2V4YA

The structure of e. coli ump kinase in complex with its allosteric regulator gtp
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
237
structure length
237
Chain Sequence
b'AKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title Structural and Functional Characterization of Escherichia Coli Ump Kinase in Complex with its Allosteric Regulator GTP.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 79
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2v4yA00
3AB4A 3K4YA 3D2MA 1GS5A 2AKOA 3K56A 3QUOA 4AB7A 2J5TA 3C20A 3L76A 2R98A 3D41A 3S6KA 4JZ7A 3B8GA 4NDRA 2VA1A 1E19A 3S6GA 4A7WA 4F6TA 3L86A 1OHAA 4KZTA 4AXSA 2WE4A 2OGXA 2BUFA 2J5VA 2JJ4A 4NDQA 4NDRB 3NWYA 4Q1TA 2E9YA 2AP9A 1GSJA 4F6TB 4I49A 3QVHA 4JZ9A 2OGXB 2BTYA 2X2WA 3QURA 1OHBA 3TVIA 4NDQB 3LL9A 2IJ9A 3S6HA 3C1NA 3ZZIA 3C1MA 3EK5A 2V5HA 2JJXA 3ZZGA 2BNDA 2HMFA 3QUNA 2CDQA 3T7BA 3EK6A 2BRXA 2RD5A 4NDPA 4JZ8A 2BNEA 3ZZHA 3LL5A 3U6UA 1Z9DA 2BMUA 3AAWA 3WWMA 2J4LA 3WWNA 2V4YA 1B7BA 2J0XA 2J4JA 4NDPB 2BNFA 3LKKA 2JI5A 4NDOA 2J0WA 3QVFA 3D2PA 2A1FA 2R8VA 2BRIA 2WE5A 4A7XA 3K4OA 3K52A 1OH9A 2WXBA 3ZZFA 4NDOB 4OLCA 2W21A 1YBDA 2J4KA 3AB2A 3D40A 4USJA 3KZFA
chains in the Genus database with same CATH superfamily
3AB4A 3K4YA 3D2MA 1GS5A 2AKOA 3K56A 3QUOA 4AB7A 2J5TA 3C20A 3L76A 2R98A 3D41A 3S6KA 4JZ7A 3B8GA 4NDRA 2VA1A 1E19A 3S6GA 4A7WA 4F6TA 3L86A 1OHAA 4KZTA 4AXSA 2WE4A 2OGXA 2BUFA 2J5VA 2JJ4A 4NDQA 4NDRB 3NWYA 4Q1TA 2E9YA 2AP9A 1GSJA 4F6TB 4I49A 3QVHA 4JZ9A 2OGXB 2BTYA 2X2WA 3QURA 1OHBA 3TVIA 4NDQB 3LL9A 2IJ9A 3S6HA 3C1NA 3ZZIA 3C1MA 3EK5A 2V5HA 2JJXA 3ZZGA 2BNDA 2HMFA 3QUNA 2CDQA 3T7BA 3EK6A 2BRXA 2RD5A 4NDPA 4JZ8A 2BNEA 3ZZHA 3LL5A 3U6UA 1Z9DA 2BMUA 3AAWA 3WWMA 2J4LA 3WWNA 2V4YA 1B7BA 2J0XA 2J4JA 4NDPB 2BNFA 3LKKA 2JI5A 4NDOA 2J0WA 3QVFA 3D2PA 2A1FA 2R8VA 2BRIA 2WE5A 4A7XA 3K4OA 3K52A 1OH9A 2WXBA 3ZZFA 4NDOB 4OLCA 2W21A 1YBDA 2J4KA 3AB2A 3D40A 4USJA 3KZFA
chains in the Genus database with same CATH topology
3AB4A 3K4YA 3D2MA 1GS5A 2AKOA 3K56A 3QUOA 4AB7A 2J5TA 3C20A 3L76A 2R98A 3D41A 3S6KA 4JZ7A 3B8GA 4NDRA 2VA1A 1E19A 3S6GA 4A7WA 4F6TA 3L86A 1OHAA 4KZTA 4AXSA 2WE4A 2OGXA 2BUFA 2J5VA 2JJ4A 4NDQA 4NDRB 3NWYA 4Q1TA 2E9YA 2AP9A 1GSJA 4F6TB 4I49A 3QVHA 4JZ9A 2OGXB 2BTYA 2X2WA 3QURA 1OHBA 3TVIA 4NDQB 3LL9A 2IJ9A 3S6HA 3C1NA 3ZZIA 3C1MA 3EK5A 2V5HA 2JJXA 3ZZGA 2BNDA 2HMFA 3QUNA 2CDQA 3T7BA 3EK6A 2BRXA 2RD5A 4NDPA 4JZ8A 2BNEA 3ZZHA 3LL5A 3U6UA 1Z9DA 2BMUA 3AAWA 3WWMA 2J4LA 3WWNA 2V4YA 1B7BA 2J0XA 2J4JA 4NDPB 2BNFA 3LKKA 2JI5A 4NDOA 2J0WA 3QVFA 3D2PA 2A1FA 2R8VA 2BRIA 2WE5A 4A7XA 3K4OA 3K52A 1OH9A 2WXBA 3ZZFA 4NDOB 4OLCA 2W21A 1YBDA 2J4KA 3AB2A 3D40A 4USJA 3KZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB4 A;  3K4Y A;  3D2M A;  1GS5 A;  2AKO A;  3K56 A;  3QUO A;  4AB7 A;  2J5T A;  3C20 A;  3L76 A;  2R98 A;  3D41 A;  3S6K A;  4JZ7 A;  3B8G A;  4NDR A;  2VA1 A;  1E19 A;  3S6G A;  4A7W A;  4F6T A;  3L86 A;  1OHA A;  4KZT A;  4AXS A;  2WE4 A;  2OGX A;  2BUF A;  2J5V A;  2JJ4 A;  4NDQ A;  4NDR B;  3NWY A;  4Q1T A;  2E9Y A;  2AP9 A;  1GSJ A;  4F6T B;  4I49 A;  3QVH A;  4JZ9 A;  2OGX B;  2BTY A;  2X2W A;  3QUR A;  1OHB A;  3TVI A;  4NDQ B;  3LL9 A;  2IJ9 A;  3S6H A;  3C1N A;  3ZZI A;  3C1M A;  3EK5 A;  2V5H A;  2JJX A;  3ZZG A;  2BND A;  2HMF A;  3QUN A;  2CDQ A;  3T7B A;  3EK6 A;  2BRX A;  2RD5 A;  4NDP A;  4JZ8 A;  2BNE A;  3ZZH A;  3LL5 A;  3U6U A;  1Z9D A;  2BMU A;  3AAW A;  3WWM A;  2J4L A;  3WWN A;  2V4Y A;  1B7B A;  2J0X A;  2J4J A;  4NDP B;  2BNF A;  3LKK A;  2JI5 A;  4NDO A;  2J0W A;  3QVF A;  3D2P A;  2A1F A;  2R8V A;  2BRI A;  2WE5 A;  4A7X A;  3K4O A;  3K52 A;  1OH9 A;  2WXB A;  3ZZF A;  4NDO B;  4OLC A;  2W21 A;  1YBD A;  2J4K A;  3AB2 A;  3D40 A;  4USJ A;  3KZF A; 
#chains in the Genus database with same CATH topology
 3AB4 A;  3K4Y A;  3D2M A;  1GS5 A;  2AKO A;  3K56 A;  3QUO A;  4AB7 A;  2J5T A;  3C20 A;  3L76 A;  2R98 A;  3D41 A;  3S6K A;  4JZ7 A;  3B8G A;  4NDR A;  2VA1 A;  1E19 A;  3S6G A;  4A7W A;  4F6T A;  3L86 A;  1OHA A;  4KZT A;  4AXS A;  2WE4 A;  2OGX A;  2BUF A;  2J5V A;  2JJ4 A;  4NDQ A;  4NDR B;  3NWY A;  4Q1T A;  2E9Y A;  2AP9 A;  1GSJ A;  4F6T B;  4I49 A;  3QVH A;  4JZ9 A;  2OGX B;  2BTY A;  2X2W A;  3QUR A;  1OHB A;  3TVI A;  4NDQ B;  3LL9 A;  2IJ9 A;  3S6H A;  3C1N A;  3ZZI A;  3C1M A;  3EK5 A;  2V5H A;  2JJX A;  3ZZG A;  2BND A;  2HMF A;  3QUN A;  2CDQ A;  3T7B A;  3EK6 A;  2BRX A;  2RD5 A;  4NDP A;  4JZ8 A;  2BNE A;  3ZZH A;  3LL5 A;  3U6U A;  1Z9D A;  2BMU A;  3AAW A;  3WWM A;  2J4L A;  3WWN A;  2V4Y A;  1B7B A;  2J0X A;  2J4J A;  4NDP B;  2BNF A;  3LKK A;  2JI5 A;  4NDO A;  2J0W A;  3QVF A;  3D2P A;  2A1F A;  2R8V A;  2BRI A;  2WE5 A;  4A7X A;  3K4O A;  3K52 A;  1OH9 A;  2WXB A;  3ZZF A;  4NDO B;  4OLC A;  2W21 A;  1YBD A;  2J4K A;  3AB2 A;  3D40 A;  4USJ A;  3KZF A; 
#chains in the Genus database with same CATH homology
 3AB4 A;  3K4Y A;  3D2M A;  1GS5 A;  2AKO A;  3K56 A;  3QUO A;  4AB7 A;  2J5T A;  3C20 A;  3L76 A;  2R98 A;  3D41 A;  3S6K A;  4JZ7 A;  3B8G A;  4NDR A;  2VA1 A;  1E19 A;  3S6G A;  4A7W A;  4F6T A;  3L86 A;  1OHA A;  4KZT A;  4AXS A;  2WE4 A;  2OGX A;  2BUF A;  2J5V A;  2JJ4 A;  4NDQ A;  4NDR B;  3NWY A;  4Q1T A;  2E9Y A;  2AP9 A;  1GSJ A;  4F6T B;  4I49 A;  3QVH A;  4JZ9 A;  2OGX B;  2BTY A;  2X2W A;  3QUR A;  1OHB A;  3TVI A;  4NDQ B;  3LL9 A;  2IJ9 A;  3S6H A;  3C1N A;  3ZZI A;  3C1M A;  3EK5 A;  2V5H A;  2JJX A;  3ZZG A;  2BND A;  2HMF A;  3QUN A;  2CDQ A;  3T7B A;  3EK6 A;  2BRX A;  2RD5 A;  4NDP A;  4JZ8 A;  2BNE A;  3ZZH A;  3LL5 A;  3U6U A;  1Z9D A;  2BMU A;  3AAW A;  3WWM A;  2J4L A;  3WWN A;  2V4Y A;  1B7B A;  2J0X A;  2J4J A;  4NDP B;  2BNF A;  3LKK A;  2JI5 A;  4NDO A;  2J0W A;  3QVF A;  3D2P A;  2A1F A;  2R8V A;  2BRI A;  2WE5 A;  4A7X A;  3K4O A;  3K52 A;  1OH9 A;  2WXB A;  3ZZF A;  4NDO B;  4OLC A;  2W21 A;  1YBD A;  2J4K A;  3AB2 A;  3D40 A;  4USJ A;  3KZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...