2RD5A

Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Acetylglutamate kinase-like protein
publication title Structural Basis for the Regulation of N-Acetylglutamate Kinase by PII in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 91
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2rd5A00
2JI5A 2VA1A 1YBDA 3S6GA 2J0WA 3K52A 2BNDA 4NDOA 1OHAA 2A1FA 4NDQB 3S6KA 3K56A 4NDRA 3C1MA 3WWMA 2WE4A 2J0XA 1B7BA 1E19A 3QVHA 3QUNA 4F6TB 4I49A 2J5TA 3U6UA 1GSJA 3EK5A 4JZ7A 4USJA 1OH9A 3ZZIA 3ZZHA 2BMUA 3D2PA 4NDPB 2JJ4A 3QVFA 3D40A 3C20A 2OGXA 3EK6A 3LL9A 2BRXA 2CDQA 2J5VA 4AB7A 3QURA 3S6HA 3KZFA 2BNEA 2BRIA 3QUOA 2V5HA 2R8VA 3TVIA 2BUFA 3D2MA 1Z9DA 2BNFA 4AXSA 4A7WA 3C1NA 2V4YA 3L86A 2AP9A 4F6TA 3T7BA 2X2WA 4JZ9A 2BTYA 4NDOB 4OLCA 3AB4A 2JJXA 4KZTA 2HMFA 4NDRB 3ZZFA 4Q1TA 4NDQA 2OGXB 2WE5A 3NWYA 3B8GA 2J4KA 3D41A 3K4OA 3AB2A 2E9YA 2J4JA 2W21A 4A7XA 1OHBA 1GS5A 2WXBA 2IJ9A 2R98A 3K4YA 2J4LA 4JZ8A 3LL5A 3WWNA 3L76A 3ZZGA 2RD5A 4NDPA 3AAWA 3LKKA 2AKOA
chains in the Genus database with same CATH superfamily
2JI5A 2VA1A 1YBDA 3S6GA 2J0WA 3K52A 2BNDA 4NDOA 1OHAA 2A1FA 4NDQB 3S6KA 3K56A 4NDRA 3C1MA 3WWMA 2WE4A 2J0XA 1B7BA 1E19A 3QVHA 3QUNA 4F6TB 4I49A 2J5TA 3U6UA 1GSJA 3EK5A 4JZ7A 4USJA 1OH9A 3ZZIA 3ZZHA 2BMUA 3D2PA 4NDPB 2JJ4A 3QVFA 3D40A 3C20A 2OGXA 3EK6A 3LL9A 2BRXA 2CDQA 2J5VA 4AB7A 3QURA 3S6HA 3KZFA 2BNEA 2BRIA 3QUOA 2V5HA 2R8VA 3TVIA 2BUFA 3D2MA 1Z9DA 2BNFA 4AXSA 4A7WA 3C1NA 2V4YA 3L86A 2AP9A 4F6TA 3T7BA 2X2WA 4JZ9A 2BTYA 4NDOB 4OLCA 3AB4A 2JJXA 4KZTA 2HMFA 4NDRB 3ZZFA 4Q1TA 4NDQA 2OGXB 2WE5A 3NWYA 3B8GA 2J4KA 3D41A 3K4OA 3AB2A 2E9YA 2J4JA 2W21A 4A7XA 1OHBA 1GS5A 2WXBA 2IJ9A 2R98A 3K4YA 2J4LA 4JZ8A 3LL5A 3WWNA 3L76A 3ZZGA 2RD5A 4NDPA 3AAWA 3LKKA 2AKOA
chains in the Genus database with same CATH topology
2JI5A 2VA1A 1YBDA 3S6GA 2J0WA 3K52A 2BNDA 4NDOA 1OHAA 2A1FA 4NDQB 3S6KA 3K56A 4NDRA 3C1MA 3WWMA 2WE4A 2J0XA 1B7BA 1E19A 3QVHA 3QUNA 4F6TB 4I49A 2J5TA 3U6UA 1GSJA 3EK5A 4JZ7A 4USJA 1OH9A 3ZZIA 3ZZHA 2BMUA 3D2PA 4NDPB 2JJ4A 3QVFA 3D40A 3C20A 2OGXA 3EK6A 3LL9A 2BRXA 2CDQA 2J5VA 4AB7A 3QURA 3S6HA 3KZFA 2BNEA 2BRIA 3QUOA 2V5HA 2R8VA 3TVIA 2BUFA 3D2MA 1Z9DA 2BNFA 4AXSA 4A7WA 3C1NA 2V4YA 3L86A 2AP9A 4F6TA 3T7BA 2X2WA 4JZ9A 2BTYA 4NDOB 4OLCA 3AB4A 2JJXA 4KZTA 2HMFA 4NDRB 3ZZFA 4Q1TA 4NDQA 2OGXB 2WE5A 3NWYA 3B8GA 2J4KA 3D41A 3K4OA 3AB2A 2E9YA 2J4JA 2W21A 4A7XA 1OHBA 1GS5A 2WXBA 2IJ9A 2R98A 3K4YA 2J4LA 4JZ8A 3LL5A 3WWNA 3L76A 3ZZGA 2RD5A 4NDPA 3AAWA 3LKKA 2AKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JI5 A;  2VA1 A;  1YBD A;  3S6G A;  2J0W A;  3K52 A;  2BND A;  4NDO A;  1OHA A;  2A1F A;  4NDQ B;  3S6K A;  3K56 A;  4NDR A;  3C1M A;  3WWM A;  2WE4 A;  2J0X A;  1B7B A;  1E19 A;  3QVH A;  3QUN A;  4F6T B;  4I49 A;  2J5T A;  3U6U A;  1GSJ A;  3EK5 A;  4JZ7 A;  4USJ A;  1OH9 A;  3ZZI A;  3ZZH A;  2BMU A;  3D2P A;  4NDP B;  2JJ4 A;  3QVF A;  3D40 A;  3C20 A;  2OGX A;  3EK6 A;  3LL9 A;  2BRX A;  2CDQ A;  2J5V A;  4AB7 A;  3QUR A;  3S6H A;  3KZF A;  2BNE A;  2BRI A;  3QUO A;  2V5H A;  2R8V A;  3TVI A;  2BUF A;  3D2M A;  1Z9D A;  2BNF A;  4AXS A;  4A7W A;  3C1N A;  2V4Y A;  3L86 A;  2AP9 A;  4F6T A;  3T7B A;  2X2W A;  4JZ9 A;  2BTY A;  4NDO B;  4OLC A;  3AB4 A;  2JJX A;  4KZT A;  2HMF A;  4NDR B;  3ZZF A;  4Q1T A;  4NDQ A;  2OGX B;  2WE5 A;  3NWY A;  3B8G A;  2J4K A;  3D41 A;  3K4O A;  3AB2 A;  2E9Y A;  2J4J A;  2W21 A;  4A7X A;  1OHB A;  1GS5 A;  2WXB A;  2IJ9 A;  2R98 A;  3K4Y A;  2J4L A;  4JZ8 A;  3LL5 A;  3WWN A;  3L76 A;  3ZZG A;  2RD5 A;  4NDP A;  3AAW A;  3LKK A;  2AKO A; 
#chains in the Genus database with same CATH topology
 2JI5 A;  2VA1 A;  1YBD A;  3S6G A;  2J0W A;  3K52 A;  2BND A;  4NDO A;  1OHA A;  2A1F A;  4NDQ B;  3S6K A;  3K56 A;  4NDR A;  3C1M A;  3WWM A;  2WE4 A;  2J0X A;  1B7B A;  1E19 A;  3QVH A;  3QUN A;  4F6T B;  4I49 A;  2J5T A;  3U6U A;  1GSJ A;  3EK5 A;  4JZ7 A;  4USJ A;  1OH9 A;  3ZZI A;  3ZZH A;  2BMU A;  3D2P A;  4NDP B;  2JJ4 A;  3QVF A;  3D40 A;  3C20 A;  2OGX A;  3EK6 A;  3LL9 A;  2BRX A;  2CDQ A;  2J5V A;  4AB7 A;  3QUR A;  3S6H A;  3KZF A;  2BNE A;  2BRI A;  3QUO A;  2V5H A;  2R8V A;  3TVI A;  2BUF A;  3D2M A;  1Z9D A;  2BNF A;  4AXS A;  4A7W A;  3C1N A;  2V4Y A;  3L86 A;  2AP9 A;  4F6T A;  3T7B A;  2X2W A;  4JZ9 A;  2BTY A;  4NDO B;  4OLC A;  3AB4 A;  2JJX A;  4KZT A;  2HMF A;  4NDR B;  3ZZF A;  4Q1T A;  4NDQ A;  2OGX B;  2WE5 A;  3NWY A;  3B8G A;  2J4K A;  3D41 A;  3K4O A;  3AB2 A;  2E9Y A;  2J4J A;  2W21 A;  4A7X A;  1OHB A;  1GS5 A;  2WXB A;  2IJ9 A;  2R98 A;  3K4Y A;  2J4L A;  4JZ8 A;  3LL5 A;  3WWN A;  3L76 A;  3ZZG A;  2RD5 A;  4NDP A;  3AAW A;  3LKK A;  2AKO A; 
#chains in the Genus database with same CATH homology
 2JI5 A;  2VA1 A;  1YBD A;  3S6G A;  2J0W A;  3K52 A;  2BND A;  4NDO A;  1OHA A;  2A1F A;  4NDQ B;  3S6K A;  3K56 A;  4NDR A;  3C1M A;  3WWM A;  2WE4 A;  2J0X A;  1B7B A;  1E19 A;  3QVH A;  3QUN A;  4F6T B;  4I49 A;  2J5T A;  3U6U A;  1GSJ A;  3EK5 A;  4JZ7 A;  4USJ A;  1OH9 A;  3ZZI A;  3ZZH A;  2BMU A;  3D2P A;  4NDP B;  2JJ4 A;  3QVF A;  3D40 A;  3C20 A;  2OGX A;  3EK6 A;  3LL9 A;  2BRX A;  2CDQ A;  2J5V A;  4AB7 A;  3QUR A;  3S6H A;  3KZF A;  2BNE A;  2BRI A;  3QUO A;  2V5H A;  2R8V A;  3TVI A;  2BUF A;  3D2M A;  1Z9D A;  2BNF A;  4AXS A;  4A7W A;  3C1N A;  2V4Y A;  3L86 A;  2AP9 A;  4F6T A;  3T7B A;  2X2W A;  4JZ9 A;  2BTY A;  4NDO B;  4OLC A;  3AB4 A;  2JJX A;  4KZT A;  2HMF A;  4NDR B;  3ZZF A;  4Q1T A;  4NDQ A;  2OGX B;  2WE5 A;  3NWY A;  3B8G A;  2J4K A;  3D41 A;  3K4O A;  3AB2 A;  2E9Y A;  2J4J A;  2W21 A;  4A7X A;  1OHB A;  1GS5 A;  2WXB A;  2IJ9 A;  2R98 A;  3K4Y A;  2J4L A;  4JZ8 A;  3LL5 A;  3WWN A;  3L76 A;  3ZZG A;  2RD5 A;  4NDP A;  3AAW A;  3LKK A;  2AKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...