3T7BA

Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
255
Chain Sequence
AMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGGCLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCLADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQAATALAATLGADLILLSDVSGILDQRIAEMTAQKAEQLIAQGIITDGMVVKVNAALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylglutamate kinase
publication title Crystal Structure of N-acetyl-L-glutamate kinase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 76
structure length 255
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3t7bA00
4AB7A 2W21A 4NDRA 2HMFA 4NDQB 3D41A 3ZZHA 4OLCA 2J0WA 3EK5A 1OH9A 3QUOA 3EK6A 2BNEA 1YBDA 2A1FA 4F6TB 3K4YA 3D2MA 4Q1TA 4I49A 3T7BA 2IJ9A 3LL9A 2OGXB 4KZTA 4AXSA 3D2PA 3QVHA 2BNFA 4NDOB 3TVIA 2V4YA 4NDPA 3LKKA 2JJ4A 2VA1A 4JZ7A 3AAWA 4NDRB 2J4LA 2WXBA 1B7BA 3LL5A 3D40A 2J4KA 4USJA 3C20A 3S6GA 2WE4A 2J4JA 2J5TA 3KZFA 3K56A 3ZZIA 1OHAA 1Z9DA 2WE5A 2X2WA 2BNDA 3L76A 2AKOA 3WWMA 4JZ8A 3C1NA 2J0XA 4A7XA 3QUNA 3S6HA 2V5HA 3QURA 2JJXA 3L86A 4NDPB 1GSJA 3C1MA 2BMUA 3U6UA 3B8GA 2JI5A 2BRXA 3ZZGA 1OHBA 4NDQA 2J5VA 2BRIA 4JZ9A 2AP9A 4F6TA 2CDQA 3S6KA 1GS5A 3K52A 2RD5A 2E9YA 2OGXA 3AB4A 3NWYA 2R8VA 2BUFA 2BTYA 3K4OA 3AB2A 4NDOA 3ZZFA 4A7WA 1E19A 3QVFA 3WWNA 2R98A
chains in the Genus database with same CATH superfamily
4AB7A 2W21A 4NDRA 2HMFA 4NDQB 3D41A 3ZZHA 4OLCA 2J0WA 3EK5A 1OH9A 3QUOA 3EK6A 2BNEA 1YBDA 2A1FA 4F6TB 3K4YA 3D2MA 4Q1TA 4I49A 3T7BA 2IJ9A 3LL9A 2OGXB 4KZTA 4AXSA 3D2PA 3QVHA 2BNFA 4NDOB 3TVIA 2V4YA 4NDPA 3LKKA 2JJ4A 2VA1A 4JZ7A 3AAWA 4NDRB 2J4LA 2WXBA 1B7BA 3LL5A 3D40A 2J4KA 4USJA 3C20A 3S6GA 2WE4A 2J4JA 2J5TA 3KZFA 3K56A 3ZZIA 1OHAA 1Z9DA 2WE5A 2X2WA 2BNDA 3L76A 2AKOA 3WWMA 4JZ8A 3C1NA 2J0XA 4A7XA 3QUNA 3S6HA 2V5HA 3QURA 2JJXA 3L86A 4NDPB 1GSJA 3C1MA 2BMUA 3U6UA 3B8GA 2JI5A 2BRXA 3ZZGA 1OHBA 4NDQA 2J5VA 2BRIA 4JZ9A 2AP9A 4F6TA 2CDQA 3S6KA 1GS5A 3K52A 2RD5A 2E9YA 2OGXA 3AB4A 3NWYA 2R8VA 2BUFA 2BTYA 3K4OA 3AB2A 4NDOA 3ZZFA 4A7WA 1E19A 3QVFA 3WWNA 2R98A
chains in the Genus database with same CATH topology
4AB7A 2W21A 4NDRA 2HMFA 4NDQB 3D41A 3ZZHA 4OLCA 2J0WA 3EK5A 1OH9A 3QUOA 3EK6A 2BNEA 1YBDA 2A1FA 4F6TB 3K4YA 3D2MA 4Q1TA 4I49A 3T7BA 2IJ9A 3LL9A 2OGXB 4KZTA 4AXSA 3D2PA 3QVHA 2BNFA 4NDOB 3TVIA 2V4YA 4NDPA 3LKKA 2JJ4A 2VA1A 4JZ7A 3AAWA 4NDRB 2J4LA 2WXBA 1B7BA 3LL5A 3D40A 2J4KA 4USJA 3C20A 3S6GA 2WE4A 2J4JA 2J5TA 3KZFA 3K56A 3ZZIA 1OHAA 1Z9DA 2WE5A 2X2WA 2BNDA 3L76A 2AKOA 3WWMA 4JZ8A 3C1NA 2J0XA 4A7XA 3QUNA 3S6HA 2V5HA 3QURA 2JJXA 3L86A 4NDPB 1GSJA 3C1MA 2BMUA 3U6UA 3B8GA 2JI5A 2BRXA 3ZZGA 1OHBA 4NDQA 2J5VA 2BRIA 4JZ9A 2AP9A 4F6TA 2CDQA 3S6KA 1GS5A 3K52A 2RD5A 2E9YA 2OGXA 3AB4A 3NWYA 2R8VA 2BUFA 2BTYA 3K4OA 3AB2A 4NDOA 3ZZFA 4A7WA 1E19A 3QVFA 3WWNA 2R98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AB7 A;  2W21 A;  4NDR A;  2HMF A;  4NDQ B;  3D41 A;  3ZZH A;  4OLC A;  2J0W A;  3EK5 A;  1OH9 A;  3QUO A;  3EK6 A;  2BNE A;  1YBD A;  2A1F A;  4F6T B;  3K4Y A;  3D2M A;  4Q1T A;  4I49 A;  3T7B A;  2IJ9 A;  3LL9 A;  2OGX B;  4KZT A;  4AXS A;  3D2P A;  3QVH A;  2BNF A;  4NDO B;  3TVI A;  2V4Y A;  4NDP A;  3LKK A;  2JJ4 A;  2VA1 A;  4JZ7 A;  3AAW A;  4NDR B;  2J4L A;  2WXB A;  1B7B A;  3LL5 A;  3D40 A;  2J4K A;  4USJ A;  3C20 A;  3S6G A;  2WE4 A;  2J4J A;  2J5T A;  3KZF A;  3K56 A;  3ZZI A;  1OHA A;  1Z9D A;  2WE5 A;  2X2W A;  2BND A;  3L76 A;  2AKO A;  3WWM A;  4JZ8 A;  3C1N A;  2J0X A;  4A7X A;  3QUN A;  3S6H A;  2V5H A;  3QUR A;  2JJX A;  3L86 A;  4NDP B;  1GSJ A;  3C1M A;  2BMU A;  3U6U A;  3B8G A;  2JI5 A;  2BRX A;  3ZZG A;  1OHB A;  4NDQ A;  2J5V A;  2BRI A;  4JZ9 A;  2AP9 A;  4F6T A;  2CDQ A;  3S6K A;  1GS5 A;  3K52 A;  2RD5 A;  2E9Y A;  2OGX A;  3AB4 A;  3NWY A;  2R8V A;  2BUF A;  2BTY A;  3K4O A;  3AB2 A;  4NDO A;  3ZZF A;  4A7W A;  1E19 A;  3QVF A;  3WWN A;  2R98 A; 
#chains in the Genus database with same CATH topology
 4AB7 A;  2W21 A;  4NDR A;  2HMF A;  4NDQ B;  3D41 A;  3ZZH A;  4OLC A;  2J0W A;  3EK5 A;  1OH9 A;  3QUO A;  3EK6 A;  2BNE A;  1YBD A;  2A1F A;  4F6T B;  3K4Y A;  3D2M A;  4Q1T A;  4I49 A;  3T7B A;  2IJ9 A;  3LL9 A;  2OGX B;  4KZT A;  4AXS A;  3D2P A;  3QVH A;  2BNF A;  4NDO B;  3TVI A;  2V4Y A;  4NDP A;  3LKK A;  2JJ4 A;  2VA1 A;  4JZ7 A;  3AAW A;  4NDR B;  2J4L A;  2WXB A;  1B7B A;  3LL5 A;  3D40 A;  2J4K A;  4USJ A;  3C20 A;  3S6G A;  2WE4 A;  2J4J A;  2J5T A;  3KZF A;  3K56 A;  3ZZI A;  1OHA A;  1Z9D A;  2WE5 A;  2X2W A;  2BND A;  3L76 A;  2AKO A;  3WWM A;  4JZ8 A;  3C1N A;  2J0X A;  4A7X A;  3QUN A;  3S6H A;  2V5H A;  3QUR A;  2JJX A;  3L86 A;  4NDP B;  1GSJ A;  3C1M A;  2BMU A;  3U6U A;  3B8G A;  2JI5 A;  2BRX A;  3ZZG A;  1OHB A;  4NDQ A;  2J5V A;  2BRI A;  4JZ9 A;  2AP9 A;  4F6T A;  2CDQ A;  3S6K A;  1GS5 A;  3K52 A;  2RD5 A;  2E9Y A;  2OGX A;  3AB4 A;  3NWY A;  2R8V A;  2BUF A;  2BTY A;  3K4O A;  3AB2 A;  4NDO A;  3ZZF A;  4A7W A;  1E19 A;  3QVF A;  3WWN A;  2R98 A; 
#chains in the Genus database with same CATH homology
 4AB7 A;  2W21 A;  4NDR A;  2HMF A;  4NDQ B;  3D41 A;  3ZZH A;  4OLC A;  2J0W A;  3EK5 A;  1OH9 A;  3QUO A;  3EK6 A;  2BNE A;  1YBD A;  2A1F A;  4F6T B;  3K4Y A;  3D2M A;  4Q1T A;  4I49 A;  3T7B A;  2IJ9 A;  3LL9 A;  2OGX B;  4KZT A;  4AXS A;  3D2P A;  3QVH A;  2BNF A;  4NDO B;  3TVI A;  2V4Y A;  4NDP A;  3LKK A;  2JJ4 A;  2VA1 A;  4JZ7 A;  3AAW A;  4NDR B;  2J4L A;  2WXB A;  1B7B A;  3LL5 A;  3D40 A;  2J4K A;  4USJ A;  3C20 A;  3S6G A;  2WE4 A;  2J4J A;  2J5T A;  3KZF A;  3K56 A;  3ZZI A;  1OHA A;  1Z9D A;  2WE5 A;  2X2W A;  2BND A;  3L76 A;  2AKO A;  3WWM A;  4JZ8 A;  3C1N A;  2J0X A;  4A7X A;  3QUN A;  3S6H A;  2V5H A;  3QUR A;  2JJX A;  3L86 A;  4NDP B;  1GSJ A;  3C1M A;  2BMU A;  3U6U A;  3B8G A;  2JI5 A;  2BRX A;  3ZZG A;  1OHB A;  4NDQ A;  2J5V A;  2BRI A;  4JZ9 A;  2AP9 A;  4F6T A;  2CDQ A;  3S6K A;  1GS5 A;  3K52 A;  2RD5 A;  2E9Y A;  2OGX A;  3AB4 A;  3NWY A;  2R8V A;  2BUF A;  2BTY A;  3K4O A;  3AB2 A;  4NDO A;  3ZZF A;  4A7W A;  1E19 A;  3QVF A;  3WWN A;  2R98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...