4USJA

N-acetylglutamate kinase from arabidopsis thaliana in complex with pii from chlamydomonas reinhardtii
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
281
Chain Sequence
DYRVEILSESLPFIQKFRGKTIVVKYGGAAMTSPELKSSVVSDLVLLACVGLRPILVHGGGPDINRYLKQLNIPAEFRDGLRVTDATTMEIVSMVLVGKVNKNLVSLINAAGATAVGLSGHDGRLLTARPVPNSAQLGFVGEVARVDPSVLRPLVDYGYIPVIASVAADDSGQAYNINADTVAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGVKKMIEDGKVAGGMIPKVKCCIRSLAQGVKTASIIDGRRQHSLLHEIMSDEGAGTMITG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Widespread Glutamine-Sensing Mechanism in the Plant Kingdom.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords ACETYLGLUTAMATE KINASE, CHLOROPLASTIC
total genus 95
structure length 281
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.7.2.8: Acetylglutamate kinase.
pdb deposition date 2014-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 4usjA00
4JZ9A 3C20A 2OGXB 3D41A 3LL9A 3C1NA 4JZ7A 2BMUA 3KZFA 3ZZHA 2BRIA 3L86A 3D40A 4I49A 4NDQA 1GS5A 3QUOA 3K4YA 3QVHA 2BUFA 2R98A 2WE5A 3TVIA 1YBDA 1OH9A 3EK6A 4Q1TA 3WWMA 3ZZGA 4NDPB 2BTYA 4JZ8A 3QUNA 2J4KA 2BNDA 3AB2A 4NDPA 2J5TA 4F6TA 2HMFA 2BRXA 2R8VA 4A7WA 2JJXA 3ZZFA 2VA1A 3AB4A 2E9YA 2J4LA 4KZTA 3AAWA 3K4OA 2V5HA 3D2PA 3K52A 2IJ9A 3NWYA 3T7BA 2W21A 3LKKA 2JJ4A 1Z9DA 2CDQA 2J4JA 3U6UA 3QURA 3B8GA 2AP9A 4A7XA 1GSJA 3D2MA 3S6GA 2RD5A 1B7BA 2J5VA 4AXSA 4NDOB 2BNEA 2J0WA 4F6TB 3WWNA 2V4YA 1E19A 3QVFA 4AB7A 2J0XA 4OLCA 3LL5A 4NDOA 4NDRB 4NDQB 1OHBA 3K56A 3ZZIA 4NDRA 2X2WA 3S6KA 2A1FA 2WXBA 3EK5A 2OGXA 2WE4A 2BNFA 2JI5A 3L76A 3C1MA 1OHAA 3S6HA 2AKOA 4USJA
chains in the Genus database with same CATH superfamily
4JZ9A 3C20A 2OGXB 3D41A 3LL9A 3C1NA 4JZ7A 2BMUA 3KZFA 3ZZHA 2BRIA 3L86A 3D40A 4I49A 4NDQA 1GS5A 3QUOA 3K4YA 3QVHA 2BUFA 2R98A 2WE5A 3TVIA 1YBDA 1OH9A 3EK6A 4Q1TA 3WWMA 3ZZGA 4NDPB 2BTYA 4JZ8A 3QUNA 2J4KA 2BNDA 3AB2A 4NDPA 2J5TA 4F6TA 2HMFA 2BRXA 2R8VA 4A7WA 2JJXA 3ZZFA 2VA1A 3AB4A 2E9YA 2J4LA 4KZTA 3AAWA 3K4OA 2V5HA 3D2PA 3K52A 2IJ9A 3NWYA 3T7BA 2W21A 3LKKA 2JJ4A 1Z9DA 2CDQA 2J4JA 3U6UA 3QURA 3B8GA 2AP9A 4A7XA 1GSJA 3D2MA 3S6GA 2RD5A 1B7BA 2J5VA 4AXSA 4NDOB 2BNEA 2J0WA 4F6TB 3WWNA 2V4YA 1E19A 3QVFA 4AB7A 2J0XA 4OLCA 3LL5A 4NDOA 4NDRB 4NDQB 1OHBA 3K56A 3ZZIA 4NDRA 2X2WA 3S6KA 2A1FA 2WXBA 3EK5A 2OGXA 2WE4A 2BNFA 2JI5A 3L76A 3C1MA 1OHAA 3S6HA 2AKOA 4USJA
chains in the Genus database with same CATH topology
4JZ9A 3C20A 2OGXB 3D41A 3LL9A 3C1NA 4JZ7A 2BMUA 3KZFA 3ZZHA 2BRIA 3L86A 3D40A 4I49A 4NDQA 1GS5A 3QUOA 3K4YA 3QVHA 2BUFA 2R98A 2WE5A 3TVIA 1YBDA 1OH9A 3EK6A 4Q1TA 3WWMA 3ZZGA 4NDPB 2BTYA 4JZ8A 3QUNA 2J4KA 2BNDA 3AB2A 4NDPA 2J5TA 4F6TA 2HMFA 2BRXA 2R8VA 4A7WA 2JJXA 3ZZFA 2VA1A 3AB4A 2E9YA 2J4LA 4KZTA 3AAWA 3K4OA 2V5HA 3D2PA 3K52A 2IJ9A 3NWYA 3T7BA 2W21A 3LKKA 2JJ4A 1Z9DA 2CDQA 2J4JA 3U6UA 3QURA 3B8GA 2AP9A 4A7XA 1GSJA 3D2MA 3S6GA 2RD5A 1B7BA 2J5VA 4AXSA 4NDOB 2BNEA 2J0WA 4F6TB 3WWNA 2V4YA 1E19A 3QVFA 4AB7A 2J0XA 4OLCA 3LL5A 4NDOA 4NDRB 4NDQB 1OHBA 3K56A 3ZZIA 4NDRA 2X2WA 3S6KA 2A1FA 2WXBA 3EK5A 2OGXA 2WE4A 2BNFA 2JI5A 3L76A 3C1MA 1OHAA 3S6HA 2AKOA 4USJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ9 A;  3C20 A;  2OGX B;  3D41 A;  3LL9 A;  3C1N A;  4JZ7 A;  2BMU A;  3KZF A;  3ZZH A;  2BRI A;  3L86 A;  3D40 A;  4I49 A;  4NDQ A;  1GS5 A;  3QUO A;  3K4Y A;  3QVH A;  2BUF A;  2R98 A;  2WE5 A;  3TVI A;  1YBD A;  1OH9 A;  3EK6 A;  4Q1T A;  3WWM A;  3ZZG A;  4NDP B;  2BTY A;  4JZ8 A;  3QUN A;  2J4K A;  2BND A;  3AB2 A;  4NDP A;  2J5T A;  4F6T A;  2HMF A;  2BRX A;  2R8V A;  4A7W A;  2JJX A;  3ZZF A;  2VA1 A;  3AB4 A;  2E9Y A;  2J4L A;  4KZT A;  3AAW A;  3K4O A;  2V5H A;  3D2P A;  3K52 A;  2IJ9 A;  3NWY A;  3T7B A;  2W21 A;  3LKK A;  2JJ4 A;  1Z9D A;  2CDQ A;  2J4J A;  3U6U A;  3QUR A;  3B8G A;  2AP9 A;  4A7X A;  1GSJ A;  3D2M A;  3S6G A;  2RD5 A;  1B7B A;  2J5V A;  4AXS A;  4NDO B;  2BNE A;  2J0W A;  4F6T B;  3WWN A;  2V4Y A;  1E19 A;  3QVF A;  4AB7 A;  2J0X A;  4OLC A;  3LL5 A;  4NDO A;  4NDR B;  4NDQ B;  1OHB A;  3K56 A;  3ZZI A;  4NDR A;  2X2W A;  3S6K A;  2A1F A;  2WXB A;  3EK5 A;  2OGX A;  2WE4 A;  2BNF A;  2JI5 A;  3L76 A;  3C1M A;  1OHA A;  3S6H A;  2AKO A;  4USJ A; 
#chains in the Genus database with same CATH topology
 4JZ9 A;  3C20 A;  2OGX B;  3D41 A;  3LL9 A;  3C1N A;  4JZ7 A;  2BMU A;  3KZF A;  3ZZH A;  2BRI A;  3L86 A;  3D40 A;  4I49 A;  4NDQ A;  1GS5 A;  3QUO A;  3K4Y A;  3QVH A;  2BUF A;  2R98 A;  2WE5 A;  3TVI A;  1YBD A;  1OH9 A;  3EK6 A;  4Q1T A;  3WWM A;  3ZZG A;  4NDP B;  2BTY A;  4JZ8 A;  3QUN A;  2J4K A;  2BND A;  3AB2 A;  4NDP A;  2J5T A;  4F6T A;  2HMF A;  2BRX A;  2R8V A;  4A7W A;  2JJX A;  3ZZF A;  2VA1 A;  3AB4 A;  2E9Y A;  2J4L A;  4KZT A;  3AAW A;  3K4O A;  2V5H A;  3D2P A;  3K52 A;  2IJ9 A;  3NWY A;  3T7B A;  2W21 A;  3LKK A;  2JJ4 A;  1Z9D A;  2CDQ A;  2J4J A;  3U6U A;  3QUR A;  3B8G A;  2AP9 A;  4A7X A;  1GSJ A;  3D2M A;  3S6G A;  2RD5 A;  1B7B A;  2J5V A;  4AXS A;  4NDO B;  2BNE A;  2J0W A;  4F6T B;  3WWN A;  2V4Y A;  1E19 A;  3QVF A;  4AB7 A;  2J0X A;  4OLC A;  3LL5 A;  4NDO A;  4NDR B;  4NDQ B;  1OHB A;  3K56 A;  3ZZI A;  4NDR A;  2X2W A;  3S6K A;  2A1F A;  2WXB A;  3EK5 A;  2OGX A;  2WE4 A;  2BNF A;  2JI5 A;  3L76 A;  3C1M A;  1OHA A;  3S6H A;  2AKO A;  4USJ A; 
#chains in the Genus database with same CATH homology
 4JZ9 A;  3C20 A;  2OGX B;  3D41 A;  3LL9 A;  3C1N A;  4JZ7 A;  2BMU A;  3KZF A;  3ZZH A;  2BRI A;  3L86 A;  3D40 A;  4I49 A;  4NDQ A;  1GS5 A;  3QUO A;  3K4Y A;  3QVH A;  2BUF A;  2R98 A;  2WE5 A;  3TVI A;  1YBD A;  1OH9 A;  3EK6 A;  4Q1T A;  3WWM A;  3ZZG A;  4NDP B;  2BTY A;  4JZ8 A;  3QUN A;  2J4K A;  2BND A;  3AB2 A;  4NDP A;  2J5T A;  4F6T A;  2HMF A;  2BRX A;  2R8V A;  4A7W A;  2JJX A;  3ZZF A;  2VA1 A;  3AB4 A;  2E9Y A;  2J4L A;  4KZT A;  3AAW A;  3K4O A;  2V5H A;  3D2P A;  3K52 A;  2IJ9 A;  3NWY A;  3T7B A;  2W21 A;  3LKK A;  2JJ4 A;  1Z9D A;  2CDQ A;  2J4J A;  3U6U A;  3QUR A;  3B8G A;  2AP9 A;  4A7X A;  1GSJ A;  3D2M A;  3S6G A;  2RD5 A;  1B7B A;  2J5V A;  4AXS A;  4NDO B;  2BNE A;  2J0W A;  4F6T B;  3WWN A;  2V4Y A;  1E19 A;  3QVF A;  4AB7 A;  2J0X A;  4OLC A;  3LL5 A;  4NDO A;  4NDR B;  4NDQ B;  1OHB A;  3K56 A;  3ZZI A;  4NDR A;  2X2W A;  3S6K A;  2A1F A;  2WXB A;  3EK5 A;  2OGX A;  2WE4 A;  2BNF A;  2JI5 A;  3L76 A;  3C1M A;  1OHA A;  3S6H A;  2AKO A;  4USJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...