4USJA

N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLGLUTAMATE KINASE, CHLOROPLASTIC
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 95
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4usjA00
4JZ9A 1OHAA 3KZFA 3C1NA 1GSJA 4AB7A 3L76A 2WE5A 3ZZIA 1Z9DA 4NDOA 3QURA 2E9YA 3WWNA 3K56A 4Q1TA 2R98A 4A7XA 3K52A 3K4OA 2R8VA 4I49A 3D40A 1E19A 4NDRB 3QUNA 2VA1A 3T7BA 3L86A 1B7BA 3S6HA 2BMUA 3LKKA 3D2MA 3QVFA 4NDQB 3S6GA 2J5VA 3U6UA 3C20A 2JJXA 2HMFA 2IJ9A 3ZZFA 3AAWA 2BRIA 2J4LA 1OH9A 3NWYA 2X2WA 2BUFA 3D41A 3ZZHA 1GS5A 2AKOA 2OGXA 4NDRA 2WE4A 2BNFA 4NDPA 2CDQA 2V5HA 4JZ8A 3EK6A 2WXBA 4NDOB 3ZZGA 3QUOA 4F6TB 3C1MA 2W21A 3EK5A 3TVIA 4NDQA 3S6KA 3LL9A 2J5TA 3QVHA 4USJA 2BNEA 3AB4A 2JI5A 3D2PA 1YBDA 2BRXA 4AXSA 2AP9A 3LL5A 2J0WA 2J0XA 4OLCA 1OHBA 2J4KA 3WWMA 2RD5A 2JJ4A 2BNDA 2J4JA 4A7WA 4F6TA 3B8GA 2V4YA 3K4YA 4JZ7A 2A1FA 3AB2A 2BTYA 2OGXB 4NDPB 4KZTA
chains in the Genus database with same CATH superfamily
4JZ9A 1OHAA 3KZFA 3C1NA 1GSJA 4AB7A 3L76A 2WE5A 3ZZIA 1Z9DA 4NDOA 3QURA 2E9YA 3WWNA 3K56A 4Q1TA 2R98A 4A7XA 3K52A 3K4OA 2R8VA 4I49A 3D40A 1E19A 4NDRB 3QUNA 2VA1A 3T7BA 3L86A 1B7BA 3S6HA 2BMUA 3LKKA 3D2MA 3QVFA 4NDQB 3S6GA 2J5VA 3U6UA 3C20A 2JJXA 2HMFA 2IJ9A 3ZZFA 3AAWA 2BRIA 2J4LA 1OH9A 3NWYA 2X2WA 2BUFA 3D41A 3ZZHA 1GS5A 2AKOA 2OGXA 4NDRA 2WE4A 2BNFA 4NDPA 2CDQA 2V5HA 4JZ8A 3EK6A 2WXBA 4NDOB 3ZZGA 3QUOA 4F6TB 3C1MA 2W21A 3EK5A 3TVIA 4NDQA 3S6KA 3LL9A 2J5TA 3QVHA 4USJA 2BNEA 3AB4A 2JI5A 3D2PA 1YBDA 2BRXA 4AXSA 2AP9A 3LL5A 2J0WA 2J0XA 4OLCA 1OHBA 2J4KA 3WWMA 2RD5A 2JJ4A 2BNDA 2J4JA 4A7WA 4F6TA 3B8GA 2V4YA 3K4YA 4JZ7A 2A1FA 3AB2A 2BTYA 2OGXB 4NDPB 4KZTA
chains in the Genus database with same CATH topology
4JZ9A 1OHAA 3KZFA 3C1NA 1GSJA 4AB7A 3L76A 2WE5A 3ZZIA 1Z9DA 4NDOA 3QURA 2E9YA 3WWNA 3K56A 4Q1TA 2R98A 4A7XA 3K52A 3K4OA 2R8VA 4I49A 3D40A 1E19A 4NDRB 3QUNA 2VA1A 3T7BA 3L86A 1B7BA 3S6HA 2BMUA 3LKKA 3D2MA 3QVFA 4NDQB 3S6GA 2J5VA 3U6UA 3C20A 2JJXA 2HMFA 2IJ9A 3ZZFA 3AAWA 2BRIA 2J4LA 1OH9A 3NWYA 2X2WA 2BUFA 3D41A 3ZZHA 1GS5A 2AKOA 2OGXA 4NDRA 2WE4A 2BNFA 4NDPA 2CDQA 2V5HA 4JZ8A 3EK6A 2WXBA 4NDOB 3ZZGA 3QUOA 4F6TB 3C1MA 2W21A 3EK5A 3TVIA 4NDQA 3S6KA 3LL9A 2J5TA 3QVHA 4USJA 2BNEA 3AB4A 2JI5A 3D2PA 1YBDA 2BRXA 4AXSA 2AP9A 3LL5A 2J0WA 2J0XA 4OLCA 1OHBA 2J4KA 3WWMA 2RD5A 2JJ4A 2BNDA 2J4JA 4A7WA 4F6TA 3B8GA 2V4YA 3K4YA 4JZ7A 2A1FA 3AB2A 2BTYA 2OGXB 4NDPB 4KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ9 A;  1OHA A;  3KZF A;  3C1N A;  1GSJ A;  4AB7 A;  3L76 A;  2WE5 A;  3ZZI A;  1Z9D A;  4NDO A;  3QUR A;  2E9Y A;  3WWN A;  3K56 A;  4Q1T A;  2R98 A;  4A7X A;  3K52 A;  3K4O A;  2R8V A;  4I49 A;  3D40 A;  1E19 A;  4NDR B;  3QUN A;  2VA1 A;  3T7B A;  3L86 A;  1B7B A;  3S6H A;  2BMU A;  3LKK A;  3D2M A;  3QVF A;  4NDQ B;  3S6G A;  2J5V A;  3U6U A;  3C20 A;  2JJX A;  2HMF A;  2IJ9 A;  3ZZF A;  3AAW A;  2BRI A;  2J4L A;  1OH9 A;  3NWY A;  2X2W A;  2BUF A;  3D41 A;  3ZZH A;  1GS5 A;  2AKO A;  2OGX A;  4NDR A;  2WE4 A;  2BNF A;  4NDP A;  2CDQ A;  2V5H A;  4JZ8 A;  3EK6 A;  2WXB A;  4NDO B;  3ZZG A;  3QUO A;  4F6T B;  3C1M A;  2W21 A;  3EK5 A;  3TVI A;  4NDQ A;  3S6K A;  3LL9 A;  2J5T A;  3QVH A;  4USJ A;  2BNE A;  3AB4 A;  2JI5 A;  3D2P A;  1YBD A;  2BRX A;  4AXS A;  2AP9 A;  3LL5 A;  2J0W A;  2J0X A;  4OLC A;  1OHB A;  2J4K A;  3WWM A;  2RD5 A;  2JJ4 A;  2BND A;  2J4J A;  4A7W A;  4F6T A;  3B8G A;  2V4Y A;  3K4Y A;  4JZ7 A;  2A1F A;  3AB2 A;  2BTY A;  2OGX B;  4NDP B;  4KZT A; 
#chains in the Genus database with same CATH topology
 4JZ9 A;  1OHA A;  3KZF A;  3C1N A;  1GSJ A;  4AB7 A;  3L76 A;  2WE5 A;  3ZZI A;  1Z9D A;  4NDO A;  3QUR A;  2E9Y A;  3WWN A;  3K56 A;  4Q1T A;  2R98 A;  4A7X A;  3K52 A;  3K4O A;  2R8V A;  4I49 A;  3D40 A;  1E19 A;  4NDR B;  3QUN A;  2VA1 A;  3T7B A;  3L86 A;  1B7B A;  3S6H A;  2BMU A;  3LKK A;  3D2M A;  3QVF A;  4NDQ B;  3S6G A;  2J5V A;  3U6U A;  3C20 A;  2JJX A;  2HMF A;  2IJ9 A;  3ZZF A;  3AAW A;  2BRI A;  2J4L A;  1OH9 A;  3NWY A;  2X2W A;  2BUF A;  3D41 A;  3ZZH A;  1GS5 A;  2AKO A;  2OGX A;  4NDR A;  2WE4 A;  2BNF A;  4NDP A;  2CDQ A;  2V5H A;  4JZ8 A;  3EK6 A;  2WXB A;  4NDO B;  3ZZG A;  3QUO A;  4F6T B;  3C1M A;  2W21 A;  3EK5 A;  3TVI A;  4NDQ A;  3S6K A;  3LL9 A;  2J5T A;  3QVH A;  4USJ A;  2BNE A;  3AB4 A;  2JI5 A;  3D2P A;  1YBD A;  2BRX A;  4AXS A;  2AP9 A;  3LL5 A;  2J0W A;  2J0X A;  4OLC A;  1OHB A;  2J4K A;  3WWM A;  2RD5 A;  2JJ4 A;  2BND A;  2J4J A;  4A7W A;  4F6T A;  3B8G A;  2V4Y A;  3K4Y A;  4JZ7 A;  2A1F A;  3AB2 A;  2BTY A;  2OGX B;  4NDP B;  4KZT A; 
#chains in the Genus database with same CATH homology
 4JZ9 A;  1OHA A;  3KZF A;  3C1N A;  1GSJ A;  4AB7 A;  3L76 A;  2WE5 A;  3ZZI A;  1Z9D A;  4NDO A;  3QUR A;  2E9Y A;  3WWN A;  3K56 A;  4Q1T A;  2R98 A;  4A7X A;  3K52 A;  3K4O A;  2R8V A;  4I49 A;  3D40 A;  1E19 A;  4NDR B;  3QUN A;  2VA1 A;  3T7B A;  3L86 A;  1B7B A;  3S6H A;  2BMU A;  3LKK A;  3D2M A;  3QVF A;  4NDQ B;  3S6G A;  2J5V A;  3U6U A;  3C20 A;  2JJX A;  2HMF A;  2IJ9 A;  3ZZF A;  3AAW A;  2BRI A;  2J4L A;  1OH9 A;  3NWY A;  2X2W A;  2BUF A;  3D41 A;  3ZZH A;  1GS5 A;  2AKO A;  2OGX A;  4NDR A;  2WE4 A;  2BNF A;  4NDP A;  2CDQ A;  2V5H A;  4JZ8 A;  3EK6 A;  2WXB A;  4NDO B;  3ZZG A;  3QUO A;  4F6T B;  3C1M A;  2W21 A;  3EK5 A;  3TVI A;  4NDQ A;  3S6K A;  3LL9 A;  2J5T A;  3QVH A;  4USJ A;  2BNE A;  3AB4 A;  2JI5 A;  3D2P A;  1YBD A;  2BRX A;  4AXS A;  2AP9 A;  3LL5 A;  2J0W A;  2J0X A;  4OLC A;  1OHB A;  2J4K A;  3WWM A;  2RD5 A;  2JJ4 A;  2BND A;  2J4J A;  4A7W A;  4F6T A;  3B8G A;  2V4Y A;  3K4Y A;  4JZ7 A;  2A1F A;  3AB2 A;  2BTY A;  2OGX B;  4NDP B;  4KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...