3T7BA

Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
255
Chain Sequence
AMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGGCLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCLADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQAATALAATLGADLILLSDVSGILDQRIAEMTAQKAEQLIAQGIITDGMVVKVNAALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of N-acetyl-L-glutamate kinase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords Acetylglutamate kinase
total genus 76
structure length 255
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3t7bA00
2JJ4A 3K4OA 4NDOA 2A1FA 3D2MA 3LL5A 4NDOB 2WE4A 3K56A 2W21A 4NDQA 3LKKA 4USJA 2X2WA 2J5VA 3QUOA 3U6UA 1OHBA 2OGXB 3AB2A 2RD5A 3L86A 3ZZGA 2E9YA 2WE5A 4NDPA 4NDQB 4JZ8A 4F6TA 4F6TB 4NDPB 2J4JA 3D40A 3NWYA 3KZFA 2WXBA 2AKOA 2OGXA 3ZZIA 2J5TA 2BNFA 2BUFA 4KZTA 3S6HA 2BRXA 3S6KA 2BTYA 2CDQA 2IJ9A 3T7BA 4AXSA 2R8VA 1Z9DA 4Q1TA 4NDRB 3S6GA 2JI5A 1B7BA 2J0XA 3K4YA 3QURA 2JJXA 2VA1A 4AB7A 2V5HA 4OLCA 4JZ9A 2BRIA 1GSJA 3L76A 3QVFA 3ZZFA 3EK5A 3D41A 3QUNA 2J4KA 3C1MA 2J0WA 4A7XA 2BNEA 3WWNA 4NDRA 3B8GA 1YBDA 2R98A 2BNDA 3C20A 3K52A 1GS5A 3QVHA 3EK6A 4A7WA 2HMFA 2BMUA 1OH9A 3AB4A 3AAWA 1E19A 3WWMA 3TVIA 4JZ7A 2AP9A 4I49A 3C1NA 2V4YA 1OHAA 2J4LA 3ZZHA 3LL9A 3D2PA
chains in the Genus database with same CATH superfamily
2JJ4A 3K4OA 4NDOA 2A1FA 3D2MA 3LL5A 4NDOB 2WE4A 3K56A 2W21A 4NDQA 3LKKA 4USJA 2X2WA 2J5VA 3QUOA 3U6UA 1OHBA 2OGXB 3AB2A 2RD5A 3L86A 3ZZGA 2E9YA 2WE5A 4NDPA 4NDQB 4JZ8A 4F6TA 4F6TB 4NDPB 2J4JA 3D40A 3NWYA 3KZFA 2WXBA 2AKOA 2OGXA 3ZZIA 2J5TA 2BNFA 2BUFA 4KZTA 3S6HA 2BRXA 3S6KA 2BTYA 2CDQA 2IJ9A 3T7BA 4AXSA 2R8VA 1Z9DA 4Q1TA 4NDRB 3S6GA 2JI5A 1B7BA 2J0XA 3K4YA 3QURA 2JJXA 2VA1A 4AB7A 2V5HA 4OLCA 4JZ9A 2BRIA 1GSJA 3L76A 3QVFA 3ZZFA 3EK5A 3D41A 3QUNA 2J4KA 3C1MA 2J0WA 4A7XA 2BNEA 3WWNA 4NDRA 3B8GA 1YBDA 2R98A 2BNDA 3C20A 3K52A 1GS5A 3QVHA 3EK6A 4A7WA 2HMFA 2BMUA 1OH9A 3AB4A 3AAWA 1E19A 3WWMA 3TVIA 4JZ7A 2AP9A 4I49A 3C1NA 2V4YA 1OHAA 2J4LA 3ZZHA 3LL9A 3D2PA
chains in the Genus database with same CATH topology
2JJ4A 3K4OA 4NDOA 2A1FA 3D2MA 3LL5A 4NDOB 2WE4A 3K56A 2W21A 4NDQA 3LKKA 4USJA 2X2WA 2J5VA 3QUOA 3U6UA 1OHBA 2OGXB 3AB2A 2RD5A 3L86A 3ZZGA 2E9YA 2WE5A 4NDPA 4NDQB 4JZ8A 4F6TA 4F6TB 4NDPB 2J4JA 3D40A 3NWYA 3KZFA 2WXBA 2AKOA 2OGXA 3ZZIA 2J5TA 2BNFA 2BUFA 4KZTA 3S6HA 2BRXA 3S6KA 2BTYA 2CDQA 2IJ9A 3T7BA 4AXSA 2R8VA 1Z9DA 4Q1TA 4NDRB 3S6GA 2JI5A 1B7BA 2J0XA 3K4YA 3QURA 2JJXA 2VA1A 4AB7A 2V5HA 4OLCA 4JZ9A 2BRIA 1GSJA 3L76A 3QVFA 3ZZFA 3EK5A 3D41A 3QUNA 2J4KA 3C1MA 2J0WA 4A7XA 2BNEA 3WWNA 4NDRA 3B8GA 1YBDA 2R98A 2BNDA 3C20A 3K52A 1GS5A 3QVHA 3EK6A 4A7WA 2HMFA 2BMUA 1OH9A 3AB4A 3AAWA 1E19A 3WWMA 3TVIA 4JZ7A 2AP9A 4I49A 3C1NA 2V4YA 1OHAA 2J4LA 3ZZHA 3LL9A 3D2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ4 A;  3K4O A;  4NDO A;  2A1F A;  3D2M A;  3LL5 A;  4NDO B;  2WE4 A;  3K56 A;  2W21 A;  4NDQ A;  3LKK A;  4USJ A;  2X2W A;  2J5V A;  3QUO A;  3U6U A;  1OHB A;  2OGX B;  3AB2 A;  2RD5 A;  3L86 A;  3ZZG A;  2E9Y A;  2WE5 A;  4NDP A;  4NDQ B;  4JZ8 A;  4F6T A;  4F6T B;  4NDP B;  2J4J A;  3D40 A;  3NWY A;  3KZF A;  2WXB A;  2AKO A;  2OGX A;  3ZZI A;  2J5T A;  2BNF A;  2BUF A;  4KZT A;  3S6H A;  2BRX A;  3S6K A;  2BTY A;  2CDQ A;  2IJ9 A;  3T7B A;  4AXS A;  2R8V A;  1Z9D A;  4Q1T A;  4NDR B;  3S6G A;  2JI5 A;  1B7B A;  2J0X A;  3K4Y A;  3QUR A;  2JJX A;  2VA1 A;  4AB7 A;  2V5H A;  4OLC A;  4JZ9 A;  2BRI A;  1GSJ A;  3L76 A;  3QVF A;  3ZZF A;  3EK5 A;  3D41 A;  3QUN A;  2J4K A;  3C1M A;  2J0W A;  4A7X A;  2BNE A;  3WWN A;  4NDR A;  3B8G A;  1YBD A;  2R98 A;  2BND A;  3C20 A;  3K52 A;  1GS5 A;  3QVH A;  3EK6 A;  4A7W A;  2HMF A;  2BMU A;  1OH9 A;  3AB4 A;  3AAW A;  1E19 A;  3WWM A;  3TVI A;  4JZ7 A;  2AP9 A;  4I49 A;  3C1N A;  2V4Y A;  1OHA A;  2J4L A;  3ZZH A;  3LL9 A;  3D2P A; 
#chains in the Genus database with same CATH topology
 2JJ4 A;  3K4O A;  4NDO A;  2A1F A;  3D2M A;  3LL5 A;  4NDO B;  2WE4 A;  3K56 A;  2W21 A;  4NDQ A;  3LKK A;  4USJ A;  2X2W A;  2J5V A;  3QUO A;  3U6U A;  1OHB A;  2OGX B;  3AB2 A;  2RD5 A;  3L86 A;  3ZZG A;  2E9Y A;  2WE5 A;  4NDP A;  4NDQ B;  4JZ8 A;  4F6T A;  4F6T B;  4NDP B;  2J4J A;  3D40 A;  3NWY A;  3KZF A;  2WXB A;  2AKO A;  2OGX A;  3ZZI A;  2J5T A;  2BNF A;  2BUF A;  4KZT A;  3S6H A;  2BRX A;  3S6K A;  2BTY A;  2CDQ A;  2IJ9 A;  3T7B A;  4AXS A;  2R8V A;  1Z9D A;  4Q1T A;  4NDR B;  3S6G A;  2JI5 A;  1B7B A;  2J0X A;  3K4Y A;  3QUR A;  2JJX A;  2VA1 A;  4AB7 A;  2V5H A;  4OLC A;  4JZ9 A;  2BRI A;  1GSJ A;  3L76 A;  3QVF A;  3ZZF A;  3EK5 A;  3D41 A;  3QUN A;  2J4K A;  3C1M A;  2J0W A;  4A7X A;  2BNE A;  3WWN A;  4NDR A;  3B8G A;  1YBD A;  2R98 A;  2BND A;  3C20 A;  3K52 A;  1GS5 A;  3QVH A;  3EK6 A;  4A7W A;  2HMF A;  2BMU A;  1OH9 A;  3AB4 A;  3AAW A;  1E19 A;  3WWM A;  3TVI A;  4JZ7 A;  2AP9 A;  4I49 A;  3C1N A;  2V4Y A;  1OHA A;  2J4L A;  3ZZH A;  3LL9 A;  3D2P A; 
#chains in the Genus database with same CATH homology
 2JJ4 A;  3K4O A;  4NDO A;  2A1F A;  3D2M A;  3LL5 A;  4NDO B;  2WE4 A;  3K56 A;  2W21 A;  4NDQ A;  3LKK A;  4USJ A;  2X2W A;  2J5V A;  3QUO A;  3U6U A;  1OHB A;  2OGX B;  3AB2 A;  2RD5 A;  3L86 A;  3ZZG A;  2E9Y A;  2WE5 A;  4NDP A;  4NDQ B;  4JZ8 A;  4F6T A;  4F6T B;  4NDP B;  2J4J A;  3D40 A;  3NWY A;  3KZF A;  2WXB A;  2AKO A;  2OGX A;  3ZZI A;  2J5T A;  2BNF A;  2BUF A;  4KZT A;  3S6H A;  2BRX A;  3S6K A;  2BTY A;  2CDQ A;  2IJ9 A;  3T7B A;  4AXS A;  2R8V A;  1Z9D A;  4Q1T A;  4NDR B;  3S6G A;  2JI5 A;  1B7B A;  2J0X A;  3K4Y A;  3QUR A;  2JJX A;  2VA1 A;  4AB7 A;  2V5H A;  4OLC A;  4JZ9 A;  2BRI A;  1GSJ A;  3L76 A;  3QVF A;  3ZZF A;  3EK5 A;  3D41 A;  3QUN A;  2J4K A;  3C1M A;  2J0W A;  4A7X A;  2BNE A;  3WWN A;  4NDR A;  3B8G A;  1YBD A;  2R98 A;  2BND A;  3C20 A;  3K52 A;  1GS5 A;  3QVH A;  3EK6 A;  4A7W A;  2HMF A;  2BMU A;  1OH9 A;  3AB4 A;  3AAW A;  1E19 A;  3WWM A;  3TVI A;  4JZ7 A;  2AP9 A;  4I49 A;  3C1N A;  2V4Y A;  1OHA A;  2J4L A;  3ZZH A;  3LL9 A;  3D2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...