4USJA

N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLGLUTAMATE KINASE, CHLOROPLASTIC
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 95
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4usjA00
2J4KA 2JJ4A 2BNFA 3EK6A 3NWYA 4JZ9A 2HMFA 3S6GA 4AXSA 2OGXA 3D40A 2RD5A 3AAWA 2AKOA 2WE4A 4NDPB 3AB4A 2A1FA 3AB2A 4KZTA 1B7BA 2BRXA 1OH9A 3WWMA 3EK5A 2WE5A 4NDQA 2J0WA 3QURA 4NDRB 4NDOB 4A7XA 3S6KA 4F6TA 3U6UA 1GSJA 3C1MA 3K4YA 3LKKA 2E9YA 3LL9A 3QVFA 3KZFA 1E19A 3QUOA 4AB7A 2X2WA 3TVIA 4JZ8A 3L76A 2JI5A 2BRIA 2IJ9A 3L86A 2R98A 1OHBA 3ZZGA 2V4YA 3K52A 2CDQA 4OLCA 3ZZHA 2VA1A 3D2MA 2OGXB 2J5VA 4I49A 1OHAA 3K56A 3K4OA 2BMUA 3D41A 3LL5A 3QUNA 4NDPA 4NDQB 2W21A 4A7WA 1GS5A 4F6TB 3ZZIA 3WWNA 4USJA 2BNDA 3C20A 4Q1TA 3C1NA 4NDRA 1YBDA 4NDOA 2AP9A 2J4LA 4JZ7A 2J5TA 3ZZFA 2JJXA 3D2PA 2J0XA 2V5HA 2BUFA 2J4JA 1Z9DA 2BNEA 2WXBA 2R8VA 3S6HA 2BTYA 3T7BA 3B8GA 3QVHA
chains in the Genus database with same CATH superfamily
2J4KA 2JJ4A 2BNFA 3EK6A 3NWYA 4JZ9A 2HMFA 3S6GA 4AXSA 2OGXA 3D40A 2RD5A 3AAWA 2AKOA 2WE4A 4NDPB 3AB4A 2A1FA 3AB2A 4KZTA 1B7BA 2BRXA 1OH9A 3WWMA 3EK5A 2WE5A 4NDQA 2J0WA 3QURA 4NDRB 4NDOB 4A7XA 3S6KA 4F6TA 3U6UA 1GSJA 3C1MA 3K4YA 3LKKA 2E9YA 3LL9A 3QVFA 3KZFA 1E19A 3QUOA 4AB7A 2X2WA 3TVIA 4JZ8A 3L76A 2JI5A 2BRIA 2IJ9A 3L86A 2R98A 1OHBA 3ZZGA 2V4YA 3K52A 2CDQA 4OLCA 3ZZHA 2VA1A 3D2MA 2OGXB 2J5VA 4I49A 1OHAA 3K56A 3K4OA 2BMUA 3D41A 3LL5A 3QUNA 4NDPA 4NDQB 2W21A 4A7WA 1GS5A 4F6TB 3ZZIA 3WWNA 4USJA 2BNDA 3C20A 4Q1TA 3C1NA 4NDRA 1YBDA 4NDOA 2AP9A 2J4LA 4JZ7A 2J5TA 3ZZFA 2JJXA 3D2PA 2J0XA 2V5HA 2BUFA 2J4JA 1Z9DA 2BNEA 2WXBA 2R8VA 3S6HA 2BTYA 3T7BA 3B8GA 3QVHA
chains in the Genus database with same CATH topology
2J4KA 2JJ4A 2BNFA 3EK6A 3NWYA 4JZ9A 2HMFA 3S6GA 4AXSA 2OGXA 3D40A 2RD5A 3AAWA 2AKOA 2WE4A 4NDPB 3AB4A 2A1FA 3AB2A 4KZTA 1B7BA 2BRXA 1OH9A 3WWMA 3EK5A 2WE5A 4NDQA 2J0WA 3QURA 4NDRB 4NDOB 4A7XA 3S6KA 4F6TA 3U6UA 1GSJA 3C1MA 3K4YA 3LKKA 2E9YA 3LL9A 3QVFA 3KZFA 1E19A 3QUOA 4AB7A 2X2WA 3TVIA 4JZ8A 3L76A 2JI5A 2BRIA 2IJ9A 3L86A 2R98A 1OHBA 3ZZGA 2V4YA 3K52A 2CDQA 4OLCA 3ZZHA 2VA1A 3D2MA 2OGXB 2J5VA 4I49A 1OHAA 3K56A 3K4OA 2BMUA 3D41A 3LL5A 3QUNA 4NDPA 4NDQB 2W21A 4A7WA 1GS5A 4F6TB 3ZZIA 3WWNA 4USJA 2BNDA 3C20A 4Q1TA 3C1NA 4NDRA 1YBDA 4NDOA 2AP9A 2J4LA 4JZ7A 2J5TA 3ZZFA 2JJXA 3D2PA 2J0XA 2V5HA 2BUFA 2J4JA 1Z9DA 2BNEA 2WXBA 2R8VA 3S6HA 2BTYA 3T7BA 3B8GA 3QVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4K A;  2JJ4 A;  2BNF A;  3EK6 A;  3NWY A;  4JZ9 A;  2HMF A;  3S6G A;  4AXS A;  2OGX A;  3D40 A;  2RD5 A;  3AAW A;  2AKO A;  2WE4 A;  4NDP B;  3AB4 A;  2A1F A;  3AB2 A;  4KZT A;  1B7B A;  2BRX A;  1OH9 A;  3WWM A;  3EK5 A;  2WE5 A;  4NDQ A;  2J0W A;  3QUR A;  4NDR B;  4NDO B;  4A7X A;  3S6K A;  4F6T A;  3U6U A;  1GSJ A;  3C1M A;  3K4Y A;  3LKK A;  2E9Y A;  3LL9 A;  3QVF A;  3KZF A;  1E19 A;  3QUO A;  4AB7 A;  2X2W A;  3TVI A;  4JZ8 A;  3L76 A;  2JI5 A;  2BRI A;  2IJ9 A;  3L86 A;  2R98 A;  1OHB A;  3ZZG A;  2V4Y A;  3K52 A;  2CDQ A;  4OLC A;  3ZZH A;  2VA1 A;  3D2M A;  2OGX B;  2J5V A;  4I49 A;  1OHA A;  3K56 A;  3K4O A;  2BMU A;  3D41 A;  3LL5 A;  3QUN A;  4NDP A;  4NDQ B;  2W21 A;  4A7W A;  1GS5 A;  4F6T B;  3ZZI A;  3WWN A;  4USJ A;  2BND A;  3C20 A;  4Q1T A;  3C1N A;  4NDR A;  1YBD A;  4NDO A;  2AP9 A;  2J4L A;  4JZ7 A;  2J5T A;  3ZZF A;  2JJX A;  3D2P A;  2J0X A;  2V5H A;  2BUF A;  2J4J A;  1Z9D A;  2BNE A;  2WXB A;  2R8V A;  3S6H A;  2BTY A;  3T7B A;  3B8G A;  3QVH A; 
#chains in the Genus database with same CATH topology
 2J4K A;  2JJ4 A;  2BNF A;  3EK6 A;  3NWY A;  4JZ9 A;  2HMF A;  3S6G A;  4AXS A;  2OGX A;  3D40 A;  2RD5 A;  3AAW A;  2AKO A;  2WE4 A;  4NDP B;  3AB4 A;  2A1F A;  3AB2 A;  4KZT A;  1B7B A;  2BRX A;  1OH9 A;  3WWM A;  3EK5 A;  2WE5 A;  4NDQ A;  2J0W A;  3QUR A;  4NDR B;  4NDO B;  4A7X A;  3S6K A;  4F6T A;  3U6U A;  1GSJ A;  3C1M A;  3K4Y A;  3LKK A;  2E9Y A;  3LL9 A;  3QVF A;  3KZF A;  1E19 A;  3QUO A;  4AB7 A;  2X2W A;  3TVI A;  4JZ8 A;  3L76 A;  2JI5 A;  2BRI A;  2IJ9 A;  3L86 A;  2R98 A;  1OHB A;  3ZZG A;  2V4Y A;  3K52 A;  2CDQ A;  4OLC A;  3ZZH A;  2VA1 A;  3D2M A;  2OGX B;  2J5V A;  4I49 A;  1OHA A;  3K56 A;  3K4O A;  2BMU A;  3D41 A;  3LL5 A;  3QUN A;  4NDP A;  4NDQ B;  2W21 A;  4A7W A;  1GS5 A;  4F6T B;  3ZZI A;  3WWN A;  4USJ A;  2BND A;  3C20 A;  4Q1T A;  3C1N A;  4NDR A;  1YBD A;  4NDO A;  2AP9 A;  2J4L A;  4JZ7 A;  2J5T A;  3ZZF A;  2JJX A;  3D2P A;  2J0X A;  2V5H A;  2BUF A;  2J4J A;  1Z9D A;  2BNE A;  2WXB A;  2R8V A;  3S6H A;  2BTY A;  3T7B A;  3B8G A;  3QVH A; 
#chains in the Genus database with same CATH homology
 2J4K A;  2JJ4 A;  2BNF A;  3EK6 A;  3NWY A;  4JZ9 A;  2HMF A;  3S6G A;  4AXS A;  2OGX A;  3D40 A;  2RD5 A;  3AAW A;  2AKO A;  2WE4 A;  4NDP B;  3AB4 A;  2A1F A;  3AB2 A;  4KZT A;  1B7B A;  2BRX A;  1OH9 A;  3WWM A;  3EK5 A;  2WE5 A;  4NDQ A;  2J0W A;  3QUR A;  4NDR B;  4NDO B;  4A7X A;  3S6K A;  4F6T A;  3U6U A;  1GSJ A;  3C1M A;  3K4Y A;  3LKK A;  2E9Y A;  3LL9 A;  3QVF A;  3KZF A;  1E19 A;  3QUO A;  4AB7 A;  2X2W A;  3TVI A;  4JZ8 A;  3L76 A;  2JI5 A;  2BRI A;  2IJ9 A;  3L86 A;  2R98 A;  1OHB A;  3ZZG A;  2V4Y A;  3K52 A;  2CDQ A;  4OLC A;  3ZZH A;  2VA1 A;  3D2M A;  2OGX B;  2J5V A;  4I49 A;  1OHA A;  3K56 A;  3K4O A;  2BMU A;  3D41 A;  3LL5 A;  3QUN A;  4NDP A;  4NDQ B;  2W21 A;  4A7W A;  1GS5 A;  4F6T B;  3ZZI A;  3WWN A;  4USJ A;  2BND A;  3C20 A;  4Q1T A;  3C1N A;  4NDR A;  1YBD A;  4NDO A;  2AP9 A;  2J4L A;  4JZ7 A;  2J5T A;  3ZZF A;  2JJX A;  3D2P A;  2J0X A;  2V5H A;  2BUF A;  2J4J A;  1Z9D A;  2BNE A;  2WXB A;  2R8V A;  3S6H A;  2BTY A;  3T7B A;  3B8G A;  3QVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...