2V4YA

The structure of e. coli ump kinase in complex with its allosteric regulator gtp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structural and Functional Characterization of Escherichia Coli Ump Kinase in Complex with its Allosteric Regulator GTP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2v4yA00
3AAWA 3QURA 3ZZGA 3LL9A 3ZZFA 3LL5A 3B8GA 1YBDA 2AKOA 2JJXA 2VA1A 3EK6A 1B7BA 3LKKA 4A7WA 4NDRA 2J5TA 2JI5A 3ZZIA 2BTYA 4A7XA 3WWNA 3K56A 4USJA 2J5VA 4NDQB 3QUOA 3WWMA 4AXSA 2R8VA 4NDPA 2A1FA 2JJ4A 2J4KA 3AB2A 3T7BA 2J4LA 4NDOB 4JZ7A 4F6TA 2OGXB 3K4OA 3AB4A 3QUNA 1OHBA 3K4YA 4JZ9A 3D41A 2BRXA 3NWYA 3S6HA 1OHAA 3EK5A 3L86A 3QVFA 2X2WA 2IJ9A 2J4JA 3L76A 4KZTA 3C20A 4JZ8A 3C1NA 2HMFA 1GSJA 2J0XA 4I49A 2V4YA 4NDQA 2WXBA 2AP9A 2BMUA 2E9YA 3QVHA 2R98A 3S6GA 3ZZHA 3U6UA 3C1MA 3KZFA 4NDRB 1Z9DA 4Q1TA 4AB7A 3D2PA 2V5HA 3K52A 1OH9A 4NDOA 1GS5A 2BNDA 2J0WA 4OLCA 2W21A 1E19A 2OGXA 3D2MA 2WE4A 2BNEA 4NDPB 2BRIA 2BNFA 2CDQA 3D40A 2WE5A 3TVIA 2BUFA 3S6KA 2RD5A 4F6TB
chains in the Genus database with same CATH superfamily
3AAWA 3QURA 3ZZGA 3LL9A 3ZZFA 3LL5A 3B8GA 1YBDA 2AKOA 2JJXA 2VA1A 3EK6A 1B7BA 3LKKA 4A7WA 4NDRA 2J5TA 2JI5A 3ZZIA 2BTYA 4A7XA 3WWNA 3K56A 4USJA 2J5VA 4NDQB 3QUOA 3WWMA 4AXSA 2R8VA 4NDPA 2A1FA 2JJ4A 2J4KA 3AB2A 3T7BA 2J4LA 4NDOB 4JZ7A 4F6TA 2OGXB 3K4OA 3AB4A 3QUNA 1OHBA 3K4YA 4JZ9A 3D41A 2BRXA 3NWYA 3S6HA 1OHAA 3EK5A 3L86A 3QVFA 2X2WA 2IJ9A 2J4JA 3L76A 4KZTA 3C20A 4JZ8A 3C1NA 2HMFA 1GSJA 2J0XA 4I49A 2V4YA 4NDQA 2WXBA 2AP9A 2BMUA 2E9YA 3QVHA 2R98A 3S6GA 3ZZHA 3U6UA 3C1MA 3KZFA 4NDRB 1Z9DA 4Q1TA 4AB7A 3D2PA 2V5HA 3K52A 1OH9A 4NDOA 1GS5A 2BNDA 2J0WA 4OLCA 2W21A 1E19A 2OGXA 3D2MA 2WE4A 2BNEA 4NDPB 2BRIA 2BNFA 2CDQA 3D40A 2WE5A 3TVIA 2BUFA 3S6KA 2RD5A 4F6TB
chains in the Genus database with same CATH topology
3AAWA 3QURA 3ZZGA 3LL9A 3ZZFA 3LL5A 3B8GA 1YBDA 2AKOA 2JJXA 2VA1A 3EK6A 1B7BA 3LKKA 4A7WA 4NDRA 2J5TA 2JI5A 3ZZIA 2BTYA 4A7XA 3WWNA 3K56A 4USJA 2J5VA 4NDQB 3QUOA 3WWMA 4AXSA 2R8VA 4NDPA 2A1FA 2JJ4A 2J4KA 3AB2A 3T7BA 2J4LA 4NDOB 4JZ7A 4F6TA 2OGXB 3K4OA 3AB4A 3QUNA 1OHBA 3K4YA 4JZ9A 3D41A 2BRXA 3NWYA 3S6HA 1OHAA 3EK5A 3L86A 3QVFA 2X2WA 2IJ9A 2J4JA 3L76A 4KZTA 3C20A 4JZ8A 3C1NA 2HMFA 1GSJA 2J0XA 4I49A 2V4YA 4NDQA 2WXBA 2AP9A 2BMUA 2E9YA 3QVHA 2R98A 3S6GA 3ZZHA 3U6UA 3C1MA 3KZFA 4NDRB 1Z9DA 4Q1TA 4AB7A 3D2PA 2V5HA 3K52A 1OH9A 4NDOA 1GS5A 2BNDA 2J0WA 4OLCA 2W21A 1E19A 2OGXA 3D2MA 2WE4A 2BNEA 4NDPB 2BRIA 2BNFA 2CDQA 3D40A 2WE5A 3TVIA 2BUFA 3S6KA 2RD5A 4F6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAW A;  3QUR A;  3ZZG A;  3LL9 A;  3ZZF A;  3LL5 A;  3B8G A;  1YBD A;  2AKO A;  2JJX A;  2VA1 A;  3EK6 A;  1B7B A;  3LKK A;  4A7W A;  4NDR A;  2J5T A;  2JI5 A;  3ZZI A;  2BTY A;  4A7X A;  3WWN A;  3K56 A;  4USJ A;  2J5V A;  4NDQ B;  3QUO A;  3WWM A;  4AXS A;  2R8V A;  4NDP A;  2A1F A;  2JJ4 A;  2J4K A;  3AB2 A;  3T7B A;  2J4L A;  4NDO B;  4JZ7 A;  4F6T A;  2OGX B;  3K4O A;  3AB4 A;  3QUN A;  1OHB A;  3K4Y A;  4JZ9 A;  3D41 A;  2BRX A;  3NWY A;  3S6H A;  1OHA A;  3EK5 A;  3L86 A;  3QVF A;  2X2W A;  2IJ9 A;  2J4J A;  3L76 A;  4KZT A;  3C20 A;  4JZ8 A;  3C1N A;  2HMF A;  1GSJ A;  2J0X A;  4I49 A;  2V4Y A;  4NDQ A;  2WXB A;  2AP9 A;  2BMU A;  2E9Y A;  3QVH A;  2R98 A;  3S6G A;  3ZZH A;  3U6U A;  3C1M A;  3KZF A;  4NDR B;  1Z9D A;  4Q1T A;  4AB7 A;  3D2P A;  2V5H A;  3K52 A;  1OH9 A;  4NDO A;  1GS5 A;  2BND A;  2J0W A;  4OLC A;  2W21 A;  1E19 A;  2OGX A;  3D2M A;  2WE4 A;  2BNE A;  4NDP B;  2BRI A;  2BNF A;  2CDQ A;  3D40 A;  2WE5 A;  3TVI A;  2BUF A;  3S6K A;  2RD5 A;  4F6T B; 
#chains in the Genus database with same CATH topology
 3AAW A;  3QUR A;  3ZZG A;  3LL9 A;  3ZZF A;  3LL5 A;  3B8G A;  1YBD A;  2AKO A;  2JJX A;  2VA1 A;  3EK6 A;  1B7B A;  3LKK A;  4A7W A;  4NDR A;  2J5T A;  2JI5 A;  3ZZI A;  2BTY A;  4A7X A;  3WWN A;  3K56 A;  4USJ A;  2J5V A;  4NDQ B;  3QUO A;  3WWM A;  4AXS A;  2R8V A;  4NDP A;  2A1F A;  2JJ4 A;  2J4K A;  3AB2 A;  3T7B A;  2J4L A;  4NDO B;  4JZ7 A;  4F6T A;  2OGX B;  3K4O A;  3AB4 A;  3QUN A;  1OHB A;  3K4Y A;  4JZ9 A;  3D41 A;  2BRX A;  3NWY A;  3S6H A;  1OHA A;  3EK5 A;  3L86 A;  3QVF A;  2X2W A;  2IJ9 A;  2J4J A;  3L76 A;  4KZT A;  3C20 A;  4JZ8 A;  3C1N A;  2HMF A;  1GSJ A;  2J0X A;  4I49 A;  2V4Y A;  4NDQ A;  2WXB A;  2AP9 A;  2BMU A;  2E9Y A;  3QVH A;  2R98 A;  3S6G A;  3ZZH A;  3U6U A;  3C1M A;  3KZF A;  4NDR B;  1Z9D A;  4Q1T A;  4AB7 A;  3D2P A;  2V5H A;  3K52 A;  1OH9 A;  4NDO A;  1GS5 A;  2BND A;  2J0W A;  4OLC A;  2W21 A;  1E19 A;  2OGX A;  3D2M A;  2WE4 A;  2BNE A;  4NDP B;  2BRI A;  2BNF A;  2CDQ A;  3D40 A;  2WE5 A;  3TVI A;  2BUF A;  3S6K A;  2RD5 A;  4F6T B; 
#chains in the Genus database with same CATH homology
 3AAW A;  3QUR A;  3ZZG A;  3LL9 A;  3ZZF A;  3LL5 A;  3B8G A;  1YBD A;  2AKO A;  2JJX A;  2VA1 A;  3EK6 A;  1B7B A;  3LKK A;  4A7W A;  4NDR A;  2J5T A;  2JI5 A;  3ZZI A;  2BTY A;  4A7X A;  3WWN A;  3K56 A;  4USJ A;  2J5V A;  4NDQ B;  3QUO A;  3WWM A;  4AXS A;  2R8V A;  4NDP A;  2A1F A;  2JJ4 A;  2J4K A;  3AB2 A;  3T7B A;  2J4L A;  4NDO B;  4JZ7 A;  4F6T A;  2OGX B;  3K4O A;  3AB4 A;  3QUN A;  1OHB A;  3K4Y A;  4JZ9 A;  3D41 A;  2BRX A;  3NWY A;  3S6H A;  1OHA A;  3EK5 A;  3L86 A;  3QVF A;  2X2W A;  2IJ9 A;  2J4J A;  3L76 A;  4KZT A;  3C20 A;  4JZ8 A;  3C1N A;  2HMF A;  1GSJ A;  2J0X A;  4I49 A;  2V4Y A;  4NDQ A;  2WXB A;  2AP9 A;  2BMU A;  2E9Y A;  3QVH A;  2R98 A;  3S6G A;  3ZZH A;  3U6U A;  3C1M A;  3KZF A;  4NDR B;  1Z9D A;  4Q1T A;  4AB7 A;  3D2P A;  2V5H A;  3K52 A;  1OH9 A;  4NDO A;  1GS5 A;  2BND A;  2J0W A;  4OLC A;  2W21 A;  1E19 A;  2OGX A;  3D2M A;  2WE4 A;  2BNE A;  4NDP B;  2BRI A;  2BNF A;  2CDQ A;  3D40 A;  2WE5 A;  3TVI A;  2BUF A;  3S6K A;  2RD5 A;  4F6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...