2RD5A

Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylglutamate kinase-like protein
publication title Structural Basis for the Regulation of N-Acetylglutamate Kinase by PII in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 91
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2rd5A00
2BTYA 3C1MA 2BUFA 2WE5A 3EK6A 3LL9A 4NDOA 3L76A 2BRXA 3L86A 2BNDA 3S6HA 4NDPA 3AB4A 2J4JA 2R8VA 4I49A 2OGXB 2JJXA 1E19A 3ZZIA 4F6TB 2CDQA 3K52A 3B8GA 3C20A 2J4LA 3LL5A 3LKKA 2V5HA 4NDRB 4KZTA 1OH9A 3AAWA 3ZZGA 3QURA 2V4YA 1Z9DA 2IJ9A 2J5TA 3WWMA 4Q1TA 1GS5A 2AP9A 1B7BA 2J4KA 4A7WA 2R98A 3D2MA 3K4OA 3TVIA 3D2PA 4A7XA 2BNFA 2WE4A 1GSJA 2RD5A 3ZZFA 2WXBA 2HMFA 4NDQB 3T7BA 2OGXA 4AXSA 3S6GA 2BRIA 2E9YA 1YBDA 4AB7A 4F6TA 3K56A 3KZFA 3C1NA 2A1FA 4JZ7A 3ZZHA 3QUOA 4NDOB 2BNEA 3QUNA 3WWNA 2J0WA 2J0XA 1OHBA 4USJA 4NDPB 4NDRA 3U6UA 4OLCA 3QVHA 2JI5A 3D40A 2X2WA 2BMUA 3AB2A 1OHAA 3EK5A 2VA1A 2AKOA 3S6KA 2JJ4A 2W21A 3K4YA 4JZ8A 3QVFA 2J5VA 3D41A 3NWYA 4JZ9A 4NDQA
chains in the Genus database with same CATH superfamily
2BTYA 3C1MA 2BUFA 2WE5A 3EK6A 3LL9A 4NDOA 3L76A 2BRXA 3L86A 2BNDA 3S6HA 4NDPA 3AB4A 2J4JA 2R8VA 4I49A 2OGXB 2JJXA 1E19A 3ZZIA 4F6TB 2CDQA 3K52A 3B8GA 3C20A 2J4LA 3LL5A 3LKKA 2V5HA 4NDRB 4KZTA 1OH9A 3AAWA 3ZZGA 3QURA 2V4YA 1Z9DA 2IJ9A 2J5TA 3WWMA 4Q1TA 1GS5A 2AP9A 1B7BA 2J4KA 4A7WA 2R98A 3D2MA 3K4OA 3TVIA 3D2PA 4A7XA 2BNFA 2WE4A 1GSJA 2RD5A 3ZZFA 2WXBA 2HMFA 4NDQB 3T7BA 2OGXA 4AXSA 3S6GA 2BRIA 2E9YA 1YBDA 4AB7A 4F6TA 3K56A 3KZFA 3C1NA 2A1FA 4JZ7A 3ZZHA 3QUOA 4NDOB 2BNEA 3QUNA 3WWNA 2J0WA 2J0XA 1OHBA 4USJA 4NDPB 4NDRA 3U6UA 4OLCA 3QVHA 2JI5A 3D40A 2X2WA 2BMUA 3AB2A 1OHAA 3EK5A 2VA1A 2AKOA 3S6KA 2JJ4A 2W21A 3K4YA 4JZ8A 3QVFA 2J5VA 3D41A 3NWYA 4JZ9A 4NDQA
chains in the Genus database with same CATH topology
2BTYA 3C1MA 2BUFA 2WE5A 3EK6A 3LL9A 4NDOA 3L76A 2BRXA 3L86A 2BNDA 3S6HA 4NDPA 3AB4A 2J4JA 2R8VA 4I49A 2OGXB 2JJXA 1E19A 3ZZIA 4F6TB 2CDQA 3K52A 3B8GA 3C20A 2J4LA 3LL5A 3LKKA 2V5HA 4NDRB 4KZTA 1OH9A 3AAWA 3ZZGA 3QURA 2V4YA 1Z9DA 2IJ9A 2J5TA 3WWMA 4Q1TA 1GS5A 2AP9A 1B7BA 2J4KA 4A7WA 2R98A 3D2MA 3K4OA 3TVIA 3D2PA 4A7XA 2BNFA 2WE4A 1GSJA 2RD5A 3ZZFA 2WXBA 2HMFA 4NDQB 3T7BA 2OGXA 4AXSA 3S6GA 2BRIA 2E9YA 1YBDA 4AB7A 4F6TA 3K56A 3KZFA 3C1NA 2A1FA 4JZ7A 3ZZHA 3QUOA 4NDOB 2BNEA 3QUNA 3WWNA 2J0WA 2J0XA 1OHBA 4USJA 4NDPB 4NDRA 3U6UA 4OLCA 3QVHA 2JI5A 3D40A 2X2WA 2BMUA 3AB2A 1OHAA 3EK5A 2VA1A 2AKOA 3S6KA 2JJ4A 2W21A 3K4YA 4JZ8A 3QVFA 2J5VA 3D41A 3NWYA 4JZ9A 4NDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BTY A;  3C1M A;  2BUF A;  2WE5 A;  3EK6 A;  3LL9 A;  4NDO A;  3L76 A;  2BRX A;  3L86 A;  2BND A;  3S6H A;  4NDP A;  3AB4 A;  2J4J A;  2R8V A;  4I49 A;  2OGX B;  2JJX A;  1E19 A;  3ZZI A;  4F6T B;  2CDQ A;  3K52 A;  3B8G A;  3C20 A;  2J4L A;  3LL5 A;  3LKK A;  2V5H A;  4NDR B;  4KZT A;  1OH9 A;  3AAW A;  3ZZG A;  3QUR A;  2V4Y A;  1Z9D A;  2IJ9 A;  2J5T A;  3WWM A;  4Q1T A;  1GS5 A;  2AP9 A;  1B7B A;  2J4K A;  4A7W A;  2R98 A;  3D2M A;  3K4O A;  3TVI A;  3D2P A;  4A7X A;  2BNF A;  2WE4 A;  1GSJ A;  2RD5 A;  3ZZF A;  2WXB A;  2HMF A;  4NDQ B;  3T7B A;  2OGX A;  4AXS A;  3S6G A;  2BRI A;  2E9Y A;  1YBD A;  4AB7 A;  4F6T A;  3K56 A;  3KZF A;  3C1N A;  2A1F A;  4JZ7 A;  3ZZH A;  3QUO A;  4NDO B;  2BNE A;  3QUN A;  3WWN A;  2J0W A;  2J0X A;  1OHB A;  4USJ A;  4NDP B;  4NDR A;  3U6U A;  4OLC A;  3QVH A;  2JI5 A;  3D40 A;  2X2W A;  2BMU A;  3AB2 A;  1OHA A;  3EK5 A;  2VA1 A;  2AKO A;  3S6K A;  2JJ4 A;  2W21 A;  3K4Y A;  4JZ8 A;  3QVF A;  2J5V A;  3D41 A;  3NWY A;  4JZ9 A;  4NDQ A; 
#chains in the Genus database with same CATH topology
 2BTY A;  3C1M A;  2BUF A;  2WE5 A;  3EK6 A;  3LL9 A;  4NDO A;  3L76 A;  2BRX A;  3L86 A;  2BND A;  3S6H A;  4NDP A;  3AB4 A;  2J4J A;  2R8V A;  4I49 A;  2OGX B;  2JJX A;  1E19 A;  3ZZI A;  4F6T B;  2CDQ A;  3K52 A;  3B8G A;  3C20 A;  2J4L A;  3LL5 A;  3LKK A;  2V5H A;  4NDR B;  4KZT A;  1OH9 A;  3AAW A;  3ZZG A;  3QUR A;  2V4Y A;  1Z9D A;  2IJ9 A;  2J5T A;  3WWM A;  4Q1T A;  1GS5 A;  2AP9 A;  1B7B A;  2J4K A;  4A7W A;  2R98 A;  3D2M A;  3K4O A;  3TVI A;  3D2P A;  4A7X A;  2BNF A;  2WE4 A;  1GSJ A;  2RD5 A;  3ZZF A;  2WXB A;  2HMF A;  4NDQ B;  3T7B A;  2OGX A;  4AXS A;  3S6G A;  2BRI A;  2E9Y A;  1YBD A;  4AB7 A;  4F6T A;  3K56 A;  3KZF A;  3C1N A;  2A1F A;  4JZ7 A;  3ZZH A;  3QUO A;  4NDO B;  2BNE A;  3QUN A;  3WWN A;  2J0W A;  2J0X A;  1OHB A;  4USJ A;  4NDP B;  4NDR A;  3U6U A;  4OLC A;  3QVH A;  2JI5 A;  3D40 A;  2X2W A;  2BMU A;  3AB2 A;  1OHA A;  3EK5 A;  2VA1 A;  2AKO A;  3S6K A;  2JJ4 A;  2W21 A;  3K4Y A;  4JZ8 A;  3QVF A;  2J5V A;  3D41 A;  3NWY A;  4JZ9 A;  4NDQ A; 
#chains in the Genus database with same CATH homology
 2BTY A;  3C1M A;  2BUF A;  2WE5 A;  3EK6 A;  3LL9 A;  4NDO A;  3L76 A;  2BRX A;  3L86 A;  2BND A;  3S6H A;  4NDP A;  3AB4 A;  2J4J A;  2R8V A;  4I49 A;  2OGX B;  2JJX A;  1E19 A;  3ZZI A;  4F6T B;  2CDQ A;  3K52 A;  3B8G A;  3C20 A;  2J4L A;  3LL5 A;  3LKK A;  2V5H A;  4NDR B;  4KZT A;  1OH9 A;  3AAW A;  3ZZG A;  3QUR A;  2V4Y A;  1Z9D A;  2IJ9 A;  2J5T A;  3WWM A;  4Q1T A;  1GS5 A;  2AP9 A;  1B7B A;  2J4K A;  4A7W A;  2R98 A;  3D2M A;  3K4O A;  3TVI A;  3D2P A;  4A7X A;  2BNF A;  2WE4 A;  1GSJ A;  2RD5 A;  3ZZF A;  2WXB A;  2HMF A;  4NDQ B;  3T7B A;  2OGX A;  4AXS A;  3S6G A;  2BRI A;  2E9Y A;  1YBD A;  4AB7 A;  4F6T A;  3K56 A;  3KZF A;  3C1N A;  2A1F A;  4JZ7 A;  3ZZH A;  3QUO A;  4NDO B;  2BNE A;  3QUN A;  3WWN A;  2J0W A;  2J0X A;  1OHB A;  4USJ A;  4NDP B;  4NDR A;  3U6U A;  4OLC A;  3QVH A;  2JI5 A;  3D40 A;  2X2W A;  2BMU A;  3AB2 A;  1OHA A;  3EK5 A;  2VA1 A;  2AKO A;  3S6K A;  2JJ4 A;  2W21 A;  3K4Y A;  4JZ8 A;  3QVF A;  2J5V A;  3D41 A;  3NWY A;  4JZ9 A;  4NDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...