3T7BA

Crystal structure of n-acetyl-l-glutamate kinase from yersinia pestis
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
258
structure length
255
Chain Sequence
AMNPLVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGGCLVDELMKRLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHQINAVGLCLADGNTVTVTLLDAELGHVGKAQPGSAALVQTLLAAGYMPIISSIGITVEGQLMNVNADQAATALAATLGADLILLSDVSGILDQRIAEMTAQKAEQLIAQGIITDGMVVKVNAALDAARSLGRPVDIASWRHSEQLPALFNGVPIGTRISV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of N-acetyl-L-glutamate kinase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Transferase
molecule keywords Acetylglutamate kinase
total genus 76
structure length 255
sequence length 258
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3t7bA00
3ZZHA 3U6UA 2BMUA 2J4LA 4OLCA 3KZFA 4I49A 3K56A 3K4YA 2V4YA 4NDOA 3QURA 3LL9A 3K52A 3LL5A 4JZ9A 3QUOA 2J5VA 2BRIA 4NDPB 4NDRB 3T7BA 3D2MA 2WE5A 2AP9A 3C1MA 2RD5A 4NDPA 4NDRA 2JJXA 2JJ4A 3EK6A 2J4JA 2J5TA 3QUNA 1OHBA 2WE4A 4AXSA 2X2WA 4AB7A 3ZZIA 2AKOA 3AB2A 3K4OA 3B8GA 4F6TA 3ZZFA 4NDOB 3AAWA 2OGXB 3D40A 4F6TB 4NDQB 3S6GA 1OH9A 3WWMA 2JI5A 2BNDA 1E19A 4A7XA 2BUFA 3D41A 2R98A 3QVHA 3L86A 2IJ9A 1GSJA 3AB4A 4KZTA 1Z9DA 2VA1A 2J0XA 2BRXA 2V5HA 2W21A 3C1NA 4JZ8A 1GS5A 4USJA 4Q1TA 3L76A 4NDQA 4JZ7A 2CDQA 3WWNA 3EK5A 2WXBA 2A1FA 3LKKA 3NWYA 2BNFA 3S6KA 1OHAA 3S6HA 2J4KA 3ZZGA 3D2PA 3QVFA 2R8VA 1YBDA 2J0WA 2BNEA 1B7BA 4A7WA 2HMFA 3C20A 2BTYA 3TVIA 2E9YA 2OGXA
chains in the Genus database with same CATH superfamily
3ZZHA 3U6UA 2BMUA 2J4LA 4OLCA 3KZFA 4I49A 3K56A 3K4YA 2V4YA 4NDOA 3QURA 3LL9A 3K52A 3LL5A 4JZ9A 3QUOA 2J5VA 2BRIA 4NDPB 4NDRB 3T7BA 3D2MA 2WE5A 2AP9A 3C1MA 2RD5A 4NDPA 4NDRA 2JJXA 2JJ4A 3EK6A 2J4JA 2J5TA 3QUNA 1OHBA 2WE4A 4AXSA 2X2WA 4AB7A 3ZZIA 2AKOA 3AB2A 3K4OA 3B8GA 4F6TA 3ZZFA 4NDOB 3AAWA 2OGXB 3D40A 4F6TB 4NDQB 3S6GA 1OH9A 3WWMA 2JI5A 2BNDA 1E19A 4A7XA 2BUFA 3D41A 2R98A 3QVHA 3L86A 2IJ9A 1GSJA 3AB4A 4KZTA 1Z9DA 2VA1A 2J0XA 2BRXA 2V5HA 2W21A 3C1NA 4JZ8A 1GS5A 4USJA 4Q1TA 3L76A 4NDQA 4JZ7A 2CDQA 3WWNA 3EK5A 2WXBA 2A1FA 3LKKA 3NWYA 2BNFA 3S6KA 1OHAA 3S6HA 2J4KA 3ZZGA 3D2PA 3QVFA 2R8VA 1YBDA 2J0WA 2BNEA 1B7BA 4A7WA 2HMFA 3C20A 2BTYA 3TVIA 2E9YA 2OGXA
chains in the Genus database with same CATH topology
3ZZHA 3U6UA 2BMUA 2J4LA 4OLCA 3KZFA 4I49A 3K56A 3K4YA 2V4YA 4NDOA 3QURA 3LL9A 3K52A 3LL5A 4JZ9A 3QUOA 2J5VA 2BRIA 4NDPB 4NDRB 3T7BA 3D2MA 2WE5A 2AP9A 3C1MA 2RD5A 4NDPA 4NDRA 2JJXA 2JJ4A 3EK6A 2J4JA 2J5TA 3QUNA 1OHBA 2WE4A 4AXSA 2X2WA 4AB7A 3ZZIA 2AKOA 3AB2A 3K4OA 3B8GA 4F6TA 3ZZFA 4NDOB 3AAWA 2OGXB 3D40A 4F6TB 4NDQB 3S6GA 1OH9A 3WWMA 2JI5A 2BNDA 1E19A 4A7XA 2BUFA 3D41A 2R98A 3QVHA 3L86A 2IJ9A 1GSJA 3AB4A 4KZTA 1Z9DA 2VA1A 2J0XA 2BRXA 2V5HA 2W21A 3C1NA 4JZ8A 1GS5A 4USJA 4Q1TA 3L76A 4NDQA 4JZ7A 2CDQA 3WWNA 3EK5A 2WXBA 2A1FA 3LKKA 3NWYA 2BNFA 3S6KA 1OHAA 3S6HA 2J4KA 3ZZGA 3D2PA 3QVFA 2R8VA 1YBDA 2J0WA 2BNEA 1B7BA 4A7WA 2HMFA 3C20A 2BTYA 3TVIA 2E9YA 2OGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZH A;  3U6U A;  2BMU A;  2J4L A;  4OLC A;  3KZF A;  4I49 A;  3K56 A;  3K4Y A;  2V4Y A;  4NDO A;  3QUR A;  3LL9 A;  3K52 A;  3LL5 A;  4JZ9 A;  3QUO A;  2J5V A;  2BRI A;  4NDP B;  4NDR B;  3T7B A;  3D2M A;  2WE5 A;  2AP9 A;  3C1M A;  2RD5 A;  4NDP A;  4NDR A;  2JJX A;  2JJ4 A;  3EK6 A;  2J4J A;  2J5T A;  3QUN A;  1OHB A;  2WE4 A;  4AXS A;  2X2W A;  4AB7 A;  3ZZI A;  2AKO A;  3AB2 A;  3K4O A;  3B8G A;  4F6T A;  3ZZF A;  4NDO B;  3AAW A;  2OGX B;  3D40 A;  4F6T B;  4NDQ B;  3S6G A;  1OH9 A;  3WWM A;  2JI5 A;  2BND A;  1E19 A;  4A7X A;  2BUF A;  3D41 A;  2R98 A;  3QVH A;  3L86 A;  2IJ9 A;  1GSJ A;  3AB4 A;  4KZT A;  1Z9D A;  2VA1 A;  2J0X A;  2BRX A;  2V5H A;  2W21 A;  3C1N A;  4JZ8 A;  1GS5 A;  4USJ A;  4Q1T A;  3L76 A;  4NDQ A;  4JZ7 A;  2CDQ A;  3WWN A;  3EK5 A;  2WXB A;  2A1F A;  3LKK A;  3NWY A;  2BNF A;  3S6K A;  1OHA A;  3S6H A;  2J4K A;  3ZZG A;  3D2P A;  3QVF A;  2R8V A;  1YBD A;  2J0W A;  2BNE A;  1B7B A;  4A7W A;  2HMF A;  3C20 A;  2BTY A;  3TVI A;  2E9Y A;  2OGX A; 
#chains in the Genus database with same CATH topology
 3ZZH A;  3U6U A;  2BMU A;  2J4L A;  4OLC A;  3KZF A;  4I49 A;  3K56 A;  3K4Y A;  2V4Y A;  4NDO A;  3QUR A;  3LL9 A;  3K52 A;  3LL5 A;  4JZ9 A;  3QUO A;  2J5V A;  2BRI A;  4NDP B;  4NDR B;  3T7B A;  3D2M A;  2WE5 A;  2AP9 A;  3C1M A;  2RD5 A;  4NDP A;  4NDR A;  2JJX A;  2JJ4 A;  3EK6 A;  2J4J A;  2J5T A;  3QUN A;  1OHB A;  2WE4 A;  4AXS A;  2X2W A;  4AB7 A;  3ZZI A;  2AKO A;  3AB2 A;  3K4O A;  3B8G A;  4F6T A;  3ZZF A;  4NDO B;  3AAW A;  2OGX B;  3D40 A;  4F6T B;  4NDQ B;  3S6G A;  1OH9 A;  3WWM A;  2JI5 A;  2BND A;  1E19 A;  4A7X A;  2BUF A;  3D41 A;  2R98 A;  3QVH A;  3L86 A;  2IJ9 A;  1GSJ A;  3AB4 A;  4KZT A;  1Z9D A;  2VA1 A;  2J0X A;  2BRX A;  2V5H A;  2W21 A;  3C1N A;  4JZ8 A;  1GS5 A;  4USJ A;  4Q1T A;  3L76 A;  4NDQ A;  4JZ7 A;  2CDQ A;  3WWN A;  3EK5 A;  2WXB A;  2A1F A;  3LKK A;  3NWY A;  2BNF A;  3S6K A;  1OHA A;  3S6H A;  2J4K A;  3ZZG A;  3D2P A;  3QVF A;  2R8V A;  1YBD A;  2J0W A;  2BNE A;  1B7B A;  4A7W A;  2HMF A;  3C20 A;  2BTY A;  3TVI A;  2E9Y A;  2OGX A; 
#chains in the Genus database with same CATH homology
 3ZZH A;  3U6U A;  2BMU A;  2J4L A;  4OLC A;  3KZF A;  4I49 A;  3K56 A;  3K4Y A;  2V4Y A;  4NDO A;  3QUR A;  3LL9 A;  3K52 A;  3LL5 A;  4JZ9 A;  3QUO A;  2J5V A;  2BRI A;  4NDP B;  4NDR B;  3T7B A;  3D2M A;  2WE5 A;  2AP9 A;  3C1M A;  2RD5 A;  4NDP A;  4NDR A;  2JJX A;  2JJ4 A;  3EK6 A;  2J4J A;  2J5T A;  3QUN A;  1OHB A;  2WE4 A;  4AXS A;  2X2W A;  4AB7 A;  3ZZI A;  2AKO A;  3AB2 A;  3K4O A;  3B8G A;  4F6T A;  3ZZF A;  4NDO B;  3AAW A;  2OGX B;  3D40 A;  4F6T B;  4NDQ B;  3S6G A;  1OH9 A;  3WWM A;  2JI5 A;  2BND A;  1E19 A;  4A7X A;  2BUF A;  3D41 A;  2R98 A;  3QVH A;  3L86 A;  2IJ9 A;  1GSJ A;  3AB4 A;  4KZT A;  1Z9D A;  2VA1 A;  2J0X A;  2BRX A;  2V5H A;  2W21 A;  3C1N A;  4JZ8 A;  1GS5 A;  4USJ A;  4Q1T A;  3L76 A;  4NDQ A;  4JZ7 A;  2CDQ A;  3WWN A;  3EK5 A;  2WXB A;  2A1F A;  3LKK A;  3NWY A;  2BNF A;  3S6K A;  1OHA A;  3S6H A;  2J4K A;  3ZZG A;  3D2P A;  3QVF A;  2R8V A;  1YBD A;  2J0W A;  2BNE A;  1B7B A;  4A7W A;  2HMF A;  3C20 A;  2BTY A;  3TVI A;  2E9Y A;  2OGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...