3EK6A

Unique gtp-binding pocket and allostery of ump kinase from a gram-negative phytopathogen bacterium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SNAMSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGAGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uridylate kinase
publication title Unique GTP-Binding Pocket and Allostery of Uridylate Kinase from a Gram-Negative Phytopathogenic Bacterium
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 80
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ek6A00
3U6UA 3T7BA 3D2MA 3ZZGA 3EK6A 3EK5A 2J4KA 3L76A 3B8GA 4OLCA 2R8VA 3QVHA 2BRIA 2J5VA 3LL5A 3QVFA 4I49A 2OGXB 1GS5A 4JZ7A 2X2WA 2WE4A 3LKKA 2AKOA 3S6GA 2V5HA 2BNEA 2JJXA 2OGXA 3AB2A 2A1FA 2JI5A 1E19A 4NDOB 4NDQA 3S6HA 4Q1TA 1OH9A 1GSJA 3K4OA 3QUNA 2BRXA 3L86A 4F6TB 2J0XA 2JJ4A 2BTYA 3ZZHA 3C1MA 2VA1A 3WWMA 3ZZIA 3C20A 3K56A 1YBDA 1B7BA 4JZ8A 2J4JA 3D41A 3WWNA 2J5TA 4AB7A 2BNFA 2IJ9A 2R98A 3NWYA 2WE5A 3KZFA 2W21A 4NDRB 2J0WA 1OHAA 3S6KA 2BMUA 4A7WA 3LL9A 2WXBA 3AB4A 4NDOA 3C1NA 3ZZFA 2HMFA 1OHBA 3D2PA 4KZTA 4AXSA 4F6TA 3TVIA 4USJA 2BNDA 3QURA 3QUOA 2AP9A 2E9YA 3D40A 1Z9DA 2CDQA 4NDPB 2RD5A 2J4LA 3K4YA 3K52A 4A7XA 4NDQB 4JZ9A 3AAWA 4NDPA 4NDRA 2BUFA 2V4YA
chains in the Genus database with same CATH superfamily
3U6UA 3T7BA 3D2MA 3ZZGA 3EK6A 3EK5A 2J4KA 3L76A 3B8GA 4OLCA 2R8VA 3QVHA 2BRIA 2J5VA 3LL5A 3QVFA 4I49A 2OGXB 1GS5A 4JZ7A 2X2WA 2WE4A 3LKKA 2AKOA 3S6GA 2V5HA 2BNEA 2JJXA 2OGXA 3AB2A 2A1FA 2JI5A 1E19A 4NDOB 4NDQA 3S6HA 4Q1TA 1OH9A 1GSJA 3K4OA 3QUNA 2BRXA 3L86A 4F6TB 2J0XA 2JJ4A 2BTYA 3ZZHA 3C1MA 2VA1A 3WWMA 3ZZIA 3C20A 3K56A 1YBDA 1B7BA 4JZ8A 2J4JA 3D41A 3WWNA 2J5TA 4AB7A 2BNFA 2IJ9A 2R98A 3NWYA 2WE5A 3KZFA 2W21A 4NDRB 2J0WA 1OHAA 3S6KA 2BMUA 4A7WA 3LL9A 2WXBA 3AB4A 4NDOA 3C1NA 3ZZFA 2HMFA 1OHBA 3D2PA 4KZTA 4AXSA 4F6TA 3TVIA 4USJA 2BNDA 3QURA 3QUOA 2AP9A 2E9YA 3D40A 1Z9DA 2CDQA 4NDPB 2RD5A 2J4LA 3K4YA 3K52A 4A7XA 4NDQB 4JZ9A 3AAWA 4NDPA 4NDRA 2BUFA 2V4YA
chains in the Genus database with same CATH topology
3U6UA 3T7BA 3D2MA 3ZZGA 3EK6A 3EK5A 2J4KA 3L76A 3B8GA 4OLCA 2R8VA 3QVHA 2BRIA 2J5VA 3LL5A 3QVFA 4I49A 2OGXB 1GS5A 4JZ7A 2X2WA 2WE4A 3LKKA 2AKOA 3S6GA 2V5HA 2BNEA 2JJXA 2OGXA 3AB2A 2A1FA 2JI5A 1E19A 4NDOB 4NDQA 3S6HA 4Q1TA 1OH9A 1GSJA 3K4OA 3QUNA 2BRXA 3L86A 4F6TB 2J0XA 2JJ4A 2BTYA 3ZZHA 3C1MA 2VA1A 3WWMA 3ZZIA 3C20A 3K56A 1YBDA 1B7BA 4JZ8A 2J4JA 3D41A 3WWNA 2J5TA 4AB7A 2BNFA 2IJ9A 2R98A 3NWYA 2WE5A 3KZFA 2W21A 4NDRB 2J0WA 1OHAA 3S6KA 2BMUA 4A7WA 3LL9A 2WXBA 3AB4A 4NDOA 3C1NA 3ZZFA 2HMFA 1OHBA 3D2PA 4KZTA 4AXSA 4F6TA 3TVIA 4USJA 2BNDA 3QURA 3QUOA 2AP9A 2E9YA 3D40A 1Z9DA 2CDQA 4NDPB 2RD5A 2J4LA 3K4YA 3K52A 4A7XA 4NDQB 4JZ9A 3AAWA 4NDPA 4NDRA 2BUFA 2V4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6U A;  3T7B A;  3D2M A;  3ZZG A;  3EK6 A;  3EK5 A;  2J4K A;  3L76 A;  3B8G A;  4OLC A;  2R8V A;  3QVH A;  2BRI A;  2J5V A;  3LL5 A;  3QVF A;  4I49 A;  2OGX B;  1GS5 A;  4JZ7 A;  2X2W A;  2WE4 A;  3LKK A;  2AKO A;  3S6G A;  2V5H A;  2BNE A;  2JJX A;  2OGX A;  3AB2 A;  2A1F A;  2JI5 A;  1E19 A;  4NDO B;  4NDQ A;  3S6H A;  4Q1T A;  1OH9 A;  1GSJ A;  3K4O A;  3QUN A;  2BRX A;  3L86 A;  4F6T B;  2J0X A;  2JJ4 A;  2BTY A;  3ZZH A;  3C1M A;  2VA1 A;  3WWM A;  3ZZI A;  3C20 A;  3K56 A;  1YBD A;  1B7B A;  4JZ8 A;  2J4J A;  3D41 A;  3WWN A;  2J5T A;  4AB7 A;  2BNF A;  2IJ9 A;  2R98 A;  3NWY A;  2WE5 A;  3KZF A;  2W21 A;  4NDR B;  2J0W A;  1OHA A;  3S6K A;  2BMU A;  4A7W A;  3LL9 A;  2WXB A;  3AB4 A;  4NDO A;  3C1N A;  3ZZF A;  2HMF A;  1OHB A;  3D2P A;  4KZT A;  4AXS A;  4F6T A;  3TVI A;  4USJ A;  2BND A;  3QUR A;  3QUO A;  2AP9 A;  2E9Y A;  3D40 A;  1Z9D A;  2CDQ A;  4NDP B;  2RD5 A;  2J4L A;  3K4Y A;  3K52 A;  4A7X A;  4NDQ B;  4JZ9 A;  3AAW A;  4NDP A;  4NDR A;  2BUF A;  2V4Y A; 
#chains in the Genus database with same CATH topology
 3U6U A;  3T7B A;  3D2M A;  3ZZG A;  3EK6 A;  3EK5 A;  2J4K A;  3L76 A;  3B8G A;  4OLC A;  2R8V A;  3QVH A;  2BRI A;  2J5V A;  3LL5 A;  3QVF A;  4I49 A;  2OGX B;  1GS5 A;  4JZ7 A;  2X2W A;  2WE4 A;  3LKK A;  2AKO A;  3S6G A;  2V5H A;  2BNE A;  2JJX A;  2OGX A;  3AB2 A;  2A1F A;  2JI5 A;  1E19 A;  4NDO B;  4NDQ A;  3S6H A;  4Q1T A;  1OH9 A;  1GSJ A;  3K4O A;  3QUN A;  2BRX A;  3L86 A;  4F6T B;  2J0X A;  2JJ4 A;  2BTY A;  3ZZH A;  3C1M A;  2VA1 A;  3WWM A;  3ZZI A;  3C20 A;  3K56 A;  1YBD A;  1B7B A;  4JZ8 A;  2J4J A;  3D41 A;  3WWN A;  2J5T A;  4AB7 A;  2BNF A;  2IJ9 A;  2R98 A;  3NWY A;  2WE5 A;  3KZF A;  2W21 A;  4NDR B;  2J0W A;  1OHA A;  3S6K A;  2BMU A;  4A7W A;  3LL9 A;  2WXB A;  3AB4 A;  4NDO A;  3C1N A;  3ZZF A;  2HMF A;  1OHB A;  3D2P A;  4KZT A;  4AXS A;  4F6T A;  3TVI A;  4USJ A;  2BND A;  3QUR A;  3QUO A;  2AP9 A;  2E9Y A;  3D40 A;  1Z9D A;  2CDQ A;  4NDP B;  2RD5 A;  2J4L A;  3K4Y A;  3K52 A;  4A7X A;  4NDQ B;  4JZ9 A;  3AAW A;  4NDP A;  4NDR A;  2BUF A;  2V4Y A; 
#chains in the Genus database with same CATH homology
 3U6U A;  3T7B A;  3D2M A;  3ZZG A;  3EK6 A;  3EK5 A;  2J4K A;  3L76 A;  3B8G A;  4OLC A;  2R8V A;  3QVH A;  2BRI A;  2J5V A;  3LL5 A;  3QVF A;  4I49 A;  2OGX B;  1GS5 A;  4JZ7 A;  2X2W A;  2WE4 A;  3LKK A;  2AKO A;  3S6G A;  2V5H A;  2BNE A;  2JJX A;  2OGX A;  3AB2 A;  2A1F A;  2JI5 A;  1E19 A;  4NDO B;  4NDQ A;  3S6H A;  4Q1T A;  1OH9 A;  1GSJ A;  3K4O A;  3QUN A;  2BRX A;  3L86 A;  4F6T B;  2J0X A;  2JJ4 A;  2BTY A;  3ZZH A;  3C1M A;  2VA1 A;  3WWM A;  3ZZI A;  3C20 A;  3K56 A;  1YBD A;  1B7B A;  4JZ8 A;  2J4J A;  3D41 A;  3WWN A;  2J5T A;  4AB7 A;  2BNF A;  2IJ9 A;  2R98 A;  3NWY A;  2WE5 A;  3KZF A;  2W21 A;  4NDR B;  2J0W A;  1OHA A;  3S6K A;  2BMU A;  4A7W A;  3LL9 A;  2WXB A;  3AB4 A;  4NDO A;  3C1N A;  3ZZF A;  2HMF A;  1OHB A;  3D2P A;  4KZT A;  4AXS A;  4F6T A;  3TVI A;  4USJ A;  2BND A;  3QUR A;  3QUO A;  2AP9 A;  2E9Y A;  3D40 A;  1Z9D A;  2CDQ A;  4NDP B;  2RD5 A;  2J4L A;  3K4Y A;  3K52 A;  4A7X A;  4NDQ B;  4JZ9 A;  3AAW A;  4NDP A;  4NDR A;  2BUF A;  2V4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...