2RD5A

Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
b'DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylglutamate kinase-like protein
publication title Structural Basis for the Regulation of N-Acetylglutamate Kinase by PII in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 91
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2rd5A00
2BRIA 4F6TA 2V4YA 2BUFA 3AB2A 4I49A 2J5VA 2E9YA 3QUNA 3S6GA 3QURA 3C1MA 3S6KA 3EK5A 3ZZGA 1OHBA 2J4JA 4JZ8A 2V5HA 4NDRA 3AAWA 2OGXA 4NDOA 1Z9DA 3U6UA 4A7WA 3D40A 3C20A 2WE5A 2HMFA 3C1NA 2J4KA 3K52A 2BNEA 2BNDA 4JZ7A 4NDQB 2WXBA 2J5TA 4OLCA 4USJA 3S6HA 2JI5A 3ZZHA 2JJ4A 3LL9A 3ZZFA 2VA1A 3T7BA 4F6TB 1GS5A 3WWMA 1YBDA 1GSJA 3WWNA 2BNFA 1OHAA 2J4LA 2BRXA 2AP9A 2CDQA 4NDPA 3K56A 3QVHA 3NWYA 2JJXA 3AB4A 4NDRB 2OGXB 2BMUA 2RD5A 3KZFA 4NDOB 3D41A 4AB7A 3EK6A 1E19A 3ZZIA 3B8GA 2WE4A 4NDPB 2IJ9A 4AXSA 3L86A 4KZTA 4A7XA 2J0XA 2J0WA 3K4OA 3QUOA 3LL5A 1OH9A 3L76A 4Q1TA 3D2PA 3K4YA 3QVFA 2W21A 4NDQA 3D2MA 2BTYA 2R98A 2AKOA 1B7BA 2A1FA 2X2WA 3LKKA 3TVIA 4JZ9A 2R8VA
chains in the Genus database with same CATH superfamily
2BRIA 4F6TA 2V4YA 2BUFA 3AB2A 4I49A 2J5VA 2E9YA 3QUNA 3S6GA 3QURA 3C1MA 3S6KA 3EK5A 3ZZGA 1OHBA 2J4JA 4JZ8A 2V5HA 4NDRA 3AAWA 2OGXA 4NDOA 1Z9DA 3U6UA 4A7WA 3D40A 3C20A 2WE5A 2HMFA 3C1NA 2J4KA 3K52A 2BNEA 2BNDA 4JZ7A 4NDQB 2WXBA 2J5TA 4OLCA 4USJA 3S6HA 2JI5A 3ZZHA 2JJ4A 3LL9A 3ZZFA 2VA1A 3T7BA 4F6TB 1GS5A 3WWMA 1YBDA 1GSJA 3WWNA 2BNFA 1OHAA 2J4LA 2BRXA 2AP9A 2CDQA 4NDPA 3K56A 3QVHA 3NWYA 2JJXA 3AB4A 4NDRB 2OGXB 2BMUA 2RD5A 3KZFA 4NDOB 3D41A 4AB7A 3EK6A 1E19A 3ZZIA 3B8GA 2WE4A 4NDPB 2IJ9A 4AXSA 3L86A 4KZTA 4A7XA 2J0XA 2J0WA 3K4OA 3QUOA 3LL5A 1OH9A 3L76A 4Q1TA 3D2PA 3K4YA 3QVFA 2W21A 4NDQA 3D2MA 2BTYA 2R98A 2AKOA 1B7BA 2A1FA 2X2WA 3LKKA 3TVIA 4JZ9A 2R8VA
chains in the Genus database with same CATH topology
2BRIA 4F6TA 2V4YA 2BUFA 3AB2A 4I49A 2J5VA 2E9YA 3QUNA 3S6GA 3QURA 3C1MA 3S6KA 3EK5A 3ZZGA 1OHBA 2J4JA 4JZ8A 2V5HA 4NDRA 3AAWA 2OGXA 4NDOA 1Z9DA 3U6UA 4A7WA 3D40A 3C20A 2WE5A 2HMFA 3C1NA 2J4KA 3K52A 2BNEA 2BNDA 4JZ7A 4NDQB 2WXBA 2J5TA 4OLCA 4USJA 3S6HA 2JI5A 3ZZHA 2JJ4A 3LL9A 3ZZFA 2VA1A 3T7BA 4F6TB 1GS5A 3WWMA 1YBDA 1GSJA 3WWNA 2BNFA 1OHAA 2J4LA 2BRXA 2AP9A 2CDQA 4NDPA 3K56A 3QVHA 3NWYA 2JJXA 3AB4A 4NDRB 2OGXB 2BMUA 2RD5A 3KZFA 4NDOB 3D41A 4AB7A 3EK6A 1E19A 3ZZIA 3B8GA 2WE4A 4NDPB 2IJ9A 4AXSA 3L86A 4KZTA 4A7XA 2J0XA 2J0WA 3K4OA 3QUOA 3LL5A 1OH9A 3L76A 4Q1TA 3D2PA 3K4YA 3QVFA 2W21A 4NDQA 3D2MA 2BTYA 2R98A 2AKOA 1B7BA 2A1FA 2X2WA 3LKKA 3TVIA 4JZ9A 2R8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRI A;  4F6T A;  2V4Y A;  2BUF A;  3AB2 A;  4I49 A;  2J5V A;  2E9Y A;  3QUN A;  3S6G A;  3QUR A;  3C1M A;  3S6K A;  3EK5 A;  3ZZG A;  1OHB A;  2J4J A;  4JZ8 A;  2V5H A;  4NDR A;  3AAW A;  2OGX A;  4NDO A;  1Z9D A;  3U6U A;  4A7W A;  3D40 A;  3C20 A;  2WE5 A;  2HMF A;  3C1N A;  2J4K A;  3K52 A;  2BNE A;  2BND A;  4JZ7 A;  4NDQ B;  2WXB A;  2J5T A;  4OLC A;  4USJ A;  3S6H A;  2JI5 A;  3ZZH A;  2JJ4 A;  3LL9 A;  3ZZF A;  2VA1 A;  3T7B A;  4F6T B;  1GS5 A;  3WWM A;  1YBD A;  1GSJ A;  3WWN A;  2BNF A;  1OHA A;  2J4L A;  2BRX A;  2AP9 A;  2CDQ A;  4NDP A;  3K56 A;  3QVH A;  3NWY A;  2JJX A;  3AB4 A;  4NDR B;  2OGX B;  2BMU A;  2RD5 A;  3KZF A;  4NDO B;  3D41 A;  4AB7 A;  3EK6 A;  1E19 A;  3ZZI A;  3B8G A;  2WE4 A;  4NDP B;  2IJ9 A;  4AXS A;  3L86 A;  4KZT A;  4A7X A;  2J0X A;  2J0W A;  3K4O A;  3QUO A;  3LL5 A;  1OH9 A;  3L76 A;  4Q1T A;  3D2P A;  3K4Y A;  3QVF A;  2W21 A;  4NDQ A;  3D2M A;  2BTY A;  2R98 A;  2AKO A;  1B7B A;  2A1F A;  2X2W A;  3LKK A;  3TVI A;  4JZ9 A;  2R8V A; 
#chains in the Genus database with same CATH topology
 2BRI A;  4F6T A;  2V4Y A;  2BUF A;  3AB2 A;  4I49 A;  2J5V A;  2E9Y A;  3QUN A;  3S6G A;  3QUR A;  3C1M A;  3S6K A;  3EK5 A;  3ZZG A;  1OHB A;  2J4J A;  4JZ8 A;  2V5H A;  4NDR A;  3AAW A;  2OGX A;  4NDO A;  1Z9D A;  3U6U A;  4A7W A;  3D40 A;  3C20 A;  2WE5 A;  2HMF A;  3C1N A;  2J4K A;  3K52 A;  2BNE A;  2BND A;  4JZ7 A;  4NDQ B;  2WXB A;  2J5T A;  4OLC A;  4USJ A;  3S6H A;  2JI5 A;  3ZZH A;  2JJ4 A;  3LL9 A;  3ZZF A;  2VA1 A;  3T7B A;  4F6T B;  1GS5 A;  3WWM A;  1YBD A;  1GSJ A;  3WWN A;  2BNF A;  1OHA A;  2J4L A;  2BRX A;  2AP9 A;  2CDQ A;  4NDP A;  3K56 A;  3QVH A;  3NWY A;  2JJX A;  3AB4 A;  4NDR B;  2OGX B;  2BMU A;  2RD5 A;  3KZF A;  4NDO B;  3D41 A;  4AB7 A;  3EK6 A;  1E19 A;  3ZZI A;  3B8G A;  2WE4 A;  4NDP B;  2IJ9 A;  4AXS A;  3L86 A;  4KZT A;  4A7X A;  2J0X A;  2J0W A;  3K4O A;  3QUO A;  3LL5 A;  1OH9 A;  3L76 A;  4Q1T A;  3D2P A;  3K4Y A;  3QVF A;  2W21 A;  4NDQ A;  3D2M A;  2BTY A;  2R98 A;  2AKO A;  1B7B A;  2A1F A;  2X2W A;  3LKK A;  3TVI A;  4JZ9 A;  2R8V A; 
#chains in the Genus database with same CATH homology
 2BRI A;  4F6T A;  2V4Y A;  2BUF A;  3AB2 A;  4I49 A;  2J5V A;  2E9Y A;  3QUN A;  3S6G A;  3QUR A;  3C1M A;  3S6K A;  3EK5 A;  3ZZG A;  1OHB A;  2J4J A;  4JZ8 A;  2V5H A;  4NDR A;  3AAW A;  2OGX A;  4NDO A;  1Z9D A;  3U6U A;  4A7W A;  3D40 A;  3C20 A;  2WE5 A;  2HMF A;  3C1N A;  2J4K A;  3K52 A;  2BNE A;  2BND A;  4JZ7 A;  4NDQ B;  2WXB A;  2J5T A;  4OLC A;  4USJ A;  3S6H A;  2JI5 A;  3ZZH A;  2JJ4 A;  3LL9 A;  3ZZF A;  2VA1 A;  3T7B A;  4F6T B;  1GS5 A;  3WWM A;  1YBD A;  1GSJ A;  3WWN A;  2BNF A;  1OHA A;  2J4L A;  2BRX A;  2AP9 A;  2CDQ A;  4NDP A;  3K56 A;  3QVH A;  3NWY A;  2JJX A;  3AB4 A;  4NDR B;  2OGX B;  2BMU A;  2RD5 A;  3KZF A;  4NDO B;  3D41 A;  4AB7 A;  3EK6 A;  1E19 A;  3ZZI A;  3B8G A;  2WE4 A;  4NDP B;  2IJ9 A;  4AXS A;  3L86 A;  4KZT A;  4A7X A;  2J0X A;  2J0W A;  3K4O A;  3QUO A;  3LL5 A;  1OH9 A;  3L76 A;  4Q1T A;  3D2P A;  3K4Y A;  3QVF A;  2W21 A;  4NDQ A;  3D2M A;  2BTY A;  2R98 A;  2AKO A;  1B7B A;  2A1F A;  2X2W A;  3LKK A;  3TVI A;  4JZ9 A;  2R8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...