2BMUA

Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 72
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bmuA00
2BRXA 2CDQA 2JJ4A 1OH9A 4NDPA 2BNDA 4NDQB 3K56A 2A1FA 3ZZFA 3QURA 2R8VA 2W21A 2V4YA 3S6HA 3LKKA 4AXSA 2V5HA 3AB2A 4A7WA 3K4YA 2J4JA 2JJXA 3T7BA 2BMUA 2VA1A 3C1MA 3K4OA 4Q1TA 3AB4A 2WE5A 2BNEA 2HMFA 4NDOB 1Z9DA 4USJA 3ZZIA 3QUNA 4F6TA 1OHBA 3LL5A 3QVHA 3L76A 2BRIA 3WWMA 2J0WA 3L86A 2OGXA 3C20A 1E19A 4JZ9A 3ZZHA 4NDRA 4F6TB 3S6GA 2AP9A 2WXBA 2J0XA 3TVIA 4JZ7A 2OGXB 4I49A 3EK5A 4A7XA 4KZTA 4JZ8A 2JI5A 3D41A 2BNFA 3B8GA 1B7BA 3K52A 3S6KA 2X2WA 3AAWA 2BUFA 4NDOA 4OLCA 2R98A 3QVFA 3D40A 1GS5A 3ZZGA 2AKOA 3WWNA 3D2MA 3D2PA 1OHAA 2WE4A 2J5VA 3EK6A 4NDQA 2E9YA 2RD5A 2IJ9A 3C1NA 3LL9A 2BTYA 2J4LA 3KZFA 2J5TA 3QUOA 4NDPB 3U6UA 1GSJA 4NDRB 3NWYA 2J4KA 4AB7A 1YBDA
chains in the Genus database with same CATH superfamily
2BRXA 2CDQA 2JJ4A 1OH9A 4NDPA 2BNDA 4NDQB 3K56A 2A1FA 3ZZFA 3QURA 2R8VA 2W21A 2V4YA 3S6HA 3LKKA 4AXSA 2V5HA 3AB2A 4A7WA 3K4YA 2J4JA 2JJXA 3T7BA 2BMUA 2VA1A 3C1MA 3K4OA 4Q1TA 3AB4A 2WE5A 2BNEA 2HMFA 4NDOB 1Z9DA 4USJA 3ZZIA 3QUNA 4F6TA 1OHBA 3LL5A 3QVHA 3L76A 2BRIA 3WWMA 2J0WA 3L86A 2OGXA 3C20A 1E19A 4JZ9A 3ZZHA 4NDRA 4F6TB 3S6GA 2AP9A 2WXBA 2J0XA 3TVIA 4JZ7A 2OGXB 4I49A 3EK5A 4A7XA 4KZTA 4JZ8A 2JI5A 3D41A 2BNFA 3B8GA 1B7BA 3K52A 3S6KA 2X2WA 3AAWA 2BUFA 4NDOA 4OLCA 2R98A 3QVFA 3D40A 1GS5A 3ZZGA 2AKOA 3WWNA 3D2MA 3D2PA 1OHAA 2WE4A 2J5VA 3EK6A 4NDQA 2E9YA 2RD5A 2IJ9A 3C1NA 3LL9A 2BTYA 2J4LA 3KZFA 2J5TA 3QUOA 4NDPB 3U6UA 1GSJA 4NDRB 3NWYA 2J4KA 4AB7A 1YBDA
chains in the Genus database with same CATH topology
2BRXA 2CDQA 2JJ4A 1OH9A 4NDPA 2BNDA 4NDQB 3K56A 2A1FA 3ZZFA 3QURA 2R8VA 2W21A 2V4YA 3S6HA 3LKKA 4AXSA 2V5HA 3AB2A 4A7WA 3K4YA 2J4JA 2JJXA 3T7BA 2BMUA 2VA1A 3C1MA 3K4OA 4Q1TA 3AB4A 2WE5A 2BNEA 2HMFA 4NDOB 1Z9DA 4USJA 3ZZIA 3QUNA 4F6TA 1OHBA 3LL5A 3QVHA 3L76A 2BRIA 3WWMA 2J0WA 3L86A 2OGXA 3C20A 1E19A 4JZ9A 3ZZHA 4NDRA 4F6TB 3S6GA 2AP9A 2WXBA 2J0XA 3TVIA 4JZ7A 2OGXB 4I49A 3EK5A 4A7XA 4KZTA 4JZ8A 2JI5A 3D41A 2BNFA 3B8GA 1B7BA 3K52A 3S6KA 2X2WA 3AAWA 2BUFA 4NDOA 4OLCA 2R98A 3QVFA 3D40A 1GS5A 3ZZGA 2AKOA 3WWNA 3D2MA 3D2PA 1OHAA 2WE4A 2J5VA 3EK6A 4NDQA 2E9YA 2RD5A 2IJ9A 3C1NA 3LL9A 2BTYA 2J4LA 3KZFA 2J5TA 3QUOA 4NDPB 3U6UA 1GSJA 4NDRB 3NWYA 2J4KA 4AB7A 1YBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRX A;  2CDQ A;  2JJ4 A;  1OH9 A;  4NDP A;  2BND A;  4NDQ B;  3K56 A;  2A1F A;  3ZZF A;  3QUR A;  2R8V A;  2W21 A;  2V4Y A;  3S6H A;  3LKK A;  4AXS A;  2V5H A;  3AB2 A;  4A7W A;  3K4Y A;  2J4J A;  2JJX A;  3T7B A;  2BMU A;  2VA1 A;  3C1M A;  3K4O A;  4Q1T A;  3AB4 A;  2WE5 A;  2BNE A;  2HMF A;  4NDO B;  1Z9D A;  4USJ A;  3ZZI A;  3QUN A;  4F6T A;  1OHB A;  3LL5 A;  3QVH A;  3L76 A;  2BRI A;  3WWM A;  2J0W A;  3L86 A;  2OGX A;  3C20 A;  1E19 A;  4JZ9 A;  3ZZH A;  4NDR A;  4F6T B;  3S6G A;  2AP9 A;  2WXB A;  2J0X A;  3TVI A;  4JZ7 A;  2OGX B;  4I49 A;  3EK5 A;  4A7X A;  4KZT A;  4JZ8 A;  2JI5 A;  3D41 A;  2BNF A;  3B8G A;  1B7B A;  3K52 A;  3S6K A;  2X2W A;  3AAW A;  2BUF A;  4NDO A;  4OLC A;  2R98 A;  3QVF A;  3D40 A;  1GS5 A;  3ZZG A;  2AKO A;  3WWN A;  3D2M A;  3D2P A;  1OHA A;  2WE4 A;  2J5V A;  3EK6 A;  4NDQ A;  2E9Y A;  2RD5 A;  2IJ9 A;  3C1N A;  3LL9 A;  2BTY A;  2J4L A;  3KZF A;  2J5T A;  3QUO A;  4NDP B;  3U6U A;  1GSJ A;  4NDR B;  3NWY A;  2J4K A;  4AB7 A;  1YBD A; 
#chains in the Genus database with same CATH topology
 2BRX A;  2CDQ A;  2JJ4 A;  1OH9 A;  4NDP A;  2BND A;  4NDQ B;  3K56 A;  2A1F A;  3ZZF A;  3QUR A;  2R8V A;  2W21 A;  2V4Y A;  3S6H A;  3LKK A;  4AXS A;  2V5H A;  3AB2 A;  4A7W A;  3K4Y A;  2J4J A;  2JJX A;  3T7B A;  2BMU A;  2VA1 A;  3C1M A;  3K4O A;  4Q1T A;  3AB4 A;  2WE5 A;  2BNE A;  2HMF A;  4NDO B;  1Z9D A;  4USJ A;  3ZZI A;  3QUN A;  4F6T A;  1OHB A;  3LL5 A;  3QVH A;  3L76 A;  2BRI A;  3WWM A;  2J0W A;  3L86 A;  2OGX A;  3C20 A;  1E19 A;  4JZ9 A;  3ZZH A;  4NDR A;  4F6T B;  3S6G A;  2AP9 A;  2WXB A;  2J0X A;  3TVI A;  4JZ7 A;  2OGX B;  4I49 A;  3EK5 A;  4A7X A;  4KZT A;  4JZ8 A;  2JI5 A;  3D41 A;  2BNF A;  3B8G A;  1B7B A;  3K52 A;  3S6K A;  2X2W A;  3AAW A;  2BUF A;  4NDO A;  4OLC A;  2R98 A;  3QVF A;  3D40 A;  1GS5 A;  3ZZG A;  2AKO A;  3WWN A;  3D2M A;  3D2P A;  1OHA A;  2WE4 A;  2J5V A;  3EK6 A;  4NDQ A;  2E9Y A;  2RD5 A;  2IJ9 A;  3C1N A;  3LL9 A;  2BTY A;  2J4L A;  3KZF A;  2J5T A;  3QUO A;  4NDP B;  3U6U A;  1GSJ A;  4NDR B;  3NWY A;  2J4K A;  4AB7 A;  1YBD A; 
#chains in the Genus database with same CATH homology
 2BRX A;  2CDQ A;  2JJ4 A;  1OH9 A;  4NDP A;  2BND A;  4NDQ B;  3K56 A;  2A1F A;  3ZZF A;  3QUR A;  2R8V A;  2W21 A;  2V4Y A;  3S6H A;  3LKK A;  4AXS A;  2V5H A;  3AB2 A;  4A7W A;  3K4Y A;  2J4J A;  2JJX A;  3T7B A;  2BMU A;  2VA1 A;  3C1M A;  3K4O A;  4Q1T A;  3AB4 A;  2WE5 A;  2BNE A;  2HMF A;  4NDO B;  1Z9D A;  4USJ A;  3ZZI A;  3QUN A;  4F6T A;  1OHB A;  3LL5 A;  3QVH A;  3L76 A;  2BRI A;  3WWM A;  2J0W A;  3L86 A;  2OGX A;  3C20 A;  1E19 A;  4JZ9 A;  3ZZH A;  4NDR A;  4F6T B;  3S6G A;  2AP9 A;  2WXB A;  2J0X A;  3TVI A;  4JZ7 A;  2OGX B;  4I49 A;  3EK5 A;  4A7X A;  4KZT A;  4JZ8 A;  2JI5 A;  3D41 A;  2BNF A;  3B8G A;  1B7B A;  3K52 A;  3S6K A;  2X2W A;  3AAW A;  2BUF A;  4NDO A;  4OLC A;  2R98 A;  3QVF A;  3D40 A;  1GS5 A;  3ZZG A;  2AKO A;  3WWN A;  3D2M A;  3D2P A;  1OHA A;  2WE4 A;  2J5V A;  3EK6 A;  4NDQ A;  2E9Y A;  2RD5 A;  2IJ9 A;  3C1N A;  3LL9 A;  2BTY A;  2J4L A;  3KZF A;  2J5T A;  3QUO A;  4NDP B;  3U6U A;  1GSJ A;  4NDR B;  3NWY A;  2J4K A;  4AB7 A;  1YBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...