3EK6A

Unique gtp-binding pocket and allostery of ump kinase from a gram-negative phytopathogen bacterium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
SNAMSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGAGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique GTP-Binding Pocket and Allostery of Uridylate Kinase from a Gram-Negative Phytopathogenic Bacterium
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords Uridylate kinase
total genus 80
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ek6A00
2JJ4A 4A7WA 2BRIA 2AP9A 3C1NA 2OGXA 3AAWA 1OHAA 3ZZHA 3T7BA 2R98A 4I49A 2BRXA 1OH9A 1OHBA 4F6TB 2JI5A 1E19A 3WWNA 4NDOA 3C20A 4NDRB 3L86A 4OLCA 3KZFA 3D2MA 2WE4A 2E9YA 3QUOA 3EK6A 4KZTA 2JJXA 2W21A 2J5TA 3LKKA 3K4YA 3QUNA 3K4OA 3QURA 3WWMA 3EK5A 2BNFA 3K56A 4NDQB 3B8GA 3K52A 1Z9DA 4NDPA 4NDOB 3S6HA 2WE5A 3AB4A 4USJA 2BNDA 4AXSA 3S6GA 3LL9A 2OGXB 2V4YA 2CDQA 2J0XA 4JZ7A 1YBDA 3ZZFA 4F6TA 2BMUA 4AB7A 3C1MA 4JZ9A 2RD5A 3L76A 3ZZIA 3D40A 2R8VA 2J0WA 1B7BA 2J4LA 4NDPB 3D41A 2V5HA 4A7XA 2BUFA 2VA1A 4Q1TA 2J4KA 3D2PA 2IJ9A 2X2WA 3U6UA 2AKOA 2BTYA 3TVIA 4JZ8A 2HMFA 2WXBA 1GS5A 2J5VA 3NWYA 2BNEA 2A1FA 3ZZGA 3QVFA 3S6KA 4NDQA 1GSJA 4NDRA 2J4JA 3AB2A 3LL5A 3QVHA
chains in the Genus database with same CATH superfamily
2JJ4A 4A7WA 2BRIA 2AP9A 3C1NA 2OGXA 3AAWA 1OHAA 3ZZHA 3T7BA 2R98A 4I49A 2BRXA 1OH9A 1OHBA 4F6TB 2JI5A 1E19A 3WWNA 4NDOA 3C20A 4NDRB 3L86A 4OLCA 3KZFA 3D2MA 2WE4A 2E9YA 3QUOA 3EK6A 4KZTA 2JJXA 2W21A 2J5TA 3LKKA 3K4YA 3QUNA 3K4OA 3QURA 3WWMA 3EK5A 2BNFA 3K56A 4NDQB 3B8GA 3K52A 1Z9DA 4NDPA 4NDOB 3S6HA 2WE5A 3AB4A 4USJA 2BNDA 4AXSA 3S6GA 3LL9A 2OGXB 2V4YA 2CDQA 2J0XA 4JZ7A 1YBDA 3ZZFA 4F6TA 2BMUA 4AB7A 3C1MA 4JZ9A 2RD5A 3L76A 3ZZIA 3D40A 2R8VA 2J0WA 1B7BA 2J4LA 4NDPB 3D41A 2V5HA 4A7XA 2BUFA 2VA1A 4Q1TA 2J4KA 3D2PA 2IJ9A 2X2WA 3U6UA 2AKOA 2BTYA 3TVIA 4JZ8A 2HMFA 2WXBA 1GS5A 2J5VA 3NWYA 2BNEA 2A1FA 3ZZGA 3QVFA 3S6KA 4NDQA 1GSJA 4NDRA 2J4JA 3AB2A 3LL5A 3QVHA
chains in the Genus database with same CATH topology
2JJ4A 4A7WA 2BRIA 2AP9A 3C1NA 2OGXA 3AAWA 1OHAA 3ZZHA 3T7BA 2R98A 4I49A 2BRXA 1OH9A 1OHBA 4F6TB 2JI5A 1E19A 3WWNA 4NDOA 3C20A 4NDRB 3L86A 4OLCA 3KZFA 3D2MA 2WE4A 2E9YA 3QUOA 3EK6A 4KZTA 2JJXA 2W21A 2J5TA 3LKKA 3K4YA 3QUNA 3K4OA 3QURA 3WWMA 3EK5A 2BNFA 3K56A 4NDQB 3B8GA 3K52A 1Z9DA 4NDPA 4NDOB 3S6HA 2WE5A 3AB4A 4USJA 2BNDA 4AXSA 3S6GA 3LL9A 2OGXB 2V4YA 2CDQA 2J0XA 4JZ7A 1YBDA 3ZZFA 4F6TA 2BMUA 4AB7A 3C1MA 4JZ9A 2RD5A 3L76A 3ZZIA 3D40A 2R8VA 2J0WA 1B7BA 2J4LA 4NDPB 3D41A 2V5HA 4A7XA 2BUFA 2VA1A 4Q1TA 2J4KA 3D2PA 2IJ9A 2X2WA 3U6UA 2AKOA 2BTYA 3TVIA 4JZ8A 2HMFA 2WXBA 1GS5A 2J5VA 3NWYA 2BNEA 2A1FA 3ZZGA 3QVFA 3S6KA 4NDQA 1GSJA 4NDRA 2J4JA 3AB2A 3LL5A 3QVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ4 A;  4A7W A;  2BRI A;  2AP9 A;  3C1N A;  2OGX A;  3AAW A;  1OHA A;  3ZZH A;  3T7B A;  2R98 A;  4I49 A;  2BRX A;  1OH9 A;  1OHB A;  4F6T B;  2JI5 A;  1E19 A;  3WWN A;  4NDO A;  3C20 A;  4NDR B;  3L86 A;  4OLC A;  3KZF A;  3D2M A;  2WE4 A;  2E9Y A;  3QUO A;  3EK6 A;  4KZT A;  2JJX A;  2W21 A;  2J5T A;  3LKK A;  3K4Y A;  3QUN A;  3K4O A;  3QUR A;  3WWM A;  3EK5 A;  2BNF A;  3K56 A;  4NDQ B;  3B8G A;  3K52 A;  1Z9D A;  4NDP A;  4NDO B;  3S6H A;  2WE5 A;  3AB4 A;  4USJ A;  2BND A;  4AXS A;  3S6G A;  3LL9 A;  2OGX B;  2V4Y A;  2CDQ A;  2J0X A;  4JZ7 A;  1YBD A;  3ZZF A;  4F6T A;  2BMU A;  4AB7 A;  3C1M A;  4JZ9 A;  2RD5 A;  3L76 A;  3ZZI A;  3D40 A;  2R8V A;  2J0W A;  1B7B A;  2J4L A;  4NDP B;  3D41 A;  2V5H A;  4A7X A;  2BUF A;  2VA1 A;  4Q1T A;  2J4K A;  3D2P A;  2IJ9 A;  2X2W A;  3U6U A;  2AKO A;  2BTY A;  3TVI A;  4JZ8 A;  2HMF A;  2WXB A;  1GS5 A;  2J5V A;  3NWY A;  2BNE A;  2A1F A;  3ZZG A;  3QVF A;  3S6K A;  4NDQ A;  1GSJ A;  4NDR A;  2J4J A;  3AB2 A;  3LL5 A;  3QVH A; 
#chains in the Genus database with same CATH topology
 2JJ4 A;  4A7W A;  2BRI A;  2AP9 A;  3C1N A;  2OGX A;  3AAW A;  1OHA A;  3ZZH A;  3T7B A;  2R98 A;  4I49 A;  2BRX A;  1OH9 A;  1OHB A;  4F6T B;  2JI5 A;  1E19 A;  3WWN A;  4NDO A;  3C20 A;  4NDR B;  3L86 A;  4OLC A;  3KZF A;  3D2M A;  2WE4 A;  2E9Y A;  3QUO A;  3EK6 A;  4KZT A;  2JJX A;  2W21 A;  2J5T A;  3LKK A;  3K4Y A;  3QUN A;  3K4O A;  3QUR A;  3WWM A;  3EK5 A;  2BNF A;  3K56 A;  4NDQ B;  3B8G A;  3K52 A;  1Z9D A;  4NDP A;  4NDO B;  3S6H A;  2WE5 A;  3AB4 A;  4USJ A;  2BND A;  4AXS A;  3S6G A;  3LL9 A;  2OGX B;  2V4Y A;  2CDQ A;  2J0X A;  4JZ7 A;  1YBD A;  3ZZF A;  4F6T A;  2BMU A;  4AB7 A;  3C1M A;  4JZ9 A;  2RD5 A;  3L76 A;  3ZZI A;  3D40 A;  2R8V A;  2J0W A;  1B7B A;  2J4L A;  4NDP B;  3D41 A;  2V5H A;  4A7X A;  2BUF A;  2VA1 A;  4Q1T A;  2J4K A;  3D2P A;  2IJ9 A;  2X2W A;  3U6U A;  2AKO A;  2BTY A;  3TVI A;  4JZ8 A;  2HMF A;  2WXB A;  1GS5 A;  2J5V A;  3NWY A;  2BNE A;  2A1F A;  3ZZG A;  3QVF A;  3S6K A;  4NDQ A;  1GSJ A;  4NDR A;  2J4J A;  3AB2 A;  3LL5 A;  3QVH A; 
#chains in the Genus database with same CATH homology
 2JJ4 A;  4A7W A;  2BRI A;  2AP9 A;  3C1N A;  2OGX A;  3AAW A;  1OHA A;  3ZZH A;  3T7B A;  2R98 A;  4I49 A;  2BRX A;  1OH9 A;  1OHB A;  4F6T B;  2JI5 A;  1E19 A;  3WWN A;  4NDO A;  3C20 A;  4NDR B;  3L86 A;  4OLC A;  3KZF A;  3D2M A;  2WE4 A;  2E9Y A;  3QUO A;  3EK6 A;  4KZT A;  2JJX A;  2W21 A;  2J5T A;  3LKK A;  3K4Y A;  3QUN A;  3K4O A;  3QUR A;  3WWM A;  3EK5 A;  2BNF A;  3K56 A;  4NDQ B;  3B8G A;  3K52 A;  1Z9D A;  4NDP A;  4NDO B;  3S6H A;  2WE5 A;  3AB4 A;  4USJ A;  2BND A;  4AXS A;  3S6G A;  3LL9 A;  2OGX B;  2V4Y A;  2CDQ A;  2J0X A;  4JZ7 A;  1YBD A;  3ZZF A;  4F6T A;  2BMU A;  4AB7 A;  3C1M A;  4JZ9 A;  2RD5 A;  3L76 A;  3ZZI A;  3D40 A;  2R8V A;  2J0W A;  1B7B A;  2J4L A;  4NDP B;  3D41 A;  2V5H A;  4A7X A;  2BUF A;  2VA1 A;  4Q1T A;  2J4K A;  3D2P A;  2IJ9 A;  2X2W A;  3U6U A;  2AKO A;  2BTY A;  3TVI A;  4JZ8 A;  2HMF A;  2WXB A;  1GS5 A;  2J5V A;  3NWY A;  2BNE A;  2A1F A;  3ZZG A;  3QVF A;  3S6K A;  4NDQ A;  1GSJ A;  4NDR A;  2J4J A;  3AB2 A;  3LL5 A;  3QVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...