2V4YA

The structure of e. coli ump kinase in complex with its allosteric regulator gtp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Escherichia Coli Ump Kinase in Complex with its Allosteric Regulator GTP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 79
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2v4yA00
3D2PA 3LL5A 2JI5A 3NWYA 4A7XA 2BNDA 2WE4A 2J4LA 4F6TB 3K4OA 2X2WA 3L76A 2J5VA 3AB2A 3B8GA 4NDQA 4USJA 3S6HA 2BNEA 1Z9DA 4AXSA 2WXBA 3ZZHA 2J4JA 3QVFA 3C1MA 3K52A 4I49A 4NDPB 2R8VA 4Q1TA 3TVIA 3LL9A 4NDPA 3KZFA 3AB4A 3ZZGA 3EK5A 3QURA 4JZ9A 2AKOA 3QVHA 4KZTA 2OGXA 2V4YA 1GS5A 2RD5A 3EK6A 3ZZFA 1YBDA 2BRXA 2BNFA 1B7BA 3S6KA 2J4KA 3ZZIA 2IJ9A 3LKKA 2J0WA 1GSJA 4A7WA 3T7BA 3WWMA 2J5TA 4NDRB 2E9YA 3L86A 2W21A 2J0XA 2JJXA 3D40A 2BMUA 2JJ4A 3D2MA 4F6TA 2VA1A 1OH9A 1OHBA 2R98A 4NDOA 4AB7A 3S6GA 2V5HA 3U6UA 3QUOA 3AAWA 4NDOB 2BTYA 2AP9A 3QUNA 2A1FA 4NDRA 1E19A 1OHAA 4JZ8A 4NDQB 3C20A 2BUFA 3K56A 3K4YA 2HMFA 3C1NA 2OGXB 3D41A 3WWNA 2BRIA 2WE5A 4OLCA 2CDQA 4JZ7A
chains in the Genus database with same CATH superfamily
3D2PA 3LL5A 2JI5A 3NWYA 4A7XA 2BNDA 2WE4A 2J4LA 4F6TB 3K4OA 2X2WA 3L76A 2J5VA 3AB2A 3B8GA 4NDQA 4USJA 3S6HA 2BNEA 1Z9DA 4AXSA 2WXBA 3ZZHA 2J4JA 3QVFA 3C1MA 3K52A 4I49A 4NDPB 2R8VA 4Q1TA 3TVIA 3LL9A 4NDPA 3KZFA 3AB4A 3ZZGA 3EK5A 3QURA 4JZ9A 2AKOA 3QVHA 4KZTA 2OGXA 2V4YA 1GS5A 2RD5A 3EK6A 3ZZFA 1YBDA 2BRXA 2BNFA 1B7BA 3S6KA 2J4KA 3ZZIA 2IJ9A 3LKKA 2J0WA 1GSJA 4A7WA 3T7BA 3WWMA 2J5TA 4NDRB 2E9YA 3L86A 2W21A 2J0XA 2JJXA 3D40A 2BMUA 2JJ4A 3D2MA 4F6TA 2VA1A 1OH9A 1OHBA 2R98A 4NDOA 4AB7A 3S6GA 2V5HA 3U6UA 3QUOA 3AAWA 4NDOB 2BTYA 2AP9A 3QUNA 2A1FA 4NDRA 1E19A 1OHAA 4JZ8A 4NDQB 3C20A 2BUFA 3K56A 3K4YA 2HMFA 3C1NA 2OGXB 3D41A 3WWNA 2BRIA 2WE5A 4OLCA 2CDQA 4JZ7A
chains in the Genus database with same CATH topology
3D2PA 3LL5A 2JI5A 3NWYA 4A7XA 2BNDA 2WE4A 2J4LA 4F6TB 3K4OA 2X2WA 3L76A 2J5VA 3AB2A 3B8GA 4NDQA 4USJA 3S6HA 2BNEA 1Z9DA 4AXSA 2WXBA 3ZZHA 2J4JA 3QVFA 3C1MA 3K52A 4I49A 4NDPB 2R8VA 4Q1TA 3TVIA 3LL9A 4NDPA 3KZFA 3AB4A 3ZZGA 3EK5A 3QURA 4JZ9A 2AKOA 3QVHA 4KZTA 2OGXA 2V4YA 1GS5A 2RD5A 3EK6A 3ZZFA 1YBDA 2BRXA 2BNFA 1B7BA 3S6KA 2J4KA 3ZZIA 2IJ9A 3LKKA 2J0WA 1GSJA 4A7WA 3T7BA 3WWMA 2J5TA 4NDRB 2E9YA 3L86A 2W21A 2J0XA 2JJXA 3D40A 2BMUA 2JJ4A 3D2MA 4F6TA 2VA1A 1OH9A 1OHBA 2R98A 4NDOA 4AB7A 3S6GA 2V5HA 3U6UA 3QUOA 3AAWA 4NDOB 2BTYA 2AP9A 3QUNA 2A1FA 4NDRA 1E19A 1OHAA 4JZ8A 4NDQB 3C20A 2BUFA 3K56A 3K4YA 2HMFA 3C1NA 2OGXB 3D41A 3WWNA 2BRIA 2WE5A 4OLCA 2CDQA 4JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2P A;  3LL5 A;  2JI5 A;  3NWY A;  4A7X A;  2BND A;  2WE4 A;  2J4L A;  4F6T B;  3K4O A;  2X2W A;  3L76 A;  2J5V A;  3AB2 A;  3B8G A;  4NDQ A;  4USJ A;  3S6H A;  2BNE A;  1Z9D A;  4AXS A;  2WXB A;  3ZZH A;  2J4J A;  3QVF A;  3C1M A;  3K52 A;  4I49 A;  4NDP B;  2R8V A;  4Q1T A;  3TVI A;  3LL9 A;  4NDP A;  3KZF A;  3AB4 A;  3ZZG A;  3EK5 A;  3QUR A;  4JZ9 A;  2AKO A;  3QVH A;  4KZT A;  2OGX A;  2V4Y A;  1GS5 A;  2RD5 A;  3EK6 A;  3ZZF A;  1YBD A;  2BRX A;  2BNF A;  1B7B A;  3S6K A;  2J4K A;  3ZZI A;  2IJ9 A;  3LKK A;  2J0W A;  1GSJ A;  4A7W A;  3T7B A;  3WWM A;  2J5T A;  4NDR B;  2E9Y A;  3L86 A;  2W21 A;  2J0X A;  2JJX A;  3D40 A;  2BMU A;  2JJ4 A;  3D2M A;  4F6T A;  2VA1 A;  1OH9 A;  1OHB A;  2R98 A;  4NDO A;  4AB7 A;  3S6G A;  2V5H A;  3U6U A;  3QUO A;  3AAW A;  4NDO B;  2BTY A;  2AP9 A;  3QUN A;  2A1F A;  4NDR A;  1E19 A;  1OHA A;  4JZ8 A;  4NDQ B;  3C20 A;  2BUF A;  3K56 A;  3K4Y A;  2HMF A;  3C1N A;  2OGX B;  3D41 A;  3WWN A;  2BRI A;  2WE5 A;  4OLC A;  2CDQ A;  4JZ7 A; 
#chains in the Genus database with same CATH topology
 3D2P A;  3LL5 A;  2JI5 A;  3NWY A;  4A7X A;  2BND A;  2WE4 A;  2J4L A;  4F6T B;  3K4O A;  2X2W A;  3L76 A;  2J5V A;  3AB2 A;  3B8G A;  4NDQ A;  4USJ A;  3S6H A;  2BNE A;  1Z9D A;  4AXS A;  2WXB A;  3ZZH A;  2J4J A;  3QVF A;  3C1M A;  3K52 A;  4I49 A;  4NDP B;  2R8V A;  4Q1T A;  3TVI A;  3LL9 A;  4NDP A;  3KZF A;  3AB4 A;  3ZZG A;  3EK5 A;  3QUR A;  4JZ9 A;  2AKO A;  3QVH A;  4KZT A;  2OGX A;  2V4Y A;  1GS5 A;  2RD5 A;  3EK6 A;  3ZZF A;  1YBD A;  2BRX A;  2BNF A;  1B7B A;  3S6K A;  2J4K A;  3ZZI A;  2IJ9 A;  3LKK A;  2J0W A;  1GSJ A;  4A7W A;  3T7B A;  3WWM A;  2J5T A;  4NDR B;  2E9Y A;  3L86 A;  2W21 A;  2J0X A;  2JJX A;  3D40 A;  2BMU A;  2JJ4 A;  3D2M A;  4F6T A;  2VA1 A;  1OH9 A;  1OHB A;  2R98 A;  4NDO A;  4AB7 A;  3S6G A;  2V5H A;  3U6U A;  3QUO A;  3AAW A;  4NDO B;  2BTY A;  2AP9 A;  3QUN A;  2A1F A;  4NDR A;  1E19 A;  1OHA A;  4JZ8 A;  4NDQ B;  3C20 A;  2BUF A;  3K56 A;  3K4Y A;  2HMF A;  3C1N A;  2OGX B;  3D41 A;  3WWN A;  2BRI A;  2WE5 A;  4OLC A;  2CDQ A;  4JZ7 A; 
#chains in the Genus database with same CATH homology
 3D2P A;  3LL5 A;  2JI5 A;  3NWY A;  4A7X A;  2BND A;  2WE4 A;  2J4L A;  4F6T B;  3K4O A;  2X2W A;  3L76 A;  2J5V A;  3AB2 A;  3B8G A;  4NDQ A;  4USJ A;  3S6H A;  2BNE A;  1Z9D A;  4AXS A;  2WXB A;  3ZZH A;  2J4J A;  3QVF A;  3C1M A;  3K52 A;  4I49 A;  4NDP B;  2R8V A;  4Q1T A;  3TVI A;  3LL9 A;  4NDP A;  3KZF A;  3AB4 A;  3ZZG A;  3EK5 A;  3QUR A;  4JZ9 A;  2AKO A;  3QVH A;  4KZT A;  2OGX A;  2V4Y A;  1GS5 A;  2RD5 A;  3EK6 A;  3ZZF A;  1YBD A;  2BRX A;  2BNF A;  1B7B A;  3S6K A;  2J4K A;  3ZZI A;  2IJ9 A;  3LKK A;  2J0W A;  1GSJ A;  4A7W A;  3T7B A;  3WWM A;  2J5T A;  4NDR B;  2E9Y A;  3L86 A;  2W21 A;  2J0X A;  2JJX A;  3D40 A;  2BMU A;  2JJ4 A;  3D2M A;  4F6T A;  2VA1 A;  1OH9 A;  1OHB A;  2R98 A;  4NDO A;  4AB7 A;  3S6G A;  2V5H A;  3U6U A;  3QUO A;  3AAW A;  4NDO B;  2BTY A;  2AP9 A;  3QUN A;  2A1F A;  4NDR A;  1E19 A;  1OHA A;  4JZ8 A;  4NDQ B;  3C20 A;  2BUF A;  3K56 A;  3K4Y A;  2HMF A;  3C1N A;  2OGX B;  3D41 A;  3WWN A;  2BRI A;  2WE5 A;  4OLC A;  2CDQ A;  4JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...