2RD5A

Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Regulation of N-Acetylglutamate Kinase by PII in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Acetylglutamate kinase-like protein
total genus 91
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2rd5A00
4A7XA 1YBDA 3K4YA 3T7BA 2V4YA 4USJA 3WWMA 3AAWA 3TVIA 2OGXB 3EK5A 2AKOA 3C1NA 4NDRA 2JJXA 2R98A 2WXBA 3KZFA 4A7WA 4NDOA 3D2PA 3L86A 2W21A 2X2WA 2BNFA 4JZ8A 4NDPA 4NDQA 3K56A 2J5VA 4Q1TA 3NWYA 3K52A 3L76A 3ZZHA 2WE5A 2HMFA 2JI5A 2IJ9A 4NDRB 1OHBA 1GSJA 3AB4A 4OLCA 2BNEA 4JZ7A 3AB2A 3ZZGA 2J4JA 2J4KA 1OH9A 4NDPB 3QVHA 4NDQB 3C20A 3QVFA 2WE4A 3K4OA 2J4LA 2OGXA 2BNDA 2VA1A 3ZZIA 3B8GA 2BMUA 1GS5A 4AXSA 2AP9A 2CDQA 2BUFA 2A1FA 4F6TB 4KZTA 2JJ4A 1OHAA 2J5TA 4NDOB 3D41A 3LL9A 3LL5A 3EK6A 3QUNA 3ZZFA 2R8VA 4JZ9A 4AB7A 3C1MA 3WWNA 2J0WA 4F6TA 2BRXA 2E9YA 3U6UA 3S6KA 1E19A 3S6HA 3D2MA 3LKKA 4I49A 3S6GA 3QUOA 2BRIA 2BTYA 3D40A 3QURA 1Z9DA 1B7BA 2RD5A 2J0XA 2V5HA
chains in the Genus database with same CATH superfamily
4A7XA 1YBDA 3K4YA 3T7BA 2V4YA 4USJA 3WWMA 3AAWA 3TVIA 2OGXB 3EK5A 2AKOA 3C1NA 4NDRA 2JJXA 2R98A 2WXBA 3KZFA 4A7WA 4NDOA 3D2PA 3L86A 2W21A 2X2WA 2BNFA 4JZ8A 4NDPA 4NDQA 3K56A 2J5VA 4Q1TA 3NWYA 3K52A 3L76A 3ZZHA 2WE5A 2HMFA 2JI5A 2IJ9A 4NDRB 1OHBA 1GSJA 3AB4A 4OLCA 2BNEA 4JZ7A 3AB2A 3ZZGA 2J4JA 2J4KA 1OH9A 4NDPB 3QVHA 4NDQB 3C20A 3QVFA 2WE4A 3K4OA 2J4LA 2OGXA 2BNDA 2VA1A 3ZZIA 3B8GA 2BMUA 1GS5A 4AXSA 2AP9A 2CDQA 2BUFA 2A1FA 4F6TB 4KZTA 2JJ4A 1OHAA 2J5TA 4NDOB 3D41A 3LL9A 3LL5A 3EK6A 3QUNA 3ZZFA 2R8VA 4JZ9A 4AB7A 3C1MA 3WWNA 2J0WA 4F6TA 2BRXA 2E9YA 3U6UA 3S6KA 1E19A 3S6HA 3D2MA 3LKKA 4I49A 3S6GA 3QUOA 2BRIA 2BTYA 3D40A 3QURA 1Z9DA 1B7BA 2RD5A 2J0XA 2V5HA
chains in the Genus database with same CATH topology
4A7XA 1YBDA 3K4YA 3T7BA 2V4YA 4USJA 3WWMA 3AAWA 3TVIA 2OGXB 3EK5A 2AKOA 3C1NA 4NDRA 2JJXA 2R98A 2WXBA 3KZFA 4A7WA 4NDOA 3D2PA 3L86A 2W21A 2X2WA 2BNFA 4JZ8A 4NDPA 4NDQA 3K56A 2J5VA 4Q1TA 3NWYA 3K52A 3L76A 3ZZHA 2WE5A 2HMFA 2JI5A 2IJ9A 4NDRB 1OHBA 1GSJA 3AB4A 4OLCA 2BNEA 4JZ7A 3AB2A 3ZZGA 2J4JA 2J4KA 1OH9A 4NDPB 3QVHA 4NDQB 3C20A 3QVFA 2WE4A 3K4OA 2J4LA 2OGXA 2BNDA 2VA1A 3ZZIA 3B8GA 2BMUA 1GS5A 4AXSA 2AP9A 2CDQA 2BUFA 2A1FA 4F6TB 4KZTA 2JJ4A 1OHAA 2J5TA 4NDOB 3D41A 3LL9A 3LL5A 3EK6A 3QUNA 3ZZFA 2R8VA 4JZ9A 4AB7A 3C1MA 3WWNA 2J0WA 4F6TA 2BRXA 2E9YA 3U6UA 3S6KA 1E19A 3S6HA 3D2MA 3LKKA 4I49A 3S6GA 3QUOA 2BRIA 2BTYA 3D40A 3QURA 1Z9DA 1B7BA 2RD5A 2J0XA 2V5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A7X A;  1YBD A;  3K4Y A;  3T7B A;  2V4Y A;  4USJ A;  3WWM A;  3AAW A;  3TVI A;  2OGX B;  3EK5 A;  2AKO A;  3C1N A;  4NDR A;  2JJX A;  2R98 A;  2WXB A;  3KZF A;  4A7W A;  4NDO A;  3D2P A;  3L86 A;  2W21 A;  2X2W A;  2BNF A;  4JZ8 A;  4NDP A;  4NDQ A;  3K56 A;  2J5V A;  4Q1T A;  3NWY A;  3K52 A;  3L76 A;  3ZZH A;  2WE5 A;  2HMF A;  2JI5 A;  2IJ9 A;  4NDR B;  1OHB A;  1GSJ A;  3AB4 A;  4OLC A;  2BNE A;  4JZ7 A;  3AB2 A;  3ZZG A;  2J4J A;  2J4K A;  1OH9 A;  4NDP B;  3QVH A;  4NDQ B;  3C20 A;  3QVF A;  2WE4 A;  3K4O A;  2J4L A;  2OGX A;  2BND A;  2VA1 A;  3ZZI A;  3B8G A;  2BMU A;  1GS5 A;  4AXS A;  2AP9 A;  2CDQ A;  2BUF A;  2A1F A;  4F6T B;  4KZT A;  2JJ4 A;  1OHA A;  2J5T A;  4NDO B;  3D41 A;  3LL9 A;  3LL5 A;  3EK6 A;  3QUN A;  3ZZF A;  2R8V A;  4JZ9 A;  4AB7 A;  3C1M A;  3WWN A;  2J0W A;  4F6T A;  2BRX A;  2E9Y A;  3U6U A;  3S6K A;  1E19 A;  3S6H A;  3D2M A;  3LKK A;  4I49 A;  3S6G A;  3QUO A;  2BRI A;  2BTY A;  3D40 A;  3QUR A;  1Z9D A;  1B7B A;  2RD5 A;  2J0X A;  2V5H A; 
#chains in the Genus database with same CATH topology
 4A7X A;  1YBD A;  3K4Y A;  3T7B A;  2V4Y A;  4USJ A;  3WWM A;  3AAW A;  3TVI A;  2OGX B;  3EK5 A;  2AKO A;  3C1N A;  4NDR A;  2JJX A;  2R98 A;  2WXB A;  3KZF A;  4A7W A;  4NDO A;  3D2P A;  3L86 A;  2W21 A;  2X2W A;  2BNF A;  4JZ8 A;  4NDP A;  4NDQ A;  3K56 A;  2J5V A;  4Q1T A;  3NWY A;  3K52 A;  3L76 A;  3ZZH A;  2WE5 A;  2HMF A;  2JI5 A;  2IJ9 A;  4NDR B;  1OHB A;  1GSJ A;  3AB4 A;  4OLC A;  2BNE A;  4JZ7 A;  3AB2 A;  3ZZG A;  2J4J A;  2J4K A;  1OH9 A;  4NDP B;  3QVH A;  4NDQ B;  3C20 A;  3QVF A;  2WE4 A;  3K4O A;  2J4L A;  2OGX A;  2BND A;  2VA1 A;  3ZZI A;  3B8G A;  2BMU A;  1GS5 A;  4AXS A;  2AP9 A;  2CDQ A;  2BUF A;  2A1F A;  4F6T B;  4KZT A;  2JJ4 A;  1OHA A;  2J5T A;  4NDO B;  3D41 A;  3LL9 A;  3LL5 A;  3EK6 A;  3QUN A;  3ZZF A;  2R8V A;  4JZ9 A;  4AB7 A;  3C1M A;  3WWN A;  2J0W A;  4F6T A;  2BRX A;  2E9Y A;  3U6U A;  3S6K A;  1E19 A;  3S6H A;  3D2M A;  3LKK A;  4I49 A;  3S6G A;  3QUO A;  2BRI A;  2BTY A;  3D40 A;  3QUR A;  1Z9D A;  1B7B A;  2RD5 A;  2J0X A;  2V5H A; 
#chains in the Genus database with same CATH homology
 4A7X A;  1YBD A;  3K4Y A;  3T7B A;  2V4Y A;  4USJ A;  3WWM A;  3AAW A;  3TVI A;  2OGX B;  3EK5 A;  2AKO A;  3C1N A;  4NDR A;  2JJX A;  2R98 A;  2WXB A;  3KZF A;  4A7W A;  4NDO A;  3D2P A;  3L86 A;  2W21 A;  2X2W A;  2BNF A;  4JZ8 A;  4NDP A;  4NDQ A;  3K56 A;  2J5V A;  4Q1T A;  3NWY A;  3K52 A;  3L76 A;  3ZZH A;  2WE5 A;  2HMF A;  2JI5 A;  2IJ9 A;  4NDR B;  1OHB A;  1GSJ A;  3AB4 A;  4OLC A;  2BNE A;  4JZ7 A;  3AB2 A;  3ZZG A;  2J4J A;  2J4K A;  1OH9 A;  4NDP B;  3QVH A;  4NDQ B;  3C20 A;  3QVF A;  2WE4 A;  3K4O A;  2J4L A;  2OGX A;  2BND A;  2VA1 A;  3ZZI A;  3B8G A;  2BMU A;  1GS5 A;  4AXS A;  2AP9 A;  2CDQ A;  2BUF A;  2A1F A;  4F6T B;  4KZT A;  2JJ4 A;  1OHA A;  2J5T A;  4NDO B;  3D41 A;  3LL9 A;  3LL5 A;  3EK6 A;  3QUN A;  3ZZF A;  2R8V A;  4JZ9 A;  4AB7 A;  3C1M A;  3WWN A;  2J0W A;  4F6T A;  2BRX A;  2E9Y A;  3U6U A;  3S6K A;  1E19 A;  3S6H A;  3D2M A;  3LKK A;  4I49 A;  3S6G A;  3QUO A;  2BRI A;  2BTY A;  3D40 A;  3QUR A;  1Z9D A;  1B7B A;  2RD5 A;  2J0X A;  2V5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...