4USJA

N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE, CHLOROPLASTIC
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 95
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4usjA00
1E19A 2BMUA 4NDOB 4NDRB 2OGXA 3AAWA 3L86A 2BUFA 3WWMA 2J4KA 4AXSA 3QVHA 2J0WA 3WWNA 2V5HA 2CDQA 4F6TB 4NDQA 2BNDA 2RD5A 4NDOA 4NDRA 1YBDA 2BNEA 2AKOA 3ZZIA 4F6TA 2A1FA 3L76A 3AB4A 2AP9A 2J4JA 3S6GA 2JJ4A 2JJXA 4I49A 3LL9A 1GSJA 2WE5A 3S6HA 3T7BA 3D2PA 3QUOA 3EK5A 3KZFA 3TVIA 3EK6A 3U6UA 4AB7A 3ZZHA 3LKKA 3C1NA 3C20A 3D41A 1B7BA 3QVFA 4A7XA 4OLCA 3K4OA 4JZ9A 4NDPA 2WXBA 2J5VA 4JZ7A 3S6KA 3B8GA 2BTYA 2R98A 3K4YA 1OHAA 3NWYA 1OHBA 3ZZFA 3K56A 4NDPB 3LL5A 2J5TA 3C1MA 3ZZGA 2J4LA 2X2WA 2V4YA 2BRIA 3D2MA 2BNFA 2VA1A 3D40A 2BRXA 2W21A 4USJA 3QUNA 4KZTA 4A7WA 1OH9A 1Z9DA 2E9YA 2IJ9A 2WE4A 1GS5A 2J0XA 2OGXB 2JI5A 3K52A 4JZ8A 2HMFA 3AB2A 4NDQB 3QURA 2R8VA 4Q1TA
chains in the Genus database with same CATH superfamily
1E19A 2BMUA 4NDOB 4NDRB 2OGXA 3AAWA 3L86A 2BUFA 3WWMA 2J4KA 4AXSA 3QVHA 2J0WA 3WWNA 2V5HA 2CDQA 4F6TB 4NDQA 2BNDA 2RD5A 4NDOA 4NDRA 1YBDA 2BNEA 2AKOA 3ZZIA 4F6TA 2A1FA 3L76A 3AB4A 2AP9A 2J4JA 3S6GA 2JJ4A 2JJXA 4I49A 3LL9A 1GSJA 2WE5A 3S6HA 3T7BA 3D2PA 3QUOA 3EK5A 3KZFA 3TVIA 3EK6A 3U6UA 4AB7A 3ZZHA 3LKKA 3C1NA 3C20A 3D41A 1B7BA 3QVFA 4A7XA 4OLCA 3K4OA 4JZ9A 4NDPA 2WXBA 2J5VA 4JZ7A 3S6KA 3B8GA 2BTYA 2R98A 3K4YA 1OHAA 3NWYA 1OHBA 3ZZFA 3K56A 4NDPB 3LL5A 2J5TA 3C1MA 3ZZGA 2J4LA 2X2WA 2V4YA 2BRIA 3D2MA 2BNFA 2VA1A 3D40A 2BRXA 2W21A 4USJA 3QUNA 4KZTA 4A7WA 1OH9A 1Z9DA 2E9YA 2IJ9A 2WE4A 1GS5A 2J0XA 2OGXB 2JI5A 3K52A 4JZ8A 2HMFA 3AB2A 4NDQB 3QURA 2R8VA 4Q1TA
chains in the Genus database with same CATH topology
1E19A 2BMUA 4NDOB 4NDRB 2OGXA 3AAWA 3L86A 2BUFA 3WWMA 2J4KA 4AXSA 3QVHA 2J0WA 3WWNA 2V5HA 2CDQA 4F6TB 4NDQA 2BNDA 2RD5A 4NDOA 4NDRA 1YBDA 2BNEA 2AKOA 3ZZIA 4F6TA 2A1FA 3L76A 3AB4A 2AP9A 2J4JA 3S6GA 2JJ4A 2JJXA 4I49A 3LL9A 1GSJA 2WE5A 3S6HA 3T7BA 3D2PA 3QUOA 3EK5A 3KZFA 3TVIA 3EK6A 3U6UA 4AB7A 3ZZHA 3LKKA 3C1NA 3C20A 3D41A 1B7BA 3QVFA 4A7XA 4OLCA 3K4OA 4JZ9A 4NDPA 2WXBA 2J5VA 4JZ7A 3S6KA 3B8GA 2BTYA 2R98A 3K4YA 1OHAA 3NWYA 1OHBA 3ZZFA 3K56A 4NDPB 3LL5A 2J5TA 3C1MA 3ZZGA 2J4LA 2X2WA 2V4YA 2BRIA 3D2MA 2BNFA 2VA1A 3D40A 2BRXA 2W21A 4USJA 3QUNA 4KZTA 4A7WA 1OH9A 1Z9DA 2E9YA 2IJ9A 2WE4A 1GS5A 2J0XA 2OGXB 2JI5A 3K52A 4JZ8A 2HMFA 3AB2A 4NDQB 3QURA 2R8VA 4Q1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E19 A;  2BMU A;  4NDO B;  4NDR B;  2OGX A;  3AAW A;  3L86 A;  2BUF A;  3WWM A;  2J4K A;  4AXS A;  3QVH A;  2J0W A;  3WWN A;  2V5H A;  2CDQ A;  4F6T B;  4NDQ A;  2BND A;  2RD5 A;  4NDO A;  4NDR A;  1YBD A;  2BNE A;  2AKO A;  3ZZI A;  4F6T A;  2A1F A;  3L76 A;  3AB4 A;  2AP9 A;  2J4J A;  3S6G A;  2JJ4 A;  2JJX A;  4I49 A;  3LL9 A;  1GSJ A;  2WE5 A;  3S6H A;  3T7B A;  3D2P A;  3QUO A;  3EK5 A;  3KZF A;  3TVI A;  3EK6 A;  3U6U A;  4AB7 A;  3ZZH A;  3LKK A;  3C1N A;  3C20 A;  3D41 A;  1B7B A;  3QVF A;  4A7X A;  4OLC A;  3K4O A;  4JZ9 A;  4NDP A;  2WXB A;  2J5V A;  4JZ7 A;  3S6K A;  3B8G A;  2BTY A;  2R98 A;  3K4Y A;  1OHA A;  3NWY A;  1OHB A;  3ZZF A;  3K56 A;  4NDP B;  3LL5 A;  2J5T A;  3C1M A;  3ZZG A;  2J4L A;  2X2W A;  2V4Y A;  2BRI A;  3D2M A;  2BNF A;  2VA1 A;  3D40 A;  2BRX A;  2W21 A;  4USJ A;  3QUN A;  4KZT A;  4A7W A;  1OH9 A;  1Z9D A;  2E9Y A;  2IJ9 A;  2WE4 A;  1GS5 A;  2J0X A;  2OGX B;  2JI5 A;  3K52 A;  4JZ8 A;  2HMF A;  3AB2 A;  4NDQ B;  3QUR A;  2R8V A;  4Q1T A; 
#chains in the Genus database with same CATH topology
 1E19 A;  2BMU A;  4NDO B;  4NDR B;  2OGX A;  3AAW A;  3L86 A;  2BUF A;  3WWM A;  2J4K A;  4AXS A;  3QVH A;  2J0W A;  3WWN A;  2V5H A;  2CDQ A;  4F6T B;  4NDQ A;  2BND A;  2RD5 A;  4NDO A;  4NDR A;  1YBD A;  2BNE A;  2AKO A;  3ZZI A;  4F6T A;  2A1F A;  3L76 A;  3AB4 A;  2AP9 A;  2J4J A;  3S6G A;  2JJ4 A;  2JJX A;  4I49 A;  3LL9 A;  1GSJ A;  2WE5 A;  3S6H A;  3T7B A;  3D2P A;  3QUO A;  3EK5 A;  3KZF A;  3TVI A;  3EK6 A;  3U6U A;  4AB7 A;  3ZZH A;  3LKK A;  3C1N A;  3C20 A;  3D41 A;  1B7B A;  3QVF A;  4A7X A;  4OLC A;  3K4O A;  4JZ9 A;  4NDP A;  2WXB A;  2J5V A;  4JZ7 A;  3S6K A;  3B8G A;  2BTY A;  2R98 A;  3K4Y A;  1OHA A;  3NWY A;  1OHB A;  3ZZF A;  3K56 A;  4NDP B;  3LL5 A;  2J5T A;  3C1M A;  3ZZG A;  2J4L A;  2X2W A;  2V4Y A;  2BRI A;  3D2M A;  2BNF A;  2VA1 A;  3D40 A;  2BRX A;  2W21 A;  4USJ A;  3QUN A;  4KZT A;  4A7W A;  1OH9 A;  1Z9D A;  2E9Y A;  2IJ9 A;  2WE4 A;  1GS5 A;  2J0X A;  2OGX B;  2JI5 A;  3K52 A;  4JZ8 A;  2HMF A;  3AB2 A;  4NDQ B;  3QUR A;  2R8V A;  4Q1T A; 
#chains in the Genus database with same CATH homology
 1E19 A;  2BMU A;  4NDO B;  4NDR B;  2OGX A;  3AAW A;  3L86 A;  2BUF A;  3WWM A;  2J4K A;  4AXS A;  3QVH A;  2J0W A;  3WWN A;  2V5H A;  2CDQ A;  4F6T B;  4NDQ A;  2BND A;  2RD5 A;  4NDO A;  4NDR A;  1YBD A;  2BNE A;  2AKO A;  3ZZI A;  4F6T A;  2A1F A;  3L76 A;  3AB4 A;  2AP9 A;  2J4J A;  3S6G A;  2JJ4 A;  2JJX A;  4I49 A;  3LL9 A;  1GSJ A;  2WE5 A;  3S6H A;  3T7B A;  3D2P A;  3QUO A;  3EK5 A;  3KZF A;  3TVI A;  3EK6 A;  3U6U A;  4AB7 A;  3ZZH A;  3LKK A;  3C1N A;  3C20 A;  3D41 A;  1B7B A;  3QVF A;  4A7X A;  4OLC A;  3K4O A;  4JZ9 A;  4NDP A;  2WXB A;  2J5V A;  4JZ7 A;  3S6K A;  3B8G A;  2BTY A;  2R98 A;  3K4Y A;  1OHA A;  3NWY A;  1OHB A;  3ZZF A;  3K56 A;  4NDP B;  3LL5 A;  2J5T A;  3C1M A;  3ZZG A;  2J4L A;  2X2W A;  2V4Y A;  2BRI A;  3D2M A;  2BNF A;  2VA1 A;  3D40 A;  2BRX A;  2W21 A;  4USJ A;  3QUN A;  4KZT A;  4A7W A;  1OH9 A;  1Z9D A;  2E9Y A;  2IJ9 A;  2WE4 A;  1GS5 A;  2J0X A;  2OGX B;  2JI5 A;  3K52 A;  4JZ8 A;  2HMF A;  3AB2 A;  4NDQ B;  3QUR A;  2R8V A;  4Q1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...