2RD5A

Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Regulation of N-Acetylglutamate Kinase by PII in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Acetylglutamate kinase-like protein
total genus 91
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2rd5A00
1GS5A 3C1MA 2BNEA 3K4OA 4USJA 4F6TA 1B7BA 3AAWA 2J5VA 1OHAA 3B8GA 3LL5A 4AB7A 2R8VA 4A7XA 3LL9A 2BNDA 4NDPA 3WWMA 4NDOB 2JJ4A 3QVFA 2CDQA 2AKOA 2X2WA 3TVIA 2BUFA 2BRXA 1Z9DA 4F6TB 2J4KA 2HMFA 4NDQB 3ZZFA 4OLCA 3LKKA 4NDPB 3L76A 3C20A 3QVHA 2J4LA 3ZZIA 3S6HA 2JJXA 2BRIA 2JI5A 3D40A 4NDQA 4NDRA 1E19A 2OGXB 4AXSA 4NDRB 2W21A 2E9YA 3D2PA 4I49A 2R98A 3S6KA 2J4JA 2J0XA 2WE5A 2WE4A 3EK5A 2V5HA 3AB2A 3K4YA 2IJ9A 1OH9A 2WXBA 3AB4A 2OGXA 2A1FA 2J5TA 2AP9A 2BMUA 3QUNA 1OHBA 3U6UA 3C1NA 1GSJA 3D2MA 2J0WA 4Q1TA 2BNFA 3D41A 3S6GA 2VA1A 4JZ9A 3T7BA 4JZ8A 3K56A 3WWNA 1YBDA 2RD5A 3QURA 4KZTA 3ZZHA 4A7WA 3NWYA 4JZ7A 2BTYA 4NDOA 3L86A 2V4YA 3ZZGA 3EK6A 3KZFA 3QUOA 3K52A
chains in the Genus database with same CATH superfamily
1GS5A 3C1MA 2BNEA 3K4OA 4USJA 4F6TA 1B7BA 3AAWA 2J5VA 1OHAA 3B8GA 3LL5A 4AB7A 2R8VA 4A7XA 3LL9A 2BNDA 4NDPA 3WWMA 4NDOB 2JJ4A 3QVFA 2CDQA 2AKOA 2X2WA 3TVIA 2BUFA 2BRXA 1Z9DA 4F6TB 2J4KA 2HMFA 4NDQB 3ZZFA 4OLCA 3LKKA 4NDPB 3L76A 3C20A 3QVHA 2J4LA 3ZZIA 3S6HA 2JJXA 2BRIA 2JI5A 3D40A 4NDQA 4NDRA 1E19A 2OGXB 4AXSA 4NDRB 2W21A 2E9YA 3D2PA 4I49A 2R98A 3S6KA 2J4JA 2J0XA 2WE5A 2WE4A 3EK5A 2V5HA 3AB2A 3K4YA 2IJ9A 1OH9A 2WXBA 3AB4A 2OGXA 2A1FA 2J5TA 2AP9A 2BMUA 3QUNA 1OHBA 3U6UA 3C1NA 1GSJA 3D2MA 2J0WA 4Q1TA 2BNFA 3D41A 3S6GA 2VA1A 4JZ9A 3T7BA 4JZ8A 3K56A 3WWNA 1YBDA 2RD5A 3QURA 4KZTA 3ZZHA 4A7WA 3NWYA 4JZ7A 2BTYA 4NDOA 3L86A 2V4YA 3ZZGA 3EK6A 3KZFA 3QUOA 3K52A
chains in the Genus database with same CATH topology
1GS5A 3C1MA 2BNEA 3K4OA 4USJA 4F6TA 1B7BA 3AAWA 2J5VA 1OHAA 3B8GA 3LL5A 4AB7A 2R8VA 4A7XA 3LL9A 2BNDA 4NDPA 3WWMA 4NDOB 2JJ4A 3QVFA 2CDQA 2AKOA 2X2WA 3TVIA 2BUFA 2BRXA 1Z9DA 4F6TB 2J4KA 2HMFA 4NDQB 3ZZFA 4OLCA 3LKKA 4NDPB 3L76A 3C20A 3QVHA 2J4LA 3ZZIA 3S6HA 2JJXA 2BRIA 2JI5A 3D40A 4NDQA 4NDRA 1E19A 2OGXB 4AXSA 4NDRB 2W21A 2E9YA 3D2PA 4I49A 2R98A 3S6KA 2J4JA 2J0XA 2WE5A 2WE4A 3EK5A 2V5HA 3AB2A 3K4YA 2IJ9A 1OH9A 2WXBA 3AB4A 2OGXA 2A1FA 2J5TA 2AP9A 2BMUA 3QUNA 1OHBA 3U6UA 3C1NA 1GSJA 3D2MA 2J0WA 4Q1TA 2BNFA 3D41A 3S6GA 2VA1A 4JZ9A 3T7BA 4JZ8A 3K56A 3WWNA 1YBDA 2RD5A 3QURA 4KZTA 3ZZHA 4A7WA 3NWYA 4JZ7A 2BTYA 4NDOA 3L86A 2V4YA 3ZZGA 3EK6A 3KZFA 3QUOA 3K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS5 A;  3C1M A;  2BNE A;  3K4O A;  4USJ A;  4F6T A;  1B7B A;  3AAW A;  2J5V A;  1OHA A;  3B8G A;  3LL5 A;  4AB7 A;  2R8V A;  4A7X A;  3LL9 A;  2BND A;  4NDP A;  3WWM A;  4NDO B;  2JJ4 A;  3QVF A;  2CDQ A;  2AKO A;  2X2W A;  3TVI A;  2BUF A;  2BRX A;  1Z9D A;  4F6T B;  2J4K A;  2HMF A;  4NDQ B;  3ZZF A;  4OLC A;  3LKK A;  4NDP B;  3L76 A;  3C20 A;  3QVH A;  2J4L A;  3ZZI A;  3S6H A;  2JJX A;  2BRI A;  2JI5 A;  3D40 A;  4NDQ A;  4NDR A;  1E19 A;  2OGX B;  4AXS A;  4NDR B;  2W21 A;  2E9Y A;  3D2P A;  4I49 A;  2R98 A;  3S6K A;  2J4J A;  2J0X A;  2WE5 A;  2WE4 A;  3EK5 A;  2V5H A;  3AB2 A;  3K4Y A;  2IJ9 A;  1OH9 A;  2WXB A;  3AB4 A;  2OGX A;  2A1F A;  2J5T A;  2AP9 A;  2BMU A;  3QUN A;  1OHB A;  3U6U A;  3C1N A;  1GSJ A;  3D2M A;  2J0W A;  4Q1T A;  2BNF A;  3D41 A;  3S6G A;  2VA1 A;  4JZ9 A;  3T7B A;  4JZ8 A;  3K56 A;  3WWN A;  1YBD A;  2RD5 A;  3QUR A;  4KZT A;  3ZZH A;  4A7W A;  3NWY A;  4JZ7 A;  2BTY A;  4NDO A;  3L86 A;  2V4Y A;  3ZZG A;  3EK6 A;  3KZF A;  3QUO A;  3K52 A; 
#chains in the Genus database with same CATH topology
 1GS5 A;  3C1M A;  2BNE A;  3K4O A;  4USJ A;  4F6T A;  1B7B A;  3AAW A;  2J5V A;  1OHA A;  3B8G A;  3LL5 A;  4AB7 A;  2R8V A;  4A7X A;  3LL9 A;  2BND A;  4NDP A;  3WWM A;  4NDO B;  2JJ4 A;  3QVF A;  2CDQ A;  2AKO A;  2X2W A;  3TVI A;  2BUF A;  2BRX A;  1Z9D A;  4F6T B;  2J4K A;  2HMF A;  4NDQ B;  3ZZF A;  4OLC A;  3LKK A;  4NDP B;  3L76 A;  3C20 A;  3QVH A;  2J4L A;  3ZZI A;  3S6H A;  2JJX A;  2BRI A;  2JI5 A;  3D40 A;  4NDQ A;  4NDR A;  1E19 A;  2OGX B;  4AXS A;  4NDR B;  2W21 A;  2E9Y A;  3D2P A;  4I49 A;  2R98 A;  3S6K A;  2J4J A;  2J0X A;  2WE5 A;  2WE4 A;  3EK5 A;  2V5H A;  3AB2 A;  3K4Y A;  2IJ9 A;  1OH9 A;  2WXB A;  3AB4 A;  2OGX A;  2A1F A;  2J5T A;  2AP9 A;  2BMU A;  3QUN A;  1OHB A;  3U6U A;  3C1N A;  1GSJ A;  3D2M A;  2J0W A;  4Q1T A;  2BNF A;  3D41 A;  3S6G A;  2VA1 A;  4JZ9 A;  3T7B A;  4JZ8 A;  3K56 A;  3WWN A;  1YBD A;  2RD5 A;  3QUR A;  4KZT A;  3ZZH A;  4A7W A;  3NWY A;  4JZ7 A;  2BTY A;  4NDO A;  3L86 A;  2V4Y A;  3ZZG A;  3EK6 A;  3KZF A;  3QUO A;  3K52 A; 
#chains in the Genus database with same CATH homology
 1GS5 A;  3C1M A;  2BNE A;  3K4O A;  4USJ A;  4F6T A;  1B7B A;  3AAW A;  2J5V A;  1OHA A;  3B8G A;  3LL5 A;  4AB7 A;  2R8V A;  4A7X A;  3LL9 A;  2BND A;  4NDP A;  3WWM A;  4NDO B;  2JJ4 A;  3QVF A;  2CDQ A;  2AKO A;  2X2W A;  3TVI A;  2BUF A;  2BRX A;  1Z9D A;  4F6T B;  2J4K A;  2HMF A;  4NDQ B;  3ZZF A;  4OLC A;  3LKK A;  4NDP B;  3L76 A;  3C20 A;  3QVH A;  2J4L A;  3ZZI A;  3S6H A;  2JJX A;  2BRI A;  2JI5 A;  3D40 A;  4NDQ A;  4NDR A;  1E19 A;  2OGX B;  4AXS A;  4NDR B;  2W21 A;  2E9Y A;  3D2P A;  4I49 A;  2R98 A;  3S6K A;  2J4J A;  2J0X A;  2WE5 A;  2WE4 A;  3EK5 A;  2V5H A;  3AB2 A;  3K4Y A;  2IJ9 A;  1OH9 A;  2WXB A;  3AB4 A;  2OGX A;  2A1F A;  2J5T A;  2AP9 A;  2BMU A;  3QUN A;  1OHB A;  3U6U A;  3C1N A;  1GSJ A;  3D2M A;  2J0W A;  4Q1T A;  2BNF A;  3D41 A;  3S6G A;  2VA1 A;  4JZ9 A;  3T7B A;  4JZ8 A;  3K56 A;  3WWN A;  1YBD A;  2RD5 A;  3QUR A;  4KZT A;  3ZZH A;  4A7W A;  3NWY A;  4JZ7 A;  2BTY A;  4NDO A;  3L86 A;  2V4Y A;  3ZZG A;  3EK6 A;  3KZF A;  3QUO A;  3K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...