3T7BA

Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
255
Chain Sequence
AMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGGCLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCLADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQAATALAATLGADLILLSDVSGILDQRIAEMTAQKAEQLIAQGIITDGMVVKVNAALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetylglutamate kinase
publication title Crystal Structure of N-acetyl-L-glutamate kinase from Yersinia pestis
rcsb
source organism Yersinia pestis
total genus 76
structure length 255
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3t7bA00
4NDQA 3QUOA 3LKKA 2RD5A 2WE4A 4A7WA 3K52A 2J4JA 2BRXA 3LL5A 3QURA 3D2MA 3T7BA 3AAWA 3U6UA 3QUNA 3ZZHA 2HMFA 3QVHA 4JZ8A 2AP9A 2A1FA 4AXSA 3D40A 3ZZIA 2BNEA 3K4YA 3LL9A 3K4OA 4F6TB 1OHAA 2CDQA 3ZZGA 3AB2A 3C1NA 4NDPB 4F6TA 2J4LA 1B7BA 4OLCA 2J0WA 2WXBA 3ZZFA 2JJ4A 4NDPA 3B8GA 4JZ7A 2J5VA 2AKOA 3L76A 2E9YA 1GS5A 3D2PA 2X2WA 4AB7A 2VA1A 3C1MA 1OH9A 4Q1TA 1GSJA 3KZFA 2IJ9A 2BUFA 1OHBA 4A7XA 3K56A 3C20A 2V5HA 3EK6A 3D41A 2R98A 3AB4A 2BRIA 2R8VA 2JI5A 3EK5A 2J0XA 1E19A 2BNDA 1Z9DA 3WWNA 3S6KA 3NWYA 3S6HA 3S6GA 2BNFA 4NDRB 4I49A 2W21A 4NDOB 2WE5A 3L86A 2JJXA 3TVIA 2J4KA 2OGXB 3QVFA 2J5TA 4NDQB 4NDRA 2BMUA 4NDOA 3WWMA 2V4YA 1YBDA 4KZTA 4JZ9A 2OGXA 2BTYA 4USJA
chains in the Genus database with same CATH superfamily
4NDQA 3QUOA 3LKKA 2RD5A 2WE4A 4A7WA 3K52A 2J4JA 2BRXA 3LL5A 3QURA 3D2MA 3T7BA 3AAWA 3U6UA 3QUNA 3ZZHA 2HMFA 3QVHA 4JZ8A 2AP9A 2A1FA 4AXSA 3D40A 3ZZIA 2BNEA 3K4YA 3LL9A 3K4OA 4F6TB 1OHAA 2CDQA 3ZZGA 3AB2A 3C1NA 4NDPB 4F6TA 2J4LA 1B7BA 4OLCA 2J0WA 2WXBA 3ZZFA 2JJ4A 4NDPA 3B8GA 4JZ7A 2J5VA 2AKOA 3L76A 2E9YA 1GS5A 3D2PA 2X2WA 4AB7A 2VA1A 3C1MA 1OH9A 4Q1TA 1GSJA 3KZFA 2IJ9A 2BUFA 1OHBA 4A7XA 3K56A 3C20A 2V5HA 3EK6A 3D41A 2R98A 3AB4A 2BRIA 2R8VA 2JI5A 3EK5A 2J0XA 1E19A 2BNDA 1Z9DA 3WWNA 3S6KA 3NWYA 3S6HA 3S6GA 2BNFA 4NDRB 4I49A 2W21A 4NDOB 2WE5A 3L86A 2JJXA 3TVIA 2J4KA 2OGXB 3QVFA 2J5TA 4NDQB 4NDRA 2BMUA 4NDOA 3WWMA 2V4YA 1YBDA 4KZTA 4JZ9A 2OGXA 2BTYA 4USJA
chains in the Genus database with same CATH topology
4NDQA 3QUOA 3LKKA 2RD5A 2WE4A 4A7WA 3K52A 2J4JA 2BRXA 3LL5A 3QURA 3D2MA 3T7BA 3AAWA 3U6UA 3QUNA 3ZZHA 2HMFA 3QVHA 4JZ8A 2AP9A 2A1FA 4AXSA 3D40A 3ZZIA 2BNEA 3K4YA 3LL9A 3K4OA 4F6TB 1OHAA 2CDQA 3ZZGA 3AB2A 3C1NA 4NDPB 4F6TA 2J4LA 1B7BA 4OLCA 2J0WA 2WXBA 3ZZFA 2JJ4A 4NDPA 3B8GA 4JZ7A 2J5VA 2AKOA 3L76A 2E9YA 1GS5A 3D2PA 2X2WA 4AB7A 2VA1A 3C1MA 1OH9A 4Q1TA 1GSJA 3KZFA 2IJ9A 2BUFA 1OHBA 4A7XA 3K56A 3C20A 2V5HA 3EK6A 3D41A 2R98A 3AB4A 2BRIA 2R8VA 2JI5A 3EK5A 2J0XA 1E19A 2BNDA 1Z9DA 3WWNA 3S6KA 3NWYA 3S6HA 3S6GA 2BNFA 4NDRB 4I49A 2W21A 4NDOB 2WE5A 3L86A 2JJXA 3TVIA 2J4KA 2OGXB 3QVFA 2J5TA 4NDQB 4NDRA 2BMUA 4NDOA 3WWMA 2V4YA 1YBDA 4KZTA 4JZ9A 2OGXA 2BTYA 4USJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDQ A;  3QUO A;  3LKK A;  2RD5 A;  2WE4 A;  4A7W A;  3K52 A;  2J4J A;  2BRX A;  3LL5 A;  3QUR A;  3D2M A;  3T7B A;  3AAW A;  3U6U A;  3QUN A;  3ZZH A;  2HMF A;  3QVH A;  4JZ8 A;  2AP9 A;  2A1F A;  4AXS A;  3D40 A;  3ZZI A;  2BNE A;  3K4Y A;  3LL9 A;  3K4O A;  4F6T B;  1OHA A;  2CDQ A;  3ZZG A;  3AB2 A;  3C1N A;  4NDP B;  4F6T A;  2J4L A;  1B7B A;  4OLC A;  2J0W A;  2WXB A;  3ZZF A;  2JJ4 A;  4NDP A;  3B8G A;  4JZ7 A;  2J5V A;  2AKO A;  3L76 A;  2E9Y A;  1GS5 A;  3D2P A;  2X2W A;  4AB7 A;  2VA1 A;  3C1M A;  1OH9 A;  4Q1T A;  1GSJ A;  3KZF A;  2IJ9 A;  2BUF A;  1OHB A;  4A7X A;  3K56 A;  3C20 A;  2V5H A;  3EK6 A;  3D41 A;  2R98 A;  3AB4 A;  2BRI A;  2R8V A;  2JI5 A;  3EK5 A;  2J0X A;  1E19 A;  2BND A;  1Z9D A;  3WWN A;  3S6K A;  3NWY A;  3S6H A;  3S6G A;  2BNF A;  4NDR B;  4I49 A;  2W21 A;  4NDO B;  2WE5 A;  3L86 A;  2JJX A;  3TVI A;  2J4K A;  2OGX B;  3QVF A;  2J5T A;  4NDQ B;  4NDR A;  2BMU A;  4NDO A;  3WWM A;  2V4Y A;  1YBD A;  4KZT A;  4JZ9 A;  2OGX A;  2BTY A;  4USJ A; 
#chains in the Genus database with same CATH topology
 4NDQ A;  3QUO A;  3LKK A;  2RD5 A;  2WE4 A;  4A7W A;  3K52 A;  2J4J A;  2BRX A;  3LL5 A;  3QUR A;  3D2M A;  3T7B A;  3AAW A;  3U6U A;  3QUN A;  3ZZH A;  2HMF A;  3QVH A;  4JZ8 A;  2AP9 A;  2A1F A;  4AXS A;  3D40 A;  3ZZI A;  2BNE A;  3K4Y A;  3LL9 A;  3K4O A;  4F6T B;  1OHA A;  2CDQ A;  3ZZG A;  3AB2 A;  3C1N A;  4NDP B;  4F6T A;  2J4L A;  1B7B A;  4OLC A;  2J0W A;  2WXB A;  3ZZF A;  2JJ4 A;  4NDP A;  3B8G A;  4JZ7 A;  2J5V A;  2AKO A;  3L76 A;  2E9Y A;  1GS5 A;  3D2P A;  2X2W A;  4AB7 A;  2VA1 A;  3C1M A;  1OH9 A;  4Q1T A;  1GSJ A;  3KZF A;  2IJ9 A;  2BUF A;  1OHB A;  4A7X A;  3K56 A;  3C20 A;  2V5H A;  3EK6 A;  3D41 A;  2R98 A;  3AB4 A;  2BRI A;  2R8V A;  2JI5 A;  3EK5 A;  2J0X A;  1E19 A;  2BND A;  1Z9D A;  3WWN A;  3S6K A;  3NWY A;  3S6H A;  3S6G A;  2BNF A;  4NDR B;  4I49 A;  2W21 A;  4NDO B;  2WE5 A;  3L86 A;  2JJX A;  3TVI A;  2J4K A;  2OGX B;  3QVF A;  2J5T A;  4NDQ B;  4NDR A;  2BMU A;  4NDO A;  3WWM A;  2V4Y A;  1YBD A;  4KZT A;  4JZ9 A;  2OGX A;  2BTY A;  4USJ A; 
#chains in the Genus database with same CATH homology
 4NDQ A;  3QUO A;  3LKK A;  2RD5 A;  2WE4 A;  4A7W A;  3K52 A;  2J4J A;  2BRX A;  3LL5 A;  3QUR A;  3D2M A;  3T7B A;  3AAW A;  3U6U A;  3QUN A;  3ZZH A;  2HMF A;  3QVH A;  4JZ8 A;  2AP9 A;  2A1F A;  4AXS A;  3D40 A;  3ZZI A;  2BNE A;  3K4Y A;  3LL9 A;  3K4O A;  4F6T B;  1OHA A;  2CDQ A;  3ZZG A;  3AB2 A;  3C1N A;  4NDP B;  4F6T A;  2J4L A;  1B7B A;  4OLC A;  2J0W A;  2WXB A;  3ZZF A;  2JJ4 A;  4NDP A;  3B8G A;  4JZ7 A;  2J5V A;  2AKO A;  3L76 A;  2E9Y A;  1GS5 A;  3D2P A;  2X2W A;  4AB7 A;  2VA1 A;  3C1M A;  1OH9 A;  4Q1T A;  1GSJ A;  3KZF A;  2IJ9 A;  2BUF A;  1OHB A;  4A7X A;  3K56 A;  3C20 A;  2V5H A;  3EK6 A;  3D41 A;  2R98 A;  3AB4 A;  2BRI A;  2R8V A;  2JI5 A;  3EK5 A;  2J0X A;  1E19 A;  2BND A;  1Z9D A;  3WWN A;  3S6K A;  3NWY A;  3S6H A;  3S6G A;  2BNF A;  4NDR B;  4I49 A;  2W21 A;  4NDO B;  2WE5 A;  3L86 A;  2JJX A;  3TVI A;  2J4K A;  2OGX B;  3QVF A;  2J5T A;  4NDQ B;  4NDR A;  2BMU A;  4NDO A;  3WWM A;  2V4Y A;  1YBD A;  4KZT A;  4JZ9 A;  2OGX A;  2BTY A;  4USJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...