2V4YA

The structure of e. coli ump kinase in complex with its allosteric regulator gtp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords URIDYLATE KINASE
publication title Structural and Functional Characterization of Escherichia Coli Ump Kinase in Complex with its Allosteric Regulator GTP.
pubmed doi rcsb
source organism Escherichia coli
total genus 79
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2v4yA00
3S6HA 1OHBA 3K52A 2V5HA 3ZZIA 2IJ9A 3QUNA 1E19A 2J0WA 4NDOB 3TVIA 1GSJA 3ZZHA 4F6TB 4NDQB 3D2PA 2AP9A 3KZFA 2X2WA 3WWMA 2V4YA 2HMFA 3LL9A 2A1FA 3C1MA 4NDRB 3K4YA 3LL5A 2OGXA 4OLCA 4NDPB 3QURA 2BNFA 2J5TA 2JJ4A 3AB2A 3LKKA 4A7WA 1Z9DA 3D40A 3B8GA 2J4LA 2W21A 3QUOA 4F6TA 2BNDA 2JJXA 3AAWA 2J5VA 2RD5A 3T7BA 2BRXA 2AKOA 2BRIA 2BNEA 1B7BA 4JZ8A 2R98A 2BTYA 4Q1TA 2OGXB 4AB7A 4A7XA 2J4JA 2J4KA 3EK6A 2WXBA 4NDOA 3D2MA 4NDQA 1OH9A 3S6KA 2WE5A 4I49A 3K4OA 3C1NA 4USJA 3AB4A 2VA1A 2BMUA 2WE4A 3U6UA 4NDRA 1OHAA 3S6GA 3L76A 3EK5A 4NDPA 2E9YA 1YBDA 3ZZGA 4AXSA 2J0XA 3L86A 3QVHA 2CDQA 2R8VA 3C20A 4JZ7A 3ZZFA 3WWNA 4KZTA 3QVFA 1GS5A 4JZ9A 3D41A 3K56A 2JI5A 2BUFA 3NWYA
chains in the Genus database with same CATH superfamily
3S6HA 1OHBA 3K52A 2V5HA 3ZZIA 2IJ9A 3QUNA 1E19A 2J0WA 4NDOB 3TVIA 1GSJA 3ZZHA 4F6TB 4NDQB 3D2PA 2AP9A 3KZFA 2X2WA 3WWMA 2V4YA 2HMFA 3LL9A 2A1FA 3C1MA 4NDRB 3K4YA 3LL5A 2OGXA 4OLCA 4NDPB 3QURA 2BNFA 2J5TA 2JJ4A 3AB2A 3LKKA 4A7WA 1Z9DA 3D40A 3B8GA 2J4LA 2W21A 3QUOA 4F6TA 2BNDA 2JJXA 3AAWA 2J5VA 2RD5A 3T7BA 2BRXA 2AKOA 2BRIA 2BNEA 1B7BA 4JZ8A 2R98A 2BTYA 4Q1TA 2OGXB 4AB7A 4A7XA 2J4JA 2J4KA 3EK6A 2WXBA 4NDOA 3D2MA 4NDQA 1OH9A 3S6KA 2WE5A 4I49A 3K4OA 3C1NA 4USJA 3AB4A 2VA1A 2BMUA 2WE4A 3U6UA 4NDRA 1OHAA 3S6GA 3L76A 3EK5A 4NDPA 2E9YA 1YBDA 3ZZGA 4AXSA 2J0XA 3L86A 3QVHA 2CDQA 2R8VA 3C20A 4JZ7A 3ZZFA 3WWNA 4KZTA 3QVFA 1GS5A 4JZ9A 3D41A 3K56A 2JI5A 2BUFA 3NWYA
chains in the Genus database with same CATH topology
3S6HA 1OHBA 3K52A 2V5HA 3ZZIA 2IJ9A 3QUNA 1E19A 2J0WA 4NDOB 3TVIA 1GSJA 3ZZHA 4F6TB 4NDQB 3D2PA 2AP9A 3KZFA 2X2WA 3WWMA 2V4YA 2HMFA 3LL9A 2A1FA 3C1MA 4NDRB 3K4YA 3LL5A 2OGXA 4OLCA 4NDPB 3QURA 2BNFA 2J5TA 2JJ4A 3AB2A 3LKKA 4A7WA 1Z9DA 3D40A 3B8GA 2J4LA 2W21A 3QUOA 4F6TA 2BNDA 2JJXA 3AAWA 2J5VA 2RD5A 3T7BA 2BRXA 2AKOA 2BRIA 2BNEA 1B7BA 4JZ8A 2R98A 2BTYA 4Q1TA 2OGXB 4AB7A 4A7XA 2J4JA 2J4KA 3EK6A 2WXBA 4NDOA 3D2MA 4NDQA 1OH9A 3S6KA 2WE5A 4I49A 3K4OA 3C1NA 4USJA 3AB4A 2VA1A 2BMUA 2WE4A 3U6UA 4NDRA 1OHAA 3S6GA 3L76A 3EK5A 4NDPA 2E9YA 1YBDA 3ZZGA 4AXSA 2J0XA 3L86A 3QVHA 2CDQA 2R8VA 3C20A 4JZ7A 3ZZFA 3WWNA 4KZTA 3QVFA 1GS5A 4JZ9A 3D41A 3K56A 2JI5A 2BUFA 3NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  1OHB A;  3K52 A;  2V5H A;  3ZZI A;  2IJ9 A;  3QUN A;  1E19 A;  2J0W A;  4NDO B;  3TVI A;  1GSJ A;  3ZZH A;  4F6T B;  4NDQ B;  3D2P A;  2AP9 A;  3KZF A;  2X2W A;  3WWM A;  2V4Y A;  2HMF A;  3LL9 A;  2A1F A;  3C1M A;  4NDR B;  3K4Y A;  3LL5 A;  2OGX A;  4OLC A;  4NDP B;  3QUR A;  2BNF A;  2J5T A;  2JJ4 A;  3AB2 A;  3LKK A;  4A7W A;  1Z9D A;  3D40 A;  3B8G A;  2J4L A;  2W21 A;  3QUO A;  4F6T A;  2BND A;  2JJX A;  3AAW A;  2J5V A;  2RD5 A;  3T7B A;  2BRX A;  2AKO A;  2BRI A;  2BNE A;  1B7B A;  4JZ8 A;  2R98 A;  2BTY A;  4Q1T A;  2OGX B;  4AB7 A;  4A7X A;  2J4J A;  2J4K A;  3EK6 A;  2WXB A;  4NDO A;  3D2M A;  4NDQ A;  1OH9 A;  3S6K A;  2WE5 A;  4I49 A;  3K4O A;  3C1N A;  4USJ A;  3AB4 A;  2VA1 A;  2BMU A;  2WE4 A;  3U6U A;  4NDR A;  1OHA A;  3S6G A;  3L76 A;  3EK5 A;  4NDP A;  2E9Y A;  1YBD A;  3ZZG A;  4AXS A;  2J0X A;  3L86 A;  3QVH A;  2CDQ A;  2R8V A;  3C20 A;  4JZ7 A;  3ZZF A;  3WWN A;  4KZT A;  3QVF A;  1GS5 A;  4JZ9 A;  3D41 A;  3K56 A;  2JI5 A;  2BUF A;  3NWY A; 
#chains in the Genus database with same CATH topology
 3S6H A;  1OHB A;  3K52 A;  2V5H A;  3ZZI A;  2IJ9 A;  3QUN A;  1E19 A;  2J0W A;  4NDO B;  3TVI A;  1GSJ A;  3ZZH A;  4F6T B;  4NDQ B;  3D2P A;  2AP9 A;  3KZF A;  2X2W A;  3WWM A;  2V4Y A;  2HMF A;  3LL9 A;  2A1F A;  3C1M A;  4NDR B;  3K4Y A;  3LL5 A;  2OGX A;  4OLC A;  4NDP B;  3QUR A;  2BNF A;  2J5T A;  2JJ4 A;  3AB2 A;  3LKK A;  4A7W A;  1Z9D A;  3D40 A;  3B8G A;  2J4L A;  2W21 A;  3QUO A;  4F6T A;  2BND A;  2JJX A;  3AAW A;  2J5V A;  2RD5 A;  3T7B A;  2BRX A;  2AKO A;  2BRI A;  2BNE A;  1B7B A;  4JZ8 A;  2R98 A;  2BTY A;  4Q1T A;  2OGX B;  4AB7 A;  4A7X A;  2J4J A;  2J4K A;  3EK6 A;  2WXB A;  4NDO A;  3D2M A;  4NDQ A;  1OH9 A;  3S6K A;  2WE5 A;  4I49 A;  3K4O A;  3C1N A;  4USJ A;  3AB4 A;  2VA1 A;  2BMU A;  2WE4 A;  3U6U A;  4NDR A;  1OHA A;  3S6G A;  3L76 A;  3EK5 A;  4NDP A;  2E9Y A;  1YBD A;  3ZZG A;  4AXS A;  2J0X A;  3L86 A;  3QVH A;  2CDQ A;  2R8V A;  3C20 A;  4JZ7 A;  3ZZF A;  3WWN A;  4KZT A;  3QVF A;  1GS5 A;  4JZ9 A;  3D41 A;  3K56 A;  2JI5 A;  2BUF A;  3NWY A; 
#chains in the Genus database with same CATH homology
 3S6H A;  1OHB A;  3K52 A;  2V5H A;  3ZZI A;  2IJ9 A;  3QUN A;  1E19 A;  2J0W A;  4NDO B;  3TVI A;  1GSJ A;  3ZZH A;  4F6T B;  4NDQ B;  3D2P A;  2AP9 A;  3KZF A;  2X2W A;  3WWM A;  2V4Y A;  2HMF A;  3LL9 A;  2A1F A;  3C1M A;  4NDR B;  3K4Y A;  3LL5 A;  2OGX A;  4OLC A;  4NDP B;  3QUR A;  2BNF A;  2J5T A;  2JJ4 A;  3AB2 A;  3LKK A;  4A7W A;  1Z9D A;  3D40 A;  3B8G A;  2J4L A;  2W21 A;  3QUO A;  4F6T A;  2BND A;  2JJX A;  3AAW A;  2J5V A;  2RD5 A;  3T7B A;  2BRX A;  2AKO A;  2BRI A;  2BNE A;  1B7B A;  4JZ8 A;  2R98 A;  2BTY A;  4Q1T A;  2OGX B;  4AB7 A;  4A7X A;  2J4J A;  2J4K A;  3EK6 A;  2WXB A;  4NDO A;  3D2M A;  4NDQ A;  1OH9 A;  3S6K A;  2WE5 A;  4I49 A;  3K4O A;  3C1N A;  4USJ A;  3AB4 A;  2VA1 A;  2BMU A;  2WE4 A;  3U6U A;  4NDR A;  1OHA A;  3S6G A;  3L76 A;  3EK5 A;  4NDP A;  2E9Y A;  1YBD A;  3ZZG A;  4AXS A;  2J0X A;  3L86 A;  3QVH A;  2CDQ A;  2R8V A;  3C20 A;  4JZ7 A;  3ZZF A;  3WWN A;  4KZT A;  3QVF A;  1GS5 A;  4JZ9 A;  3D41 A;  3K56 A;  2JI5 A;  2BUF A;  3NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...