4USJA

N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
b'DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE, CHLOROPLASTIC
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 95
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4usjA00
3QVHA 3KZFA 1OH9A 2JI5A 2BRXA 2BTYA 2HMFA 4NDPB 2JJ4A 2V4YA 3C1MA 2AP9A 3K4OA 2J4LA 4NDPA 3D40A 2WXBA 4AB7A 3NWYA 1Z9DA 1GS5A 2J5TA 2V5HA 2J4KA 3C20A 3QURA 2WE4A 4NDRB 3ZZHA 4A7XA 2AKOA 3EK5A 3S6KA 3AB2A 2WE5A 4KZTA 4NDRA 4I49A 3C1NA 3ZZFA 3U6UA 3B8GA 3AB4A 3L76A 2J0XA 2J4JA 4JZ7A 4NDOB 4JZ9A 1E19A 2R8VA 3WWNA 1YBDA 3ZZIA 2CDQA 4Q1TA 1OHAA 3K4YA 2J0WA 3L86A 3LKKA 3WWMA 2OGXB 3K56A 3D2PA 2RD5A 2A1FA 3ZZGA 3QUOA 3D2MA 4F6TB 3LL5A 4OLCA 3K52A 1GSJA 3T7BA 4USJA 4A7WA 4F6TA 3QVFA 2BNEA 2J5VA 2BRIA 2BNFA 4NDQB 2BUFA 4NDOA 4JZ8A 2BNDA 2IJ9A 2JJXA 3EK6A 3TVIA 4AXSA 4NDQA 2VA1A 3D41A 1B7BA 2BMUA 1OHBA 2OGXA 2X2WA 3QUNA 3S6HA 2R98A 2E9YA 3LL9A 2W21A 3S6GA 3AAWA
chains in the Genus database with same CATH superfamily
3QVHA 3KZFA 1OH9A 2JI5A 2BRXA 2BTYA 2HMFA 4NDPB 2JJ4A 2V4YA 3C1MA 2AP9A 3K4OA 2J4LA 4NDPA 3D40A 2WXBA 4AB7A 3NWYA 1Z9DA 1GS5A 2J5TA 2V5HA 2J4KA 3C20A 3QURA 2WE4A 4NDRB 3ZZHA 4A7XA 2AKOA 3EK5A 3S6KA 3AB2A 2WE5A 4KZTA 4NDRA 4I49A 3C1NA 3ZZFA 3U6UA 3B8GA 3AB4A 3L76A 2J0XA 2J4JA 4JZ7A 4NDOB 4JZ9A 1E19A 2R8VA 3WWNA 1YBDA 3ZZIA 2CDQA 4Q1TA 1OHAA 3K4YA 2J0WA 3L86A 3LKKA 3WWMA 2OGXB 3K56A 3D2PA 2RD5A 2A1FA 3ZZGA 3QUOA 3D2MA 4F6TB 3LL5A 4OLCA 3K52A 1GSJA 3T7BA 4USJA 4A7WA 4F6TA 3QVFA 2BNEA 2J5VA 2BRIA 2BNFA 4NDQB 2BUFA 4NDOA 4JZ8A 2BNDA 2IJ9A 2JJXA 3EK6A 3TVIA 4AXSA 4NDQA 2VA1A 3D41A 1B7BA 2BMUA 1OHBA 2OGXA 2X2WA 3QUNA 3S6HA 2R98A 2E9YA 3LL9A 2W21A 3S6GA 3AAWA
chains in the Genus database with same CATH topology
3QVHA 3KZFA 1OH9A 2JI5A 2BRXA 2BTYA 2HMFA 4NDPB 2JJ4A 2V4YA 3C1MA 2AP9A 3K4OA 2J4LA 4NDPA 3D40A 2WXBA 4AB7A 3NWYA 1Z9DA 1GS5A 2J5TA 2V5HA 2J4KA 3C20A 3QURA 2WE4A 4NDRB 3ZZHA 4A7XA 2AKOA 3EK5A 3S6KA 3AB2A 2WE5A 4KZTA 4NDRA 4I49A 3C1NA 3ZZFA 3U6UA 3B8GA 3AB4A 3L76A 2J0XA 2J4JA 4JZ7A 4NDOB 4JZ9A 1E19A 2R8VA 3WWNA 1YBDA 3ZZIA 2CDQA 4Q1TA 1OHAA 3K4YA 2J0WA 3L86A 3LKKA 3WWMA 2OGXB 3K56A 3D2PA 2RD5A 2A1FA 3ZZGA 3QUOA 3D2MA 4F6TB 3LL5A 4OLCA 3K52A 1GSJA 3T7BA 4USJA 4A7WA 4F6TA 3QVFA 2BNEA 2J5VA 2BRIA 2BNFA 4NDQB 2BUFA 4NDOA 4JZ8A 2BNDA 2IJ9A 2JJXA 3EK6A 3TVIA 4AXSA 4NDQA 2VA1A 3D41A 1B7BA 2BMUA 1OHBA 2OGXA 2X2WA 3QUNA 3S6HA 2R98A 2E9YA 3LL9A 2W21A 3S6GA 3AAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVH A;  3KZF A;  1OH9 A;  2JI5 A;  2BRX A;  2BTY A;  2HMF A;  4NDP B;  2JJ4 A;  2V4Y A;  3C1M A;  2AP9 A;  3K4O A;  2J4L A;  4NDP A;  3D40 A;  2WXB A;  4AB7 A;  3NWY A;  1Z9D A;  1GS5 A;  2J5T A;  2V5H A;  2J4K A;  3C20 A;  3QUR A;  2WE4 A;  4NDR B;  3ZZH A;  4A7X A;  2AKO A;  3EK5 A;  3S6K A;  3AB2 A;  2WE5 A;  4KZT A;  4NDR A;  4I49 A;  3C1N A;  3ZZF A;  3U6U A;  3B8G A;  3AB4 A;  3L76 A;  2J0X A;  2J4J A;  4JZ7 A;  4NDO B;  4JZ9 A;  1E19 A;  2R8V A;  3WWN A;  1YBD A;  3ZZI A;  2CDQ A;  4Q1T A;  1OHA A;  3K4Y A;  2J0W A;  3L86 A;  3LKK A;  3WWM A;  2OGX B;  3K56 A;  3D2P A;  2RD5 A;  2A1F A;  3ZZG A;  3QUO A;  3D2M A;  4F6T B;  3LL5 A;  4OLC A;  3K52 A;  1GSJ A;  3T7B A;  4USJ A;  4A7W A;  4F6T A;  3QVF A;  2BNE A;  2J5V A;  2BRI A;  2BNF A;  4NDQ B;  2BUF A;  4NDO A;  4JZ8 A;  2BND A;  2IJ9 A;  2JJX A;  3EK6 A;  3TVI A;  4AXS A;  4NDQ A;  2VA1 A;  3D41 A;  1B7B A;  2BMU A;  1OHB A;  2OGX A;  2X2W A;  3QUN A;  3S6H A;  2R98 A;  2E9Y A;  3LL9 A;  2W21 A;  3S6G A;  3AAW A; 
#chains in the Genus database with same CATH topology
 3QVH A;  3KZF A;  1OH9 A;  2JI5 A;  2BRX A;  2BTY A;  2HMF A;  4NDP B;  2JJ4 A;  2V4Y A;  3C1M A;  2AP9 A;  3K4O A;  2J4L A;  4NDP A;  3D40 A;  2WXB A;  4AB7 A;  3NWY A;  1Z9D A;  1GS5 A;  2J5T A;  2V5H A;  2J4K A;  3C20 A;  3QUR A;  2WE4 A;  4NDR B;  3ZZH A;  4A7X A;  2AKO A;  3EK5 A;  3S6K A;  3AB2 A;  2WE5 A;  4KZT A;  4NDR A;  4I49 A;  3C1N A;  3ZZF A;  3U6U A;  3B8G A;  3AB4 A;  3L76 A;  2J0X A;  2J4J A;  4JZ7 A;  4NDO B;  4JZ9 A;  1E19 A;  2R8V A;  3WWN A;  1YBD A;  3ZZI A;  2CDQ A;  4Q1T A;  1OHA A;  3K4Y A;  2J0W A;  3L86 A;  3LKK A;  3WWM A;  2OGX B;  3K56 A;  3D2P A;  2RD5 A;  2A1F A;  3ZZG A;  3QUO A;  3D2M A;  4F6T B;  3LL5 A;  4OLC A;  3K52 A;  1GSJ A;  3T7B A;  4USJ A;  4A7W A;  4F6T A;  3QVF A;  2BNE A;  2J5V A;  2BRI A;  2BNF A;  4NDQ B;  2BUF A;  4NDO A;  4JZ8 A;  2BND A;  2IJ9 A;  2JJX A;  3EK6 A;  3TVI A;  4AXS A;  4NDQ A;  2VA1 A;  3D41 A;  1B7B A;  2BMU A;  1OHB A;  2OGX A;  2X2W A;  3QUN A;  3S6H A;  2R98 A;  2E9Y A;  3LL9 A;  2W21 A;  3S6G A;  3AAW A; 
#chains in the Genus database with same CATH homology
 3QVH A;  3KZF A;  1OH9 A;  2JI5 A;  2BRX A;  2BTY A;  2HMF A;  4NDP B;  2JJ4 A;  2V4Y A;  3C1M A;  2AP9 A;  3K4O A;  2J4L A;  4NDP A;  3D40 A;  2WXB A;  4AB7 A;  3NWY A;  1Z9D A;  1GS5 A;  2J5T A;  2V5H A;  2J4K A;  3C20 A;  3QUR A;  2WE4 A;  4NDR B;  3ZZH A;  4A7X A;  2AKO A;  3EK5 A;  3S6K A;  3AB2 A;  2WE5 A;  4KZT A;  4NDR A;  4I49 A;  3C1N A;  3ZZF A;  3U6U A;  3B8G A;  3AB4 A;  3L76 A;  2J0X A;  2J4J A;  4JZ7 A;  4NDO B;  4JZ9 A;  1E19 A;  2R8V A;  3WWN A;  1YBD A;  3ZZI A;  2CDQ A;  4Q1T A;  1OHA A;  3K4Y A;  2J0W A;  3L86 A;  3LKK A;  3WWM A;  2OGX B;  3K56 A;  3D2P A;  2RD5 A;  2A1F A;  3ZZG A;  3QUO A;  3D2M A;  4F6T B;  3LL5 A;  4OLC A;  3K52 A;  1GSJ A;  3T7B A;  4USJ A;  4A7W A;  4F6T A;  3QVF A;  2BNE A;  2J5V A;  2BRI A;  2BNF A;  4NDQ B;  2BUF A;  4NDO A;  4JZ8 A;  2BND A;  2IJ9 A;  2JJX A;  3EK6 A;  3TVI A;  4AXS A;  4NDQ A;  2VA1 A;  3D41 A;  1B7B A;  2BMU A;  1OHB A;  2OGX A;  2X2W A;  3QUN A;  3S6H A;  2R98 A;  2E9Y A;  3LL9 A;  2W21 A;  3S6G A;  3AAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...