3T7BA

Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
255
Chain Sequence
b'AMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGGCLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCLADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQAATALAATLGADLILLSDVSGILDQRIAEMTAQKAEQLIAQGIITDGMVVKVNAALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylglutamate kinase
publication title Crystal Structure of N-acetyl-L-glutamate kinase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Transferase
total genus 76
structure length 255
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3t7bA00
3D40A 1B7BA 2J0WA 2J0XA 3AB2A 3LL5A 2J5TA 3TVIA 2OGXB 2A1FA 3EK6A 2JJ4A 3AAWA 3C1NA 4NDQB 2CDQA 2JJXA 4NDRA 2V4YA 2W21A 4A7XA 2J4KA 2J4LA 3EK5A 1Z9DA 4I49A 3LKKA 4AXSA 4F6TB 2RD5A 4USJA 2BUFA 3L76A 3WWMA 3D2PA 2VA1A 2HMFA 1GS5A 3D2MA 4NDPA 3K4YA 2V5HA 4AB7A 4JZ7A 3S6KA 2BNDA 1OHBA 3WWNA 3S6HA 4NDOB 2AP9A 1YBDA 3NWYA 2R8VA 4JZ8A 3T7BA 3B8GA 1E19A 2AKOA 2BRIA 4JZ9A 3K56A 3QUNA 3C20A 4NDQA 3C1MA 3ZZFA 4OLCA 2WE5A 2BNFA 3QUOA 1GSJA 3D41A 1OHAA 3K52A 4NDRB 2WXBA 3K4OA 1OH9A 2J5VA 3QVFA 2IJ9A 2WE4A 2BMUA 2J4JA 4F6TA 2BTYA 2X2WA 3L86A 3AB4A 2E9YA 3S6GA 2BNEA 2JI5A 3QVHA 3LL9A 4KZTA 2OGXA 4NDPB 3U6UA 4Q1TA 4A7WA 2BRXA 3ZZIA 3QURA 2R98A 4NDOA 3KZFA 3ZZHA 3ZZGA
chains in the Genus database with same CATH superfamily
3D40A 1B7BA 2J0WA 2J0XA 3AB2A 3LL5A 2J5TA 3TVIA 2OGXB 2A1FA 3EK6A 2JJ4A 3AAWA 3C1NA 4NDQB 2CDQA 2JJXA 4NDRA 2V4YA 2W21A 4A7XA 2J4KA 2J4LA 3EK5A 1Z9DA 4I49A 3LKKA 4AXSA 4F6TB 2RD5A 4USJA 2BUFA 3L76A 3WWMA 3D2PA 2VA1A 2HMFA 1GS5A 3D2MA 4NDPA 3K4YA 2V5HA 4AB7A 4JZ7A 3S6KA 2BNDA 1OHBA 3WWNA 3S6HA 4NDOB 2AP9A 1YBDA 3NWYA 2R8VA 4JZ8A 3T7BA 3B8GA 1E19A 2AKOA 2BRIA 4JZ9A 3K56A 3QUNA 3C20A 4NDQA 3C1MA 3ZZFA 4OLCA 2WE5A 2BNFA 3QUOA 1GSJA 3D41A 1OHAA 3K52A 4NDRB 2WXBA 3K4OA 1OH9A 2J5VA 3QVFA 2IJ9A 2WE4A 2BMUA 2J4JA 4F6TA 2BTYA 2X2WA 3L86A 3AB4A 2E9YA 3S6GA 2BNEA 2JI5A 3QVHA 3LL9A 4KZTA 2OGXA 4NDPB 3U6UA 4Q1TA 4A7WA 2BRXA 3ZZIA 3QURA 2R98A 4NDOA 3KZFA 3ZZHA 3ZZGA
chains in the Genus database with same CATH topology
3D40A 1B7BA 2J0WA 2J0XA 3AB2A 3LL5A 2J5TA 3TVIA 2OGXB 2A1FA 3EK6A 2JJ4A 3AAWA 3C1NA 4NDQB 2CDQA 2JJXA 4NDRA 2V4YA 2W21A 4A7XA 2J4KA 2J4LA 3EK5A 1Z9DA 4I49A 3LKKA 4AXSA 4F6TB 2RD5A 4USJA 2BUFA 3L76A 3WWMA 3D2PA 2VA1A 2HMFA 1GS5A 3D2MA 4NDPA 3K4YA 2V5HA 4AB7A 4JZ7A 3S6KA 2BNDA 1OHBA 3WWNA 3S6HA 4NDOB 2AP9A 1YBDA 3NWYA 2R8VA 4JZ8A 3T7BA 3B8GA 1E19A 2AKOA 2BRIA 4JZ9A 3K56A 3QUNA 3C20A 4NDQA 3C1MA 3ZZFA 4OLCA 2WE5A 2BNFA 3QUOA 1GSJA 3D41A 1OHAA 3K52A 4NDRB 2WXBA 3K4OA 1OH9A 2J5VA 3QVFA 2IJ9A 2WE4A 2BMUA 2J4JA 4F6TA 2BTYA 2X2WA 3L86A 3AB4A 2E9YA 3S6GA 2BNEA 2JI5A 3QVHA 3LL9A 4KZTA 2OGXA 4NDPB 3U6UA 4Q1TA 4A7WA 2BRXA 3ZZIA 3QURA 2R98A 4NDOA 3KZFA 3ZZHA 3ZZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D40 A;  1B7B A;  2J0W A;  2J0X A;  3AB2 A;  3LL5 A;  2J5T A;  3TVI A;  2OGX B;  2A1F A;  3EK6 A;  2JJ4 A;  3AAW A;  3C1N A;  4NDQ B;  2CDQ A;  2JJX A;  4NDR A;  2V4Y A;  2W21 A;  4A7X A;  2J4K A;  2J4L A;  3EK5 A;  1Z9D A;  4I49 A;  3LKK A;  4AXS A;  4F6T B;  2RD5 A;  4USJ A;  2BUF A;  3L76 A;  3WWM A;  3D2P A;  2VA1 A;  2HMF A;  1GS5 A;  3D2M A;  4NDP A;  3K4Y A;  2V5H A;  4AB7 A;  4JZ7 A;  3S6K A;  2BND A;  1OHB A;  3WWN A;  3S6H A;  4NDO B;  2AP9 A;  1YBD A;  3NWY A;  2R8V A;  4JZ8 A;  3T7B A;  3B8G A;  1E19 A;  2AKO A;  2BRI A;  4JZ9 A;  3K56 A;  3QUN A;  3C20 A;  4NDQ A;  3C1M A;  3ZZF A;  4OLC A;  2WE5 A;  2BNF A;  3QUO A;  1GSJ A;  3D41 A;  1OHA A;  3K52 A;  4NDR B;  2WXB A;  3K4O A;  1OH9 A;  2J5V A;  3QVF A;  2IJ9 A;  2WE4 A;  2BMU A;  2J4J A;  4F6T A;  2BTY A;  2X2W A;  3L86 A;  3AB4 A;  2E9Y A;  3S6G A;  2BNE A;  2JI5 A;  3QVH A;  3LL9 A;  4KZT A;  2OGX A;  4NDP B;  3U6U A;  4Q1T A;  4A7W A;  2BRX A;  3ZZI A;  3QUR A;  2R98 A;  4NDO A;  3KZF A;  3ZZH A;  3ZZG A; 
#chains in the Genus database with same CATH topology
 3D40 A;  1B7B A;  2J0W A;  2J0X A;  3AB2 A;  3LL5 A;  2J5T A;  3TVI A;  2OGX B;  2A1F A;  3EK6 A;  2JJ4 A;  3AAW A;  3C1N A;  4NDQ B;  2CDQ A;  2JJX A;  4NDR A;  2V4Y A;  2W21 A;  4A7X A;  2J4K A;  2J4L A;  3EK5 A;  1Z9D A;  4I49 A;  3LKK A;  4AXS A;  4F6T B;  2RD5 A;  4USJ A;  2BUF A;  3L76 A;  3WWM A;  3D2P A;  2VA1 A;  2HMF A;  1GS5 A;  3D2M A;  4NDP A;  3K4Y A;  2V5H A;  4AB7 A;  4JZ7 A;  3S6K A;  2BND A;  1OHB A;  3WWN A;  3S6H A;  4NDO B;  2AP9 A;  1YBD A;  3NWY A;  2R8V A;  4JZ8 A;  3T7B A;  3B8G A;  1E19 A;  2AKO A;  2BRI A;  4JZ9 A;  3K56 A;  3QUN A;  3C20 A;  4NDQ A;  3C1M A;  3ZZF A;  4OLC A;  2WE5 A;  2BNF A;  3QUO A;  1GSJ A;  3D41 A;  1OHA A;  3K52 A;  4NDR B;  2WXB A;  3K4O A;  1OH9 A;  2J5V A;  3QVF A;  2IJ9 A;  2WE4 A;  2BMU A;  2J4J A;  4F6T A;  2BTY A;  2X2W A;  3L86 A;  3AB4 A;  2E9Y A;  3S6G A;  2BNE A;  2JI5 A;  3QVH A;  3LL9 A;  4KZT A;  2OGX A;  4NDP B;  3U6U A;  4Q1T A;  4A7W A;  2BRX A;  3ZZI A;  3QUR A;  2R98 A;  4NDO A;  3KZF A;  3ZZH A;  3ZZG A; 
#chains in the Genus database with same CATH homology
 3D40 A;  1B7B A;  2J0W A;  2J0X A;  3AB2 A;  3LL5 A;  2J5T A;  3TVI A;  2OGX B;  2A1F A;  3EK6 A;  2JJ4 A;  3AAW A;  3C1N A;  4NDQ B;  2CDQ A;  2JJX A;  4NDR A;  2V4Y A;  2W21 A;  4A7X A;  2J4K A;  2J4L A;  3EK5 A;  1Z9D A;  4I49 A;  3LKK A;  4AXS A;  4F6T B;  2RD5 A;  4USJ A;  2BUF A;  3L76 A;  3WWM A;  3D2P A;  2VA1 A;  2HMF A;  1GS5 A;  3D2M A;  4NDP A;  3K4Y A;  2V5H A;  4AB7 A;  4JZ7 A;  3S6K A;  2BND A;  1OHB A;  3WWN A;  3S6H A;  4NDO B;  2AP9 A;  1YBD A;  3NWY A;  2R8V A;  4JZ8 A;  3T7B A;  3B8G A;  1E19 A;  2AKO A;  2BRI A;  4JZ9 A;  3K56 A;  3QUN A;  3C20 A;  4NDQ A;  3C1M A;  3ZZF A;  4OLC A;  2WE5 A;  2BNF A;  3QUO A;  1GSJ A;  3D41 A;  1OHA A;  3K52 A;  4NDR B;  2WXB A;  3K4O A;  1OH9 A;  2J5V A;  3QVF A;  2IJ9 A;  2WE4 A;  2BMU A;  2J4J A;  4F6T A;  2BTY A;  2X2W A;  3L86 A;  3AB4 A;  2E9Y A;  3S6G A;  2BNE A;  2JI5 A;  3QVH A;  3LL9 A;  4KZT A;  2OGX A;  4NDP B;  3U6U A;  4Q1T A;  4A7W A;  2BRX A;  3ZZI A;  3QUR A;  2R98 A;  4NDO A;  3KZF A;  3ZZH A;  3ZZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...