4USJA

N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords ACETYLGLUTAMATE KINASE, CHLOROPLASTIC
total genus 95
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4usjA00
3ZZGA 3U6UA 1E19A 2JI5A 3K4OA 2BNFA 1Z9DA 3ZZFA 3S6KA 1OH9A 2OGXB 2WE5A 4F6TB 2JJ4A 2V4YA 3C1MA 3AB4A 3K56A 2W21A 2IJ9A 2OGXA 3L86A 4USJA 2V5HA 3EK5A 4NDQB 2BNEA 4NDRA 2RD5A 3S6HA 3QUOA 3ZZIA 1OHBA 3QVHA 4JZ8A 2J4KA 4I49A 3D40A 2JJXA 1B7BA 2X2WA 2WXBA 2R98A 4NDPB 4JZ7A 4A7WA 3QUNA 3C20A 2BRXA 3K52A 4NDPA 2J0WA 2VA1A 2BTYA 3WWMA 4OLCA 2BRIA 1OHAA 3LL5A 3K4YA 2BUFA 2E9YA 3NWYA 1GS5A 3EK6A 1GSJA 3LL9A 3C1NA 3ZZHA 3D41A 4Q1TA 3WWNA 3AAWA 3AB2A 2J0XA 1YBDA 4NDOB 4AXSA 2A1FA 4NDRB 3QVFA 2CDQA 3L76A 3QURA 2J5VA 2AKOA 4JZ9A 3KZFA 4KZTA 3LKKA 4NDOA 2BMUA 3B8GA 2J5TA 2BNDA 2J4LA 2J4JA 4NDQA 3T7BA 2HMFA 4F6TA 2AP9A 3TVIA 4AB7A 3D2PA 3S6GA 2R8VA 4A7XA 3D2MA 2WE4A
chains in the Genus database with same CATH superfamily
3ZZGA 3U6UA 1E19A 2JI5A 3K4OA 2BNFA 1Z9DA 3ZZFA 3S6KA 1OH9A 2OGXB 2WE5A 4F6TB 2JJ4A 2V4YA 3C1MA 3AB4A 3K56A 2W21A 2IJ9A 2OGXA 3L86A 4USJA 2V5HA 3EK5A 4NDQB 2BNEA 4NDRA 2RD5A 3S6HA 3QUOA 3ZZIA 1OHBA 3QVHA 4JZ8A 2J4KA 4I49A 3D40A 2JJXA 1B7BA 2X2WA 2WXBA 2R98A 4NDPB 4JZ7A 4A7WA 3QUNA 3C20A 2BRXA 3K52A 4NDPA 2J0WA 2VA1A 2BTYA 3WWMA 4OLCA 2BRIA 1OHAA 3LL5A 3K4YA 2BUFA 2E9YA 3NWYA 1GS5A 3EK6A 1GSJA 3LL9A 3C1NA 3ZZHA 3D41A 4Q1TA 3WWNA 3AAWA 3AB2A 2J0XA 1YBDA 4NDOB 4AXSA 2A1FA 4NDRB 3QVFA 2CDQA 3L76A 3QURA 2J5VA 2AKOA 4JZ9A 3KZFA 4KZTA 3LKKA 4NDOA 2BMUA 3B8GA 2J5TA 2BNDA 2J4LA 2J4JA 4NDQA 3T7BA 2HMFA 4F6TA 2AP9A 3TVIA 4AB7A 3D2PA 3S6GA 2R8VA 4A7XA 3D2MA 2WE4A
chains in the Genus database with same CATH topology
3ZZGA 3U6UA 1E19A 2JI5A 3K4OA 2BNFA 1Z9DA 3ZZFA 3S6KA 1OH9A 2OGXB 2WE5A 4F6TB 2JJ4A 2V4YA 3C1MA 3AB4A 3K56A 2W21A 2IJ9A 2OGXA 3L86A 4USJA 2V5HA 3EK5A 4NDQB 2BNEA 4NDRA 2RD5A 3S6HA 3QUOA 3ZZIA 1OHBA 3QVHA 4JZ8A 2J4KA 4I49A 3D40A 2JJXA 1B7BA 2X2WA 2WXBA 2R98A 4NDPB 4JZ7A 4A7WA 3QUNA 3C20A 2BRXA 3K52A 4NDPA 2J0WA 2VA1A 2BTYA 3WWMA 4OLCA 2BRIA 1OHAA 3LL5A 3K4YA 2BUFA 2E9YA 3NWYA 1GS5A 3EK6A 1GSJA 3LL9A 3C1NA 3ZZHA 3D41A 4Q1TA 3WWNA 3AAWA 3AB2A 2J0XA 1YBDA 4NDOB 4AXSA 2A1FA 4NDRB 3QVFA 2CDQA 3L76A 3QURA 2J5VA 2AKOA 4JZ9A 3KZFA 4KZTA 3LKKA 4NDOA 2BMUA 3B8GA 2J5TA 2BNDA 2J4LA 2J4JA 4NDQA 3T7BA 2HMFA 4F6TA 2AP9A 3TVIA 4AB7A 3D2PA 3S6GA 2R8VA 4A7XA 3D2MA 2WE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZG A;  3U6U A;  1E19 A;  2JI5 A;  3K4O A;  2BNF A;  1Z9D A;  3ZZF A;  3S6K A;  1OH9 A;  2OGX B;  2WE5 A;  4F6T B;  2JJ4 A;  2V4Y A;  3C1M A;  3AB4 A;  3K56 A;  2W21 A;  2IJ9 A;  2OGX A;  3L86 A;  4USJ A;  2V5H A;  3EK5 A;  4NDQ B;  2BNE A;  4NDR A;  2RD5 A;  3S6H A;  3QUO A;  3ZZI A;  1OHB A;  3QVH A;  4JZ8 A;  2J4K A;  4I49 A;  3D40 A;  2JJX A;  1B7B A;  2X2W A;  2WXB A;  2R98 A;  4NDP B;  4JZ7 A;  4A7W A;  3QUN A;  3C20 A;  2BRX A;  3K52 A;  4NDP A;  2J0W A;  2VA1 A;  2BTY A;  3WWM A;  4OLC A;  2BRI A;  1OHA A;  3LL5 A;  3K4Y A;  2BUF A;  2E9Y A;  3NWY A;  1GS5 A;  3EK6 A;  1GSJ A;  3LL9 A;  3C1N A;  3ZZH A;  3D41 A;  4Q1T A;  3WWN A;  3AAW A;  3AB2 A;  2J0X A;  1YBD A;  4NDO B;  4AXS A;  2A1F A;  4NDR B;  3QVF A;  2CDQ A;  3L76 A;  3QUR A;  2J5V A;  2AKO A;  4JZ9 A;  3KZF A;  4KZT A;  3LKK A;  4NDO A;  2BMU A;  3B8G A;  2J5T A;  2BND A;  2J4L A;  2J4J A;  4NDQ A;  3T7B A;  2HMF A;  4F6T A;  2AP9 A;  3TVI A;  4AB7 A;  3D2P A;  3S6G A;  2R8V A;  4A7X A;  3D2M A;  2WE4 A; 
#chains in the Genus database with same CATH topology
 3ZZG A;  3U6U A;  1E19 A;  2JI5 A;  3K4O A;  2BNF A;  1Z9D A;  3ZZF A;  3S6K A;  1OH9 A;  2OGX B;  2WE5 A;  4F6T B;  2JJ4 A;  2V4Y A;  3C1M A;  3AB4 A;  3K56 A;  2W21 A;  2IJ9 A;  2OGX A;  3L86 A;  4USJ A;  2V5H A;  3EK5 A;  4NDQ B;  2BNE A;  4NDR A;  2RD5 A;  3S6H A;  3QUO A;  3ZZI A;  1OHB A;  3QVH A;  4JZ8 A;  2J4K A;  4I49 A;  3D40 A;  2JJX A;  1B7B A;  2X2W A;  2WXB A;  2R98 A;  4NDP B;  4JZ7 A;  4A7W A;  3QUN A;  3C20 A;  2BRX A;  3K52 A;  4NDP A;  2J0W A;  2VA1 A;  2BTY A;  3WWM A;  4OLC A;  2BRI A;  1OHA A;  3LL5 A;  3K4Y A;  2BUF A;  2E9Y A;  3NWY A;  1GS5 A;  3EK6 A;  1GSJ A;  3LL9 A;  3C1N A;  3ZZH A;  3D41 A;  4Q1T A;  3WWN A;  3AAW A;  3AB2 A;  2J0X A;  1YBD A;  4NDO B;  4AXS A;  2A1F A;  4NDR B;  3QVF A;  2CDQ A;  3L76 A;  3QUR A;  2J5V A;  2AKO A;  4JZ9 A;  3KZF A;  4KZT A;  3LKK A;  4NDO A;  2BMU A;  3B8G A;  2J5T A;  2BND A;  2J4L A;  2J4J A;  4NDQ A;  3T7B A;  2HMF A;  4F6T A;  2AP9 A;  3TVI A;  4AB7 A;  3D2P A;  3S6G A;  2R8V A;  4A7X A;  3D2M A;  2WE4 A; 
#chains in the Genus database with same CATH homology
 3ZZG A;  3U6U A;  1E19 A;  2JI5 A;  3K4O A;  2BNF A;  1Z9D A;  3ZZF A;  3S6K A;  1OH9 A;  2OGX B;  2WE5 A;  4F6T B;  2JJ4 A;  2V4Y A;  3C1M A;  3AB4 A;  3K56 A;  2W21 A;  2IJ9 A;  2OGX A;  3L86 A;  4USJ A;  2V5H A;  3EK5 A;  4NDQ B;  2BNE A;  4NDR A;  2RD5 A;  3S6H A;  3QUO A;  3ZZI A;  1OHB A;  3QVH A;  4JZ8 A;  2J4K A;  4I49 A;  3D40 A;  2JJX A;  1B7B A;  2X2W A;  2WXB A;  2R98 A;  4NDP B;  4JZ7 A;  4A7W A;  3QUN A;  3C20 A;  2BRX A;  3K52 A;  4NDP A;  2J0W A;  2VA1 A;  2BTY A;  3WWM A;  4OLC A;  2BRI A;  1OHA A;  3LL5 A;  3K4Y A;  2BUF A;  2E9Y A;  3NWY A;  1GS5 A;  3EK6 A;  1GSJ A;  3LL9 A;  3C1N A;  3ZZH A;  3D41 A;  4Q1T A;  3WWN A;  3AAW A;  3AB2 A;  2J0X A;  1YBD A;  4NDO B;  4AXS A;  2A1F A;  4NDR B;  3QVF A;  2CDQ A;  3L76 A;  3QUR A;  2J5V A;  2AKO A;  4JZ9 A;  3KZF A;  4KZT A;  3LKK A;  4NDO A;  2BMU A;  3B8G A;  2J5T A;  2BND A;  2J4L A;  2J4J A;  4NDQ A;  3T7B A;  2HMF A;  4F6T A;  2AP9 A;  3TVI A;  4AB7 A;  3D2P A;  3S6G A;  2R8V A;  4A7X A;  3D2M A;  2WE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...