S6KA 3D41A 3EK5A 3LL5A 3ZZGA 2JJXA 2J0XA 3LL9A 1OH9A 1E19A 2BNEA 2IJ9A 4NDQB 4F6TA 4NDRB 3ZZIA 4AB7A 3KZFA 2VA1A 3K52A 2J4LA 4USJA 3S6HA 2CDQA 3U6UA 2J5VA 2BNDA 3QVHA 3K56A 3AB2A 3S6GA 3K4YA 1GS5A
chains in the Genus database with same CATH topology
1OHBA 2X2WA 3L86A 3QVFA 4AXSA 2AKOA 2E9YA 1Z9DA 4Q1TA 2J4JA 4A7WA 2BRXA 4NDOA 4JZ8A 4JZ7A 3C1MA 3QURA 4NDQA 2JI5A 3AB4A 3AAWA 2BNFA 2OGXB 2J5TA 1OHAA 2RD5A 3C1NA 4NDRA 4A7XA 2WE4A 2AP9A 3C20A 3EK6A 1GSJA 2WXBA 3WWMA 4NDPB 1YBDA 2W21A 2A1FA 2BTYA 3D2MA 3TVIA 3WWNA 4F6TB 3NWYA 2R8VA 2BRIA 3QUNA 3D2PA 3ZZHA 4JZ9A 2V5HA 3D40A 2R98A 4NDOB 2BUFA 3K4OA 3T7BA 2WE5A 3LKKA 3L76A 2J4KA 2J0WA 2V4YA 3ZZFA 2HMFA 4NDPA 4OLCA 4I49A 2JJ4A 2OGXA 3B8GA 3QUOA 4KZTA 2BMUA 1B7BA 3S6KA 3D41A 3EK5A 3LL5A 3ZZGA 2JJXA 2J0XA 3LL9A 1OH9A 1E19A 2BNEA 2IJ9A 4NDQB 4F6TA 4NDRB 3ZZIA 4AB7A 3KZFA 2VA1A 3K52A 2J4LA 4USJA 3S6HA 2CDQA 3U6UA 2J5VA 2BNDA 3QVHA 3K56A 3AB2A 3S6GA 3K4YA 1GS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHB A;  2X2W A;  3L86 A;  3QVF A;  4AXS A;  2AKO A;  2E9Y A;  1Z9D A;  4Q1T A;  2J4J A;  4A7W A;  2BRX A;  4NDO A;  4JZ8 A;  4JZ7 A;  3C1M A;  3QUR A;  4NDQ A;  2JI5 A;  3AB4 A;  3AAW A;  2BNF A;  2OGX B;  2J5T A;  1OHA A;  2RD5 A;  3C1N A;  4NDR A;  4A7X A;  2WE4 A;  2AP9 A;  3C20 A;  3EK6 A;  1GSJ A;  2WXB A;  3WWM A;  4NDP B;  1YBD A;  2W21 A;  2A1F A;  2BTY A;  3D2M A;  3TVI A;  3WWN A;  4F6T B;  3NWY A;  2R8V A;  2BRI A;  3QUN A;  3D2P A;  3ZZH A;  4JZ9 A;  2V5H A;  3D40 A;  2R98 A;  4NDO B;  2BUF A;  3K4O A;  3T7B A;  2WE5 A;  3LKK A;  3L76 A;  2J4K A;  2J0W A;  2V4Y A;  3ZZF A;  2HMF A;  4NDP A;  4OLC A;  4I49 A;  2JJ4 A;  2OGX A;  3B8G A;  3QUO A;  4KZT A;  2BMU A;  1B7B A;  3S6K A;  3D41 A;  3EK5 A;  3LL5 A;  3ZZG A;  2JJX A;  2J0X A;  3LL9 A;  1OH9 A;  1E19 A;  2BNE A;  2IJ9 A;  4NDQ B;  4F6T A;  4NDR B;  3ZZI A;  4AB7 A;  3KZF A;  2VA1 A;  3K52 A;  2J4L A;  4USJ A;  3S6H A;  2CDQ A;  3U6U A;  2J5V A;  2BND A;  3QVH A;  3K56 A;  3AB2 A;  3S6G A;  3K4Y A;  1GS5 A; 
#chains in the Genus database with same CATH topology
 1OHB A;  2X2W A;  3L86 A;  3QVF A;  4AXS A;  2AKO A;  2E9Y A;  1Z9D A;  4Q1T A;  2J4J A;  4A7W A;  2BRX A;  4NDO A;  4JZ8 A;  4JZ7 A;  3C1M A;  3QUR A;  4NDQ A;  2JI5 A;  3AB4 A;  3AAW A;  2BNF A;  2OGX B;  2J5T A;  1OHA A;  2RD5 A;  3C1N A;  4NDR A;  4A7X A;  2WE4 A;  2AP9 A;  3C20 A;  3EK6 A;  1GSJ A;  2WXB A;  3WWM A;  4NDP B;  1YBD A;  2W21 A;  2A1F A;  2BTY A;  3D2M A;  3TVI A;  3WWN A;  4F6T B;  3NWY A;  2R8V A;  2BRI A;  3QUN A;  3D2P A;  3ZZH A;  4JZ9 A;  2V5H A;  3D40 A;  2R98 A;  4NDO B;  2BUF A;  3K4O A;  3T7B A;  2WE5 A;  3LKK A;  3L76 A;  2J4K A;  2J0W A;  2V4Y A;  3ZZF A;  2HMF A;  4NDP A;  4OLC A;  4I49 A;  2JJ4 A;  2OGX A;  3B8G A;  3QUO A;  4KZT A;  2BMU A;  1B7B A;  3S6K A;  3D41 A;  3EK5 A;  3LL5 A;  3ZZG A;  2JJX A;  2J0X A;  3LL9 A;  1OH9 A;  1E19 A;  2BNE A;  2IJ9 A;  4NDQ B;  4F6T A;  4NDR B;  3ZZI A;  4AB7 A;  3KZF A;  2VA1 A;  3K52 A;  2J4L A;  4USJ A;  3S6H A;  2CDQ A;  3U6U A;  2J5V A;  2BND A;  3QVH A;  3K56 A;  3AB2 A;  3S6G A;  3K4Y A;  1GS5 A; 
#chains in the Genus database with same CATH homology
 1OHB A;  2X2W A;  3L86 A;  3QVF A;  4AXS A;  2AKO A;  2E9Y A;  1Z9D A;  4Q1T A;  2J4J A;  4A7W A;  2BRX A;  4NDO A;  4JZ8 A;  4JZ7 A;  3C1M A;  3QUR A;  4NDQ A;  2JI5 A;  3AB4 A;  3AAW A;  2BNF A;  2OGX B;  2J5T A;  1OHA A;  2RD5 A;  3C1N A;  4NDR A;  4A7X A;  2WE4 A;  2AP9 A;  3C20 A;  3EK6 A;  1GSJ A;  2WXB A;  3WWM A;  4NDP B;  1YBD A;  2W21 A;  2A1F A;  2BTY A;  3D2M A;  3TVI A;  3WWN A;  4F6T B;  3NWY A;  2R8V A;  2BRI A;  3QUN A;  3D2P A;  3ZZH A;  4JZ9 A;  2V5H A;  3D40 A;  2R98 A;  4NDO B;  2BUF A;  3K4O A;  3T7B A;  2WE5 A;  3LKK A;  3L76 A;  2J4K A;  2J0W A;  2V4Y A;  3ZZF A;  2HMF A;  4NDP A;  4OLC A;  4I49 A;  2JJ4 A;  2OGX A;  3B8G A;  3QUO A;  4KZT A;  2BMU A;  1B7B A;  3S6K A;  3D41 A;  3EK5 A;  3LL5 A;  3ZZG A;  2JJX A;  2J0X A;  3LL9 A;  1OH9 A;  1E19 A;  2BNE A;  2IJ9 A;  4NDQ B;  4F6T A;  4NDR B;  3ZZI A;  4AB7 A;  3KZF A;  2VA1 A;  3K52 A;  2J4L A;  4USJ A;  3S6H A;  2CDQ A;  3U6U A;  2J5V A;  2BND A;  3QVH A;  3K56 A;  3AB2 A;  3S6G A;  3K4Y A;  1GS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...