2RD5A

Structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetylglutamate kinase-like protein
publication title Structural Basis for the Regulation of N-Acetylglutamate Kinase by PII in Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 91
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2rd5A00
2J5TA 3ZZGA 3ZZHA 2OGXB 3C1NA 1YBDA 3WWNA 1OH9A 3KZFA 3D40A 4I49A 2BRIA 2E9YA 2WE5A 4F6TA 2BUFA 2J5VA 3QUOA 3K4OA 1Z9DA 1B7BA 2J4KA 3LL9A 4NDRB 4JZ7A 3D2MA 4JZ8A 3B8GA 4OLCA 4NDOB 2JJXA 2WE4A 2JJ4A 2BTYA 2X2WA 4NDPA 1OHBA 2IJ9A 2J4LA 2VA1A 2BNFA 2HMFA 4Q1TA 3TVIA 4USJA 2OGXA 4JZ9A 3ZZIA 3C20A 2W21A 2RD5A 2J0XA 3U6UA 1GSJA 3QVHA 3QUNA 2A1FA 3K4YA 3C1MA 1E19A 4F6TB 3QVFA 3EK5A 3AB2A 2JI5A 3EK6A 3LKKA 2J0WA 4NDQB 4AB7A 4NDOA 2BNDA 2R8VA 2AKOA 3WWMA 2BNEA 2WXBA 3K52A 3LL5A 2CDQA 4KZTA 3AAWA 3NWYA 3L86A 3L76A 1OHAA 4A7WA 3T7BA 3QURA 4NDRA 2V4YA 3AB4A 3D41A 3S6KA 3S6GA 4A7XA 2BRXA 2V5HA 3ZZFA 1GS5A 2R98A 2BMUA 3K56A 4NDQA 4NDPB 3D2PA 4AXSA 3S6HA 2J4JA 2AP9A
chains in the Genus database with same CATH superfamily
2J5TA 3ZZGA 3ZZHA 2OGXB 3C1NA 1YBDA 3WWNA 1OH9A 3KZFA 3D40A 4I49A 2BRIA 2E9YA 2WE5A 4F6TA 2BUFA 2J5VA 3QUOA 3K4OA 1Z9DA 1B7BA 2J4KA 3LL9A 4NDRB 4JZ7A 3D2MA 4JZ8A 3B8GA 4OLCA 4NDOB 2JJXA 2WE4A 2JJ4A 2BTYA 2X2WA 4NDPA 1OHBA 2IJ9A 2J4LA 2VA1A 2BNFA 2HMFA 4Q1TA 3TVIA 4USJA 2OGXA 4JZ9A 3ZZIA 3C20A 2W21A 2RD5A 2J0XA 3U6UA 1GSJA 3QVHA 3QUNA 2A1FA 3K4YA 3C1MA 1E19A 4F6TB 3QVFA 3EK5A 3AB2A 2JI5A 3EK6A 3LKKA 2J0WA 4NDQB 4AB7A 4NDOA 2BNDA 2R8VA 2AKOA 3WWMA 2BNEA 2WXBA 3K52A 3LL5A 2CDQA 4KZTA 3AAWA 3NWYA 3L86A 3L76A 1OHAA 4A7WA 3T7BA 3QURA 4NDRA 2V4YA 3AB4A 3D41A 3S6KA 3S6GA 4A7XA 2BRXA 2V5HA 3ZZFA 1GS5A 2R98A 2BMUA 3K56A 4NDQA 4NDPB 3D2PA 4AXSA 3S6HA 2J4JA 2AP9A
chains in the Genus database with same CATH topology
2J5TA 3ZZGA 3ZZHA 2OGXB 3C1NA 1YBDA 3WWNA 1OH9A 3KZFA 3D40A 4I49A 2BRIA 2E9YA 2WE5A 4F6TA 2BUFA 2J5VA 3QUOA 3K4OA 1Z9DA 1B7BA 2J4KA 3LL9A 4NDRB 4JZ7A 3D2MA 4JZ8A 3B8GA 4OLCA 4NDOB 2JJXA 2WE4A 2JJ4A 2BTYA 2X2WA 4NDPA 1OHBA 2IJ9A 2J4LA 2VA1A 2BNFA 2HMFA 4Q1TA 3TVIA 4USJA 2OGXA 4JZ9A 3ZZIA 3C20A 2W21A 2RD5A 2J0XA 3U6UA 1GSJA 3QVHA 3QUNA 2A1FA 3K4YA 3C1MA 1E19A 4F6TB 3QVFA 3EK5A 3AB2A 2JI5A 3EK6A 3LKKA 2J0WA 4NDQB 4AB7A 4NDOA 2BNDA 2R8VA 2AKOA 3WWMA 2BNEA 2WXBA 3K52A 3LL5A 2CDQA 4KZTA 3AAWA 3NWYA 3L86A 3L76A 1OHAA 4A7WA 3T7BA 3QURA 4NDRA 2V4YA 3AB4A 3D41A 3S6KA 3S6GA 4A7XA 2BRXA 2V5HA 3ZZFA 1GS5A 2R98A 2BMUA 3K56A 4NDQA 4NDPB 3D2PA 4AXSA 3S6HA 2J4JA 2AP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5T A;  3ZZG A;  3ZZH A;  2OGX B;  3C1N A;  1YBD A;  3WWN A;  1OH9 A;  3KZF A;  3D40 A;  4I49 A;  2BRI A;  2E9Y A;  2WE5 A;  4F6T A;  2BUF A;  2J5V A;  3QUO A;  3K4O A;  1Z9D A;  1B7B A;  2J4K A;  3LL9 A;  4NDR B;  4JZ7 A;  3D2M A;  4JZ8 A;  3B8G A;  4OLC A;  4NDO B;  2JJX A;  2WE4 A;  2JJ4 A;  2BTY A;  2X2W A;  4NDP A;  1OHB A;  2IJ9 A;  2J4L A;  2VA1 A;  2BNF A;  2HMF A;  4Q1T A;  3TVI A;  4USJ A;  2OGX A;  4JZ9 A;  3ZZI A;  3C20 A;  2W21 A;  2RD5 A;  2J0X A;  3U6U A;  1GSJ A;  3QVH A;  3QUN A;  2A1F A;  3K4Y A;  3C1M A;  1E19 A;  4F6T B;  3QVF A;  3EK5 A;  3AB2 A;  2JI5 A;  3EK6 A;  3LKK A;  2J0W A;  4NDQ B;  4AB7 A;  4NDO A;  2BND A;  2R8V A;  2AKO A;  3WWM A;  2BNE A;  2WXB A;  3K52 A;  3LL5 A;  2CDQ A;  4KZT A;  3AAW A;  3NWY A;  3L86 A;  3L76 A;  1OHA A;  4A7W A;  3T7B A;  3QUR A;  4NDR A;  2V4Y A;  3AB4 A;  3D41 A;  3S6K A;  3S6G A;  4A7X A;  2BRX A;  2V5H A;  3ZZF A;  1GS5 A;  2R98 A;  2BMU A;  3K56 A;  4NDQ A;  4NDP B;  3D2P A;  4AXS A;  3S6H A;  2J4J A;  2AP9 A; 
#chains in the Genus database with same CATH topology
 2J5T A;  3ZZG A;  3ZZH A;  2OGX B;  3C1N A;  1YBD A;  3WWN A;  1OH9 A;  3KZF A;  3D40 A;  4I49 A;  2BRI A;  2E9Y A;  2WE5 A;  4F6T A;  2BUF A;  2J5V A;  3QUO A;  3K4O A;  1Z9D A;  1B7B A;  2J4K A;  3LL9 A;  4NDR B;  4JZ7 A;  3D2M A;  4JZ8 A;  3B8G A;  4OLC A;  4NDO B;  2JJX A;  2WE4 A;  2JJ4 A;  2BTY A;  2X2W A;  4NDP A;  1OHB A;  2IJ9 A;  2J4L A;  2VA1 A;  2BNF A;  2HMF A;  4Q1T A;  3TVI A;  4USJ A;  2OGX A;  4JZ9 A;  3ZZI A;  3C20 A;  2W21 A;  2RD5 A;  2J0X A;  3U6U A;  1GSJ A;  3QVH A;  3QUN A;  2A1F A;  3K4Y A;  3C1M A;  1E19 A;  4F6T B;  3QVF A;  3EK5 A;  3AB2 A;  2JI5 A;  3EK6 A;  3LKK A;  2J0W A;  4NDQ B;  4AB7 A;  4NDO A;  2BND A;  2R8V A;  2AKO A;  3WWM A;  2BNE A;  2WXB A;  3K52 A;  3LL5 A;  2CDQ A;  4KZT A;  3AAW A;  3NWY A;  3L86 A;  3L76 A;  1OHA A;  4A7W A;  3T7B A;  3QUR A;  4NDR A;  2V4Y A;  3AB4 A;  3D41 A;  3S6K A;  3S6G A;  4A7X A;  2BRX A;  2V5H A;  3ZZF A;  1GS5 A;  2R98 A;  2BMU A;  3K56 A;  4NDQ A;  4NDP B;  3D2P A;  4AXS A;  3S6H A;  2J4J A;  2AP9 A; 
#chains in the Genus database with same CATH homology
 2J5T A;  3ZZG A;  3ZZH A;  2OGX B;  3C1N A;  1YBD A;  3WWN A;  1OH9 A;  3KZF A;  3D40 A;  4I49 A;  2BRI A;  2E9Y A;  2WE5 A;  4F6T A;  2BUF A;  2J5V A;  3QUO A;  3K4O A;  1Z9D A;  1B7B A;  2J4K A;  3LL9 A;  4NDR B;  4JZ7 A;  3D2M A;  4JZ8 A;  3B8G A;  4OLC A;  4NDO B;  2JJX A;  2WE4 A;  2JJ4 A;  2BTY A;  2X2W A;  4NDP A;  1OHB A;  2IJ9 A;  2J4L A;  2VA1 A;  2BNF A;  2HMF A;  4Q1T A;  3TVI A;  4USJ A;  2OGX A;  4JZ9 A;  3ZZI A;  3C20 A;  2W21 A;  2RD5 A;  2J0X A;  3U6U A;  1GSJ A;  3QVH A;  3QUN A;  2A1F A;  3K4Y A;  3C1M A;  1E19 A;  4F6T B;  3QVF A;  3EK5 A;  3AB2 A;  2JI5 A;  3EK6 A;  3LKK A;  2J0W A;  4NDQ B;  4AB7 A;  4NDO A;  2BND A;  2R8V A;  2AKO A;  3WWM A;  2BNE A;  2WXB A;  3K52 A;  3LL5 A;  2CDQ A;  4KZT A;  3AAW A;  3NWY A;  3L86 A;  3L76 A;  1OHA A;  4A7W A;  3T7B A;  3QUR A;  4NDR A;  2V4Y A;  3AB4 A;  3D41 A;  3S6K A;  3S6G A;  4A7X A;  2BRX A;  2V5H A;  3ZZF A;  1GS5 A;  2R98 A;  2BMU A;  3K56 A;  4NDQ A;  4NDP B;  3D2P A;  4AXS A;  3S6H A;  2J4J A;  2AP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...