2V4YA

The structure of e. coli ump kinase in complex with its allosteric regulator gtp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Escherichia Coli Ump Kinase in Complex with its Allosteric Regulator GTP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 79
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2v4yA00
1YBDA 2A1FA 2CDQA 3EK6A 4NDQB 3WWMA 2BUFA 4NDOB 1E19A 3TVIA 3AAWA 2VA1A 2RD5A 4A7XA 3C1MA 2V5HA 3AB2A 4NDRA 2V4YA 3T7BA 4USJA 3ZZIA 2WE5A 3QURA 1OHAA 2WXBA 3C20A 3K52A 2BNFA 2IJ9A 3B8GA 1OH9A 4JZ9A 4I49A 4A7WA 3LL5A 3QVFA 3AB4A 4NDOA 2HMFA 4NDRB 1B7BA 3K4OA 4Q1TA 1GSJA 4JZ7A 3WWNA 2OGXB 3LKKA 3NWYA 2E9YA 2J4KA 3D2PA 4F6TA 4NDPB 4OLCA 3S6HA 2JJ4A 4KZTA 4NDPA 1Z9DA 3ZZGA 4F6TB 4NDQA 3S6KA 3KZFA 2J0WA 1OHBA 3LL9A 2R8VA 2J0XA 2BNEA 2AKOA 2J5VA 2OGXA 3K56A 3QUNA 2J4LA 2BNDA 2W21A 3U6UA 2BMUA 3S6GA 3D40A 4AB7A 2J5TA 2AP9A 2WE4A 2X2WA 3ZZFA 4AXSA 3QVHA 3C1NA 3D2MA 2JJXA 3L76A 2J4JA 3D41A 2JI5A 3EK5A 3QUOA 2BRXA 2BRIA 3ZZHA 1GS5A 3L86A 3K4YA 2R98A 4JZ8A 2BTYA
chains in the Genus database with same CATH superfamily
1YBDA 2A1FA 2CDQA 3EK6A 4NDQB 3WWMA 2BUFA 4NDOB 1E19A 3TVIA 3AAWA 2VA1A 2RD5A 4A7XA 3C1MA 2V5HA 3AB2A 4NDRA 2V4YA 3T7BA 4USJA 3ZZIA 2WE5A 3QURA 1OHAA 2WXBA 3C20A 3K52A 2BNFA 2IJ9A 3B8GA 1OH9A 4JZ9A 4I49A 4A7WA 3LL5A 3QVFA 3AB4A 4NDOA 2HMFA 4NDRB 1B7BA 3K4OA 4Q1TA 1GSJA 4JZ7A 3WWNA 2OGXB 3LKKA 3NWYA 2E9YA 2J4KA 3D2PA 4F6TA 4NDPB 4OLCA 3S6HA 2JJ4A 4KZTA 4NDPA 1Z9DA 3ZZGA 4F6TB 4NDQA 3S6KA 3KZFA 2J0WA 1OHBA 3LL9A 2R8VA 2J0XA 2BNEA 2AKOA 2J5VA 2OGXA 3K56A 3QUNA 2J4LA 2BNDA 2W21A 3U6UA 2BMUA 3S6GA 3D40A 4AB7A 2J5TA 2AP9A 2WE4A 2X2WA 3ZZFA 4AXSA 3QVHA 3C1NA 3D2MA 2JJXA 3L76A 2J4JA 3D41A 2JI5A 3EK5A 3QUOA 2BRXA 2BRIA 3ZZHA 1GS5A 3L86A 3K4YA 2R98A 4JZ8A 2BTYA
chains in the Genus database with same CATH topology
1YBDA 2A1FA 2CDQA 3EK6A 4NDQB 3WWMA 2BUFA 4NDOB 1E19A 3TVIA 3AAWA 2VA1A 2RD5A 4A7XA 3C1MA 2V5HA 3AB2A 4NDRA 2V4YA 3T7BA 4USJA 3ZZIA 2WE5A 3QURA 1OHAA 2WXBA 3C20A 3K52A 2BNFA 2IJ9A 3B8GA 1OH9A 4JZ9A 4I49A 4A7WA 3LL5A 3QVFA 3AB4A 4NDOA 2HMFA 4NDRB 1B7BA 3K4OA 4Q1TA 1GSJA 4JZ7A 3WWNA 2OGXB 3LKKA 3NWYA 2E9YA 2J4KA 3D2PA 4F6TA 4NDPB 4OLCA 3S6HA 2JJ4A 4KZTA 4NDPA 1Z9DA 3ZZGA 4F6TB 4NDQA 3S6KA 3KZFA 2J0WA 1OHBA 3LL9A 2R8VA 2J0XA 2BNEA 2AKOA 2J5VA 2OGXA 3K56A 3QUNA 2J4LA 2BNDA 2W21A 3U6UA 2BMUA 3S6GA 3D40A 4AB7A 2J5TA 2AP9A 2WE4A 2X2WA 3ZZFA 4AXSA 3QVHA 3C1NA 3D2MA 2JJXA 3L76A 2J4JA 3D41A 2JI5A 3EK5A 3QUOA 2BRXA 2BRIA 3ZZHA 1GS5A 3L86A 3K4YA 2R98A 4JZ8A 2BTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBD A;  2A1F A;  2CDQ A;  3EK6 A;  4NDQ B;  3WWM A;  2BUF A;  4NDO B;  1E19 A;  3TVI A;  3AAW A;  2VA1 A;  2RD5 A;  4A7X A;  3C1M A;  2V5H A;  3AB2 A;  4NDR A;  2V4Y A;  3T7B A;  4USJ A;  3ZZI A;  2WE5 A;  3QUR A;  1OHA A;  2WXB A;  3C20 A;  3K52 A;  2BNF A;  2IJ9 A;  3B8G A;  1OH9 A;  4JZ9 A;  4I49 A;  4A7W A;  3LL5 A;  3QVF A;  3AB4 A;  4NDO A;  2HMF A;  4NDR B;  1B7B A;  3K4O A;  4Q1T A;  1GSJ A;  4JZ7 A;  3WWN A;  2OGX B;  3LKK A;  3NWY A;  2E9Y A;  2J4K A;  3D2P A;  4F6T A;  4NDP B;  4OLC A;  3S6H A;  2JJ4 A;  4KZT A;  4NDP A;  1Z9D A;  3ZZG A;  4F6T B;  4NDQ A;  3S6K A;  3KZF A;  2J0W A;  1OHB A;  3LL9 A;  2R8V A;  2J0X A;  2BNE A;  2AKO A;  2J5V A;  2OGX A;  3K56 A;  3QUN A;  2J4L A;  2BND A;  2W21 A;  3U6U A;  2BMU A;  3S6G A;  3D40 A;  4AB7 A;  2J5T A;  2AP9 A;  2WE4 A;  2X2W A;  3ZZF A;  4AXS A;  3QVH A;  3C1N A;  3D2M A;  2JJX A;  3L76 A;  2J4J A;  3D41 A;  2JI5 A;  3EK5 A;  3QUO A;  2BRX A;  2BRI A;  3ZZH A;  1GS5 A;  3L86 A;  3K4Y A;  2R98 A;  4JZ8 A;  2BTY A; 
#chains in the Genus database with same CATH topology
 1YBD A;  2A1F A;  2CDQ A;  3EK6 A;  4NDQ B;  3WWM A;  2BUF A;  4NDO B;  1E19 A;  3TVI A;  3AAW A;  2VA1 A;  2RD5 A;  4A7X A;  3C1M A;  2V5H A;  3AB2 A;  4NDR A;  2V4Y A;  3T7B A;  4USJ A;  3ZZI A;  2WE5 A;  3QUR A;  1OHA A;  2WXB A;  3C20 A;  3K52 A;  2BNF A;  2IJ9 A;  3B8G A;  1OH9 A;  4JZ9 A;  4I49 A;  4A7W A;  3LL5 A;  3QVF A;  3AB4 A;  4NDO A;  2HMF A;  4NDR B;  1B7B A;  3K4O A;  4Q1T A;  1GSJ A;  4JZ7 A;  3WWN A;  2OGX B;  3LKK A;  3NWY A;  2E9Y A;  2J4K A;  3D2P A;  4F6T A;  4NDP B;  4OLC A;  3S6H A;  2JJ4 A;  4KZT A;  4NDP A;  1Z9D A;  3ZZG A;  4F6T B;  4NDQ A;  3S6K A;  3KZF A;  2J0W A;  1OHB A;  3LL9 A;  2R8V A;  2J0X A;  2BNE A;  2AKO A;  2J5V A;  2OGX A;  3K56 A;  3QUN A;  2J4L A;  2BND A;  2W21 A;  3U6U A;  2BMU A;  3S6G A;  3D40 A;  4AB7 A;  2J5T A;  2AP9 A;  2WE4 A;  2X2W A;  3ZZF A;  4AXS A;  3QVH A;  3C1N A;  3D2M A;  2JJX A;  3L76 A;  2J4J A;  3D41 A;  2JI5 A;  3EK5 A;  3QUO A;  2BRX A;  2BRI A;  3ZZH A;  1GS5 A;  3L86 A;  3K4Y A;  2R98 A;  4JZ8 A;  2BTY A; 
#chains in the Genus database with same CATH homology
 1YBD A;  2A1F A;  2CDQ A;  3EK6 A;  4NDQ B;  3WWM A;  2BUF A;  4NDO B;  1E19 A;  3TVI A;  3AAW A;  2VA1 A;  2RD5 A;  4A7X A;  3C1M A;  2V5H A;  3AB2 A;  4NDR A;  2V4Y A;  3T7B A;  4USJ A;  3ZZI A;  2WE5 A;  3QUR A;  1OHA A;  2WXB A;  3C20 A;  3K52 A;  2BNF A;  2IJ9 A;  3B8G A;  1OH9 A;  4JZ9 A;  4I49 A;  4A7W A;  3LL5 A;  3QVF A;  3AB4 A;  4NDO A;  2HMF A;  4NDR B;  1B7B A;  3K4O A;  4Q1T A;  1GSJ A;  4JZ7 A;  3WWN A;  2OGX B;  3LKK A;  3NWY A;  2E9Y A;  2J4K A;  3D2P A;  4F6T A;  4NDP B;  4OLC A;  3S6H A;  2JJ4 A;  4KZT A;  4NDP A;  1Z9D A;  3ZZG A;  4F6T B;  4NDQ A;  3S6K A;  3KZF A;  2J0W A;  1OHB A;  3LL9 A;  2R8V A;  2J0X A;  2BNE A;  2AKO A;  2J5V A;  2OGX A;  3K56 A;  3QUN A;  2J4L A;  2BND A;  2W21 A;  3U6U A;  2BMU A;  3S6G A;  3D40 A;  4AB7 A;  2J5T A;  2AP9 A;  2WE4 A;  2X2W A;  3ZZF A;  4AXS A;  3QVH A;  3C1N A;  3D2M A;  2JJX A;  3L76 A;  2J4J A;  3D41 A;  2JI5 A;  3EK5 A;  3QUO A;  2BRX A;  2BRI A;  3ZZH A;  1GS5 A;  3L86 A;  3K4Y A;  2R98 A;  4JZ8 A;  2BTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...