3EK6A

Unique gtp-binding pocket and allostery of ump kinase from a gram-negative phytopathogen bacterium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
243
structure length
243
Chain Sequence
b'SNAMSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVALVIGGGNIFRGAGLAASGMDRVTGDHMGMLATVINALAMQDALEKLGAKVRVMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRAIEIGADLLLKATKVDGVYDKDPKKHSDAVRYDSLTYDEVIMQGLEVMDTAAFALARDSDLPLRIFGMSEPGVLLRILHGAQIGTLVQGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate kinase
publication title Unique GTP-Binding Pocket and Allostery of Uridylate Kinase from a Gram-Negative Phytopathogenic Bacterium
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 80
structure length 243
sequence length 243
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3ek6A00
1GSJA 2BNEA 2J4LA 3B8GA 4A7WA 2BNFA 3S6KA 4A7XA 4USJA 3S6HA 3K4OA 3C1NA 3LKKA 2JJXA 2AP9A 4JZ9A 3L76A 4I49A 1B7BA 3C20A 1Z9DA 2J5VA 3D40A 3QVFA 3QUNA 2RD5A 2IJ9A 3QUOA 2J0XA 1YBDA 3K56A 3QURA 4F6TA 2WXBA 3LL9A 3WWNA 2V5HA 4NDQA 3ZZIA 2AKOA 2J5TA 2OGXB 2BNDA 2HMFA 3AB4A 3EK6A 4JZ7A 4NDPB 4JZ8A 4NDRA 2J0WA 3C1MA 4F6TB 2WE5A 3EK5A 1E19A 2J4KA 2A1FA 4NDQB 3U6UA 2BTYA 2VA1A 2OGXA 4NDRB 2BMUA 3WWMA 3K4YA 4NDPA 2BRIA 4KZTA 3D2PA 4NDOB 2R8VA 2BRXA 3ZZHA 2CDQA 3AAWA 4AB7A 3ZZFA 1OHAA 4Q1TA 3D2MA 3K52A 3S6GA 4NDOA 3D41A 1GS5A 2W21A 3NWYA 2WE4A 2E9YA 3AB2A 3TVIA 1OHBA 2J4JA 2X2WA 1OH9A 2BUFA 2R98A 2V4YA 2JJ4A 3KZFA 3T7BA 4AXSA 3LL5A 3L86A 3QVHA 2JI5A 3ZZGA 4OLCA
chains in the Genus database with same CATH superfamily
1GSJA 2BNEA 2J4LA 3B8GA 4A7WA 2BNFA 3S6KA 4A7XA 4USJA 3S6HA 3K4OA 3C1NA 3LKKA 2JJXA 2AP9A 4JZ9A 3L76A 4I49A 1B7BA 3C20A 1Z9DA 2J5VA 3D40A 3QVFA 3QUNA 2RD5A 2IJ9A 3QUOA 2J0XA 1YBDA 3K56A 3QURA 4F6TA 2WXBA 3LL9A 3WWNA 2V5HA 4NDQA 3ZZIA 2AKOA 2J5TA 2OGXB 2BNDA 2HMFA 3AB4A 3EK6A 4JZ7A 4NDPB 4JZ8A 4NDRA 2J0WA 3C1MA 4F6TB 2WE5A 3EK5A 1E19A 2J4KA 2A1FA 4NDQB 3U6UA 2BTYA 2VA1A 2OGXA 4NDRB 2BMUA 3WWMA 3K4YA 4NDPA 2BRIA 4KZTA 3D2PA 4NDOB 2R8VA 2BRXA 3ZZHA 2CDQA 3AAWA 4AB7A 3ZZFA 1OHAA 4Q1TA 3D2MA 3K52A 3S6GA 4NDOA 3D41A 1GS5A 2W21A 3NWYA 2WE4A 2E9YA 3AB2A 3TVIA 1OHBA 2J4JA 2X2WA 1OH9A 2BUFA 2R98A 2V4YA 2JJ4A 3KZFA 3T7BA 4AXSA 3LL5A 3L86A 3QVHA 2JI5A 3ZZGA 4OLCA
chains in the Genus database with same CATH topology
1GSJA 2BNEA 2J4LA 3B8GA 4A7WA 2BNFA 3S6KA 4A7XA 4USJA 3S6HA 3K4OA 3C1NA 3LKKA 2JJXA 2AP9A 4JZ9A 3L76A 4I49A 1B7BA 3C20A 1Z9DA 2J5VA 3D40A 3QVFA 3QUNA 2RD5A 2IJ9A 3QUOA 2J0XA 1YBDA 3K56A 3QURA 4F6TA 2WXBA 3LL9A 3WWNA 2V5HA 4NDQA 3ZZIA 2AKOA 2J5TA 2OGXB 2BNDA 2HMFA 3AB4A 3EK6A 4JZ7A 4NDPB 4JZ8A 4NDRA 2J0WA 3C1MA 4F6TB 2WE5A 3EK5A 1E19A 2J4KA 2A1FA 4NDQB 3U6UA 2BTYA 2VA1A 2OGXA 4NDRB 2BMUA 3WWMA 3K4YA 4NDPA 2BRIA 4KZTA 3D2PA 4NDOB 2R8VA 2BRXA 3ZZHA 2CDQA 3AAWA 4AB7A 3ZZFA 1OHAA 4Q1TA 3D2MA 3K52A 3S6GA 4NDOA 3D41A 1GS5A 2W21A 3NWYA 2WE4A 2E9YA 3AB2A 3TVIA 1OHBA 2J4JA 2X2WA 1OH9A 2BUFA 2R98A 2V4YA 2JJ4A 3KZFA 3T7BA 4AXSA 3LL5A 3L86A 3QVHA 2JI5A 3ZZGA 4OLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSJ A;  2BNE A;  2J4L A;  3B8G A;  4A7W A;  2BNF A;  3S6K A;  4A7X A;  4USJ A;  3S6H A;  3K4O A;  3C1N A;  3LKK A;  2JJX A;  2AP9 A;  4JZ9 A;  3L76 A;  4I49 A;  1B7B A;  3C20 A;  1Z9D A;  2J5V A;  3D40 A;  3QVF A;  3QUN A;  2RD5 A;  2IJ9 A;  3QUO A;  2J0X A;  1YBD A;  3K56 A;  3QUR A;  4F6T A;  2WXB A;  3LL9 A;  3WWN A;  2V5H A;  4NDQ A;  3ZZI A;  2AKO A;  2J5T A;  2OGX B;  2BND A;  2HMF A;  3AB4 A;  3EK6 A;  4JZ7 A;  4NDP B;  4JZ8 A;  4NDR A;  2J0W A;  3C1M A;  4F6T B;  2WE5 A;  3EK5 A;  1E19 A;  2J4K A;  2A1F A;  4NDQ B;  3U6U A;  2BTY A;  2VA1 A;  2OGX A;  4NDR B;  2BMU A;  3WWM A;  3K4Y A;  4NDP A;  2BRI A;  4KZT A;  3D2P A;  4NDO B;  2R8V A;  2BRX A;  3ZZH A;  2CDQ A;  3AAW A;  4AB7 A;  3ZZF A;  1OHA A;  4Q1T A;  3D2M A;  3K52 A;  3S6G A;  4NDO A;  3D41 A;  1GS5 A;  2W21 A;  3NWY A;  2WE4 A;  2E9Y A;  3AB2 A;  3TVI A;  1OHB A;  2J4J A;  2X2W A;  1OH9 A;  2BUF A;  2R98 A;  2V4Y A;  2JJ4 A;  3KZF A;  3T7B A;  4AXS A;  3LL5 A;  3L86 A;  3QVH A;  2JI5 A;  3ZZG A;  4OLC A; 
#chains in the Genus database with same CATH topology
 1GSJ A;  2BNE A;  2J4L A;  3B8G A;  4A7W A;  2BNF A;  3S6K A;  4A7X A;  4USJ A;  3S6H A;  3K4O A;  3C1N A;  3LKK A;  2JJX A;  2AP9 A;  4JZ9 A;  3L76 A;  4I49 A;  1B7B A;  3C20 A;  1Z9D A;  2J5V A;  3D40 A;  3QVF A;  3QUN A;  2RD5 A;  2IJ9 A;  3QUO A;  2J0X A;  1YBD A;  3K56 A;  3QUR A;  4F6T A;  2WXB A;  3LL9 A;  3WWN A;  2V5H A;  4NDQ A;  3ZZI A;  2AKO A;  2J5T A;  2OGX B;  2BND A;  2HMF A;  3AB4 A;  3EK6 A;  4JZ7 A;  4NDP B;  4JZ8 A;  4NDR A;  2J0W A;  3C1M A;  4F6T B;  2WE5 A;  3EK5 A;  1E19 A;  2J4K A;  2A1F A;  4NDQ B;  3U6U A;  2BTY A;  2VA1 A;  2OGX A;  4NDR B;  2BMU A;  3WWM A;  3K4Y A;  4NDP A;  2BRI A;  4KZT A;  3D2P A;  4NDO B;  2R8V A;  2BRX A;  3ZZH A;  2CDQ A;  3AAW A;  4AB7 A;  3ZZF A;  1OHA A;  4Q1T A;  3D2M A;  3K52 A;  3S6G A;  4NDO A;  3D41 A;  1GS5 A;  2W21 A;  3NWY A;  2WE4 A;  2E9Y A;  3AB2 A;  3TVI A;  1OHB A;  2J4J A;  2X2W A;  1OH9 A;  2BUF A;  2R98 A;  2V4Y A;  2JJ4 A;  3KZF A;  3T7B A;  4AXS A;  3LL5 A;  3L86 A;  3QVH A;  2JI5 A;  3ZZG A;  4OLC A; 
#chains in the Genus database with same CATH homology
 1GSJ A;  2BNE A;  2J4L A;  3B8G A;  4A7W A;  2BNF A;  3S6K A;  4A7X A;  4USJ A;  3S6H A;  3K4O A;  3C1N A;  3LKK A;  2JJX A;  2AP9 A;  4JZ9 A;  3L76 A;  4I49 A;  1B7B A;  3C20 A;  1Z9D A;  2J5V A;  3D40 A;  3QVF A;  3QUN A;  2RD5 A;  2IJ9 A;  3QUO A;  2J0X A;  1YBD A;  3K56 A;  3QUR A;  4F6T A;  2WXB A;  3LL9 A;  3WWN A;  2V5H A;  4NDQ A;  3ZZI A;  2AKO A;  2J5T A;  2OGX B;  2BND A;  2HMF A;  3AB4 A;  3EK6 A;  4JZ7 A;  4NDP B;  4JZ8 A;  4NDR A;  2J0W A;  3C1M A;  4F6T B;  2WE5 A;  3EK5 A;  1E19 A;  2J4K A;  2A1F A;  4NDQ B;  3U6U A;  2BTY A;  2VA1 A;  2OGX A;  4NDR B;  2BMU A;  3WWM A;  3K4Y A;  4NDP A;  2BRI A;  4KZT A;  3D2P A;  4NDO B;  2R8V A;  2BRX A;  3ZZH A;  2CDQ A;  3AAW A;  4AB7 A;  3ZZF A;  1OHA A;  4Q1T A;  3D2M A;  3K52 A;  3S6G A;  4NDO A;  3D41 A;  1GS5 A;  2W21 A;  3NWY A;  2WE4 A;  2E9Y A;  3AB2 A;  3TVI A;  1OHB A;  2J4J A;  2X2W A;  1OH9 A;  2BUF A;  2R98 A;  2V4Y A;  2JJ4 A;  3KZF A;  3T7B A;  4AXS A;  3LL5 A;  3L86 A;  3QVH A;  2JI5 A;  3ZZG A;  4OLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...