3EK6A

Unique gtp-binding pocket and allostery of ump kinase from a gram-negative phytopathogen bacterium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SNAMSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGAGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate kinase
publication title Unique GTP-Binding Pocket and Allostery of Uridylate Kinase from a Gram-Negative Phytopathogenic Bacterium
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 80
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ek6A00
4OLCA 1OH9A 3L86A 4NDPA 2BMUA 3D2MA 3D2PA 4F6TB 2J4KA 4JZ7A 2AP9A 4NDQA 4AXSA 3B8GA 3K56A 4I49A 2WE4A 2RD5A 2JJ4A 4A7WA 3C1NA 2J0XA 3WWNA 3K4YA 3T7BA 1GS5A 2J5TA 1E19A 3AB2A 3QURA 4F6TA 1YBDA 2J4LA 4KZTA 3K52A 3ZZFA 2BNEA 2BUFA 3QVHA 2V5HA 2BRXA 2HMFA 3D40A 2IJ9A 3LL5A 1OHBA 2R98A 4Q1TA 3C1MA 1OHAA 3D41A 3LL9A 2J0WA 2WE5A 2X2WA 4A7XA 2J5VA 3S6GA 2OGXB 3EK5A 2WXBA 2JI5A 3U6UA 4NDOB 2BRIA 2VA1A 2V4YA 3K4OA 3TVIA 3NWYA 3QUNA 2BNDA 3AAWA 3S6KA 2J4JA 2E9YA 4JZ8A 4NDRB 1GSJA 2OGXA 2CDQA 2BNFA 2BTYA 3QUOA 3WWMA 3AB4A 1B7BA 3LKKA 3QVFA 3C20A 4NDPB 3KZFA 3ZZGA 4NDOA 2W21A 3S6HA 3L76A 2AKOA 2A1FA 3EK6A 4USJA 1Z9DA 4NDQB 2R8VA 4NDRA 2JJXA 3ZZIA 3ZZHA 4AB7A 4JZ9A
chains in the Genus database with same CATH superfamily
4OLCA 1OH9A 3L86A 4NDPA 2BMUA 3D2MA 3D2PA 4F6TB 2J4KA 4JZ7A 2AP9A 4NDQA 4AXSA 3B8GA 3K56A 4I49A 2WE4A 2RD5A 2JJ4A 4A7WA 3C1NA 2J0XA 3WWNA 3K4YA 3T7BA 1GS5A 2J5TA 1E19A 3AB2A 3QURA 4F6TA 1YBDA 2J4LA 4KZTA 3K52A 3ZZFA 2BNEA 2BUFA 3QVHA 2V5HA 2BRXA 2HMFA 3D40A 2IJ9A 3LL5A 1OHBA 2R98A 4Q1TA 3C1MA 1OHAA 3D41A 3LL9A 2J0WA 2WE5A 2X2WA 4A7XA 2J5VA 3S6GA 2OGXB 3EK5A 2WXBA 2JI5A 3U6UA 4NDOB 2BRIA 2VA1A 2V4YA 3K4OA 3TVIA 3NWYA 3QUNA 2BNDA 3AAWA 3S6KA 2J4JA 2E9YA 4JZ8A 4NDRB 1GSJA 2OGXA 2CDQA 2BNFA 2BTYA 3QUOA 3WWMA 3AB4A 1B7BA 3LKKA 3QVFA 3C20A 4NDPB 3KZFA 3ZZGA 4NDOA 2W21A 3S6HA 3L76A 2AKOA 2A1FA 3EK6A 4USJA 1Z9DA 4NDQB 2R8VA 4NDRA 2JJXA 3ZZIA 3ZZHA 4AB7A 4JZ9A
chains in the Genus database with same CATH topology
4OLCA 1OH9A 3L86A 4NDPA 2BMUA 3D2MA 3D2PA 4F6TB 2J4KA 4JZ7A 2AP9A 4NDQA 4AXSA 3B8GA 3K56A 4I49A 2WE4A 2RD5A 2JJ4A 4A7WA 3C1NA 2J0XA 3WWNA 3K4YA 3T7BA 1GS5A 2J5TA 1E19A 3AB2A 3QURA 4F6TA 1YBDA 2J4LA 4KZTA 3K52A 3ZZFA 2BNEA 2BUFA 3QVHA 2V5HA 2BRXA 2HMFA 3D40A 2IJ9A 3LL5A 1OHBA 2R98A 4Q1TA 3C1MA 1OHAA 3D41A 3LL9A 2J0WA 2WE5A 2X2WA 4A7XA 2J5VA 3S6GA 2OGXB 3EK5A 2WXBA 2JI5A 3U6UA 4NDOB 2BRIA 2VA1A 2V4YA 3K4OA 3TVIA 3NWYA 3QUNA 2BNDA 3AAWA 3S6KA 2J4JA 2E9YA 4JZ8A 4NDRB 1GSJA 2OGXA 2CDQA 2BNFA 2BTYA 3QUOA 3WWMA 3AB4A 1B7BA 3LKKA 3QVFA 3C20A 4NDPB 3KZFA 3ZZGA 4NDOA 2W21A 3S6HA 3L76A 2AKOA 2A1FA 3EK6A 4USJA 1Z9DA 4NDQB 2R8VA 4NDRA 2JJXA 3ZZIA 3ZZHA 4AB7A 4JZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLC A;  1OH9 A;  3L86 A;  4NDP A;  2BMU A;  3D2M A;  3D2P A;  4F6T B;  2J4K A;  4JZ7 A;  2AP9 A;  4NDQ A;  4AXS A;  3B8G A;  3K56 A;  4I49 A;  2WE4 A;  2RD5 A;  2JJ4 A;  4A7W A;  3C1N A;  2J0X A;  3WWN A;  3K4Y A;  3T7B A;  1GS5 A;  2J5T A;  1E19 A;  3AB2 A;  3QUR A;  4F6T A;  1YBD A;  2J4L A;  4KZT A;  3K52 A;  3ZZF A;  2BNE A;  2BUF A;  3QVH A;  2V5H A;  2BRX A;  2HMF A;  3D40 A;  2IJ9 A;  3LL5 A;  1OHB A;  2R98 A;  4Q1T A;  3C1M A;  1OHA A;  3D41 A;  3LL9 A;  2J0W A;  2WE5 A;  2X2W A;  4A7X A;  2J5V A;  3S6G A;  2OGX B;  3EK5 A;  2WXB A;  2JI5 A;  3U6U A;  4NDO B;  2BRI A;  2VA1 A;  2V4Y A;  3K4O A;  3TVI A;  3NWY A;  3QUN A;  2BND A;  3AAW A;  3S6K A;  2J4J A;  2E9Y A;  4JZ8 A;  4NDR B;  1GSJ A;  2OGX A;  2CDQ A;  2BNF A;  2BTY A;  3QUO A;  3WWM A;  3AB4 A;  1B7B A;  3LKK A;  3QVF A;  3C20 A;  4NDP B;  3KZF A;  3ZZG A;  4NDO A;  2W21 A;  3S6H A;  3L76 A;  2AKO A;  2A1F A;  3EK6 A;  4USJ A;  1Z9D A;  4NDQ B;  2R8V A;  4NDR A;  2JJX A;  3ZZI A;  3ZZH A;  4AB7 A;  4JZ9 A; 
#chains in the Genus database with same CATH topology
 4OLC A;  1OH9 A;  3L86 A;  4NDP A;  2BMU A;  3D2M A;  3D2P A;  4F6T B;  2J4K A;  4JZ7 A;  2AP9 A;  4NDQ A;  4AXS A;  3B8G A;  3K56 A;  4I49 A;  2WE4 A;  2RD5 A;  2JJ4 A;  4A7W A;  3C1N A;  2J0X A;  3WWN A;  3K4Y A;  3T7B A;  1GS5 A;  2J5T A;  1E19 A;  3AB2 A;  3QUR A;  4F6T A;  1YBD A;  2J4L A;  4KZT A;  3K52 A;  3ZZF A;  2BNE A;  2BUF A;  3QVH A;  2V5H A;  2BRX A;  2HMF A;  3D40 A;  2IJ9 A;  3LL5 A;  1OHB A;  2R98 A;  4Q1T A;  3C1M A;  1OHA A;  3D41 A;  3LL9 A;  2J0W A;  2WE5 A;  2X2W A;  4A7X A;  2J5V A;  3S6G A;  2OGX B;  3EK5 A;  2WXB A;  2JI5 A;  3U6U A;  4NDO B;  2BRI A;  2VA1 A;  2V4Y A;  3K4O A;  3TVI A;  3NWY A;  3QUN A;  2BND A;  3AAW A;  3S6K A;  2J4J A;  2E9Y A;  4JZ8 A;  4NDR B;  1GSJ A;  2OGX A;  2CDQ A;  2BNF A;  2BTY A;  3QUO A;  3WWM A;  3AB4 A;  1B7B A;  3LKK A;  3QVF A;  3C20 A;  4NDP B;  3KZF A;  3ZZG A;  4NDO A;  2W21 A;  3S6H A;  3L76 A;  2AKO A;  2A1F A;  3EK6 A;  4USJ A;  1Z9D A;  4NDQ B;  2R8V A;  4NDR A;  2JJX A;  3ZZI A;  3ZZH A;  4AB7 A;  4JZ9 A; 
#chains in the Genus database with same CATH homology
 4OLC A;  1OH9 A;  3L86 A;  4NDP A;  2BMU A;  3D2M A;  3D2P A;  4F6T B;  2J4K A;  4JZ7 A;  2AP9 A;  4NDQ A;  4AXS A;  3B8G A;  3K56 A;  4I49 A;  2WE4 A;  2RD5 A;  2JJ4 A;  4A7W A;  3C1N A;  2J0X A;  3WWN A;  3K4Y A;  3T7B A;  1GS5 A;  2J5T A;  1E19 A;  3AB2 A;  3QUR A;  4F6T A;  1YBD A;  2J4L A;  4KZT A;  3K52 A;  3ZZF A;  2BNE A;  2BUF A;  3QVH A;  2V5H A;  2BRX A;  2HMF A;  3D40 A;  2IJ9 A;  3LL5 A;  1OHB A;  2R98 A;  4Q1T A;  3C1M A;  1OHA A;  3D41 A;  3LL9 A;  2J0W A;  2WE5 A;  2X2W A;  4A7X A;  2J5V A;  3S6G A;  2OGX B;  3EK5 A;  2WXB A;  2JI5 A;  3U6U A;  4NDO B;  2BRI A;  2VA1 A;  2V4Y A;  3K4O A;  3TVI A;  3NWY A;  3QUN A;  2BND A;  3AAW A;  3S6K A;  2J4J A;  2E9Y A;  4JZ8 A;  4NDR B;  1GSJ A;  2OGX A;  2CDQ A;  2BNF A;  2BTY A;  3QUO A;  3WWM A;  3AB4 A;  1B7B A;  3LKK A;  3QVF A;  3C20 A;  4NDP B;  3KZF A;  3ZZG A;  4NDO A;  2W21 A;  3S6H A;  3L76 A;  2AKO A;  2A1F A;  3EK6 A;  4USJ A;  1Z9D A;  4NDQ B;  2R8V A;  4NDR A;  2JJX A;  3ZZI A;  3ZZH A;  4AB7 A;  4JZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...