2BMUA

Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 72
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bmuA00
4OLCA 3L86A 4Q1TA 3QURA 2J4JA 2J0WA 3QUNA 2BRIA 3S6KA 3C20A 4JZ7A 4I49A 1OH9A 4USJA 2OGXA 2AKOA 2R98A 3B8GA 2J4LA 4NDPB 2J4KA 3K4OA 1OHBA 1E19A 1GSJA 2AP9A 4NDQB 3QVHA 3EK5A 2JJXA 3QVFA 3L76A 1Z9DA 3S6HA 2WXBA 2RD5A 2BMUA 3D40A 3LL5A 2VA1A 1YBDA 3AB4A 3ZZGA 2BRXA 2BNEA 2V4YA 4NDOA 4F6TB 3U6UA 2V5HA 3C1NA 4NDRA 2BNFA 2X2WA 1B7BA 3K52A 3WWMA 2A1FA 1OHAA 3AAWA 3K56A 1GS5A 2R8VA 3LL9A 3K4YA 3ZZHA 3D2PA 2J5TA 3ZZIA 3C1MA 3T7BA 4NDOB 4AXSA 2OGXB 2IJ9A 4NDQA 3TVIA 2BNDA 4NDRB 4KZTA 3AB2A 3EK6A 3NWYA 3LKKA 4A7XA 2BUFA 4AB7A 2J0XA 4A7WA 3QUOA 2HMFA 3D2MA 2JI5A 4F6TA 4JZ8A 2CDQA 2BTYA 4NDPA 2JJ4A 2W21A 4JZ9A 3KZFA 3S6GA 2WE5A 2J5VA 2WE4A 3WWNA 2E9YA 3D41A 3ZZFA
chains in the Genus database with same CATH superfamily
4OLCA 3L86A 4Q1TA 3QURA 2J4JA 2J0WA 3QUNA 2BRIA 3S6KA 3C20A 4JZ7A 4I49A 1OH9A 4USJA 2OGXA 2AKOA 2R98A 3B8GA 2J4LA 4NDPB 2J4KA 3K4OA 1OHBA 1E19A 1GSJA 2AP9A 4NDQB 3QVHA 3EK5A 2JJXA 3QVFA 3L76A 1Z9DA 3S6HA 2WXBA 2RD5A 2BMUA 3D40A 3LL5A 2VA1A 1YBDA 3AB4A 3ZZGA 2BRXA 2BNEA 2V4YA 4NDOA 4F6TB 3U6UA 2V5HA 3C1NA 4NDRA 2BNFA 2X2WA 1B7BA 3K52A 3WWMA 2A1FA 1OHAA 3AAWA 3K56A 1GS5A 2R8VA 3LL9A 3K4YA 3ZZHA 3D2PA 2J5TA 3ZZIA 3C1MA 3T7BA 4NDOB 4AXSA 2OGXB 2IJ9A 4NDQA 3TVIA 2BNDA 4NDRB 4KZTA 3AB2A 3EK6A 3NWYA 3LKKA 4A7XA 2BUFA 4AB7A 2J0XA 4A7WA 3QUOA 2HMFA 3D2MA 2JI5A 4F6TA 4JZ8A 2CDQA 2BTYA 4NDPA 2JJ4A 2W21A 4JZ9A 3KZFA 3S6GA 2WE5A 2J5VA 2WE4A 3WWNA 2E9YA 3D41A 3ZZFA
chains in the Genus database with same CATH topology
4OLCA 3L86A 4Q1TA 3QURA 2J4JA 2J0WA 3QUNA 2BRIA 3S6KA 3C20A 4JZ7A 4I49A 1OH9A 4USJA 2OGXA 2AKOA 2R98A 3B8GA 2J4LA 4NDPB 2J4KA 3K4OA 1OHBA 1E19A 1GSJA 2AP9A 4NDQB 3QVHA 3EK5A 2JJXA 3QVFA 3L76A 1Z9DA 3S6HA 2WXBA 2RD5A 2BMUA 3D40A 3LL5A 2VA1A 1YBDA 3AB4A 3ZZGA 2BRXA 2BNEA 2V4YA 4NDOA 4F6TB 3U6UA 2V5HA 3C1NA 4NDRA 2BNFA 2X2WA 1B7BA 3K52A 3WWMA 2A1FA 1OHAA 3AAWA 3K56A 1GS5A 2R8VA 3LL9A 3K4YA 3ZZHA 3D2PA 2J5TA 3ZZIA 3C1MA 3T7BA 4NDOB 4AXSA 2OGXB 2IJ9A 4NDQA 3TVIA 2BNDA 4NDRB 4KZTA 3AB2A 3EK6A 3NWYA 3LKKA 4A7XA 2BUFA 4AB7A 2J0XA 4A7WA 3QUOA 2HMFA 3D2MA 2JI5A 4F6TA 4JZ8A 2CDQA 2BTYA 4NDPA 2JJ4A 2W21A 4JZ9A 3KZFA 3S6GA 2WE5A 2J5VA 2WE4A 3WWNA 2E9YA 3D41A 3ZZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLC A;  3L86 A;  4Q1T A;  3QUR A;  2J4J A;  2J0W A;  3QUN A;  2BRI A;  3S6K A;  3C20 A;  4JZ7 A;  4I49 A;  1OH9 A;  4USJ A;  2OGX A;  2AKO A;  2R98 A;  3B8G A;  2J4L A;  4NDP B;  2J4K A;  3K4O A;  1OHB A;  1E19 A;  1GSJ A;  2AP9 A;  4NDQ B;  3QVH A;  3EK5 A;  2JJX A;  3QVF A;  3L76 A;  1Z9D A;  3S6H A;  2WXB A;  2RD5 A;  2BMU A;  3D40 A;  3LL5 A;  2VA1 A;  1YBD A;  3AB4 A;  3ZZG A;  2BRX A;  2BNE A;  2V4Y A;  4NDO A;  4F6T B;  3U6U A;  2V5H A;  3C1N A;  4NDR A;  2BNF A;  2X2W A;  1B7B A;  3K52 A;  3WWM A;  2A1F A;  1OHA A;  3AAW A;  3K56 A;  1GS5 A;  2R8V A;  3LL9 A;  3K4Y A;  3ZZH A;  3D2P A;  2J5T A;  3ZZI A;  3C1M A;  3T7B A;  4NDO B;  4AXS A;  2OGX B;  2IJ9 A;  4NDQ A;  3TVI A;  2BND A;  4NDR B;  4KZT A;  3AB2 A;  3EK6 A;  3NWY A;  3LKK A;  4A7X A;  2BUF A;  4AB7 A;  2J0X A;  4A7W A;  3QUO A;  2HMF A;  3D2M A;  2JI5 A;  4F6T A;  4JZ8 A;  2CDQ A;  2BTY A;  4NDP A;  2JJ4 A;  2W21 A;  4JZ9 A;  3KZF A;  3S6G A;  2WE5 A;  2J5V A;  2WE4 A;  3WWN A;  2E9Y A;  3D41 A;  3ZZF A; 
#chains in the Genus database with same CATH topology
 4OLC A;  3L86 A;  4Q1T A;  3QUR A;  2J4J A;  2J0W A;  3QUN A;  2BRI A;  3S6K A;  3C20 A;  4JZ7 A;  4I49 A;  1OH9 A;  4USJ A;  2OGX A;  2AKO A;  2R98 A;  3B8G A;  2J4L A;  4NDP B;  2J4K A;  3K4O A;  1OHB A;  1E19 A;  1GSJ A;  2AP9 A;  4NDQ B;  3QVH A;  3EK5 A;  2JJX A;  3QVF A;  3L76 A;  1Z9D A;  3S6H A;  2WXB A;  2RD5 A;  2BMU A;  3D40 A;  3LL5 A;  2VA1 A;  1YBD A;  3AB4 A;  3ZZG A;  2BRX A;  2BNE A;  2V4Y A;  4NDO A;  4F6T B;  3U6U A;  2V5H A;  3C1N A;  4NDR A;  2BNF A;  2X2W A;  1B7B A;  3K52 A;  3WWM A;  2A1F A;  1OHA A;  3AAW A;  3K56 A;  1GS5 A;  2R8V A;  3LL9 A;  3K4Y A;  3ZZH A;  3D2P A;  2J5T A;  3ZZI A;  3C1M A;  3T7B A;  4NDO B;  4AXS A;  2OGX B;  2IJ9 A;  4NDQ A;  3TVI A;  2BND A;  4NDR B;  4KZT A;  3AB2 A;  3EK6 A;  3NWY A;  3LKK A;  4A7X A;  2BUF A;  4AB7 A;  2J0X A;  4A7W A;  3QUO A;  2HMF A;  3D2M A;  2JI5 A;  4F6T A;  4JZ8 A;  2CDQ A;  2BTY A;  4NDP A;  2JJ4 A;  2W21 A;  4JZ9 A;  3KZF A;  3S6G A;  2WE5 A;  2J5V A;  2WE4 A;  3WWN A;  2E9Y A;  3D41 A;  3ZZF A; 
#chains in the Genus database with same CATH homology
 4OLC A;  3L86 A;  4Q1T A;  3QUR A;  2J4J A;  2J0W A;  3QUN A;  2BRI A;  3S6K A;  3C20 A;  4JZ7 A;  4I49 A;  1OH9 A;  4USJ A;  2OGX A;  2AKO A;  2R98 A;  3B8G A;  2J4L A;  4NDP B;  2J4K A;  3K4O A;  1OHB A;  1E19 A;  1GSJ A;  2AP9 A;  4NDQ B;  3QVH A;  3EK5 A;  2JJX A;  3QVF A;  3L76 A;  1Z9D A;  3S6H A;  2WXB A;  2RD5 A;  2BMU A;  3D40 A;  3LL5 A;  2VA1 A;  1YBD A;  3AB4 A;  3ZZG A;  2BRX A;  2BNE A;  2V4Y A;  4NDO A;  4F6T B;  3U6U A;  2V5H A;  3C1N A;  4NDR A;  2BNF A;  2X2W A;  1B7B A;  3K52 A;  3WWM A;  2A1F A;  1OHA A;  3AAW A;  3K56 A;  1GS5 A;  2R8V A;  3LL9 A;  3K4Y A;  3ZZH A;  3D2P A;  2J5T A;  3ZZI A;  3C1M A;  3T7B A;  4NDO B;  4AXS A;  2OGX B;  2IJ9 A;  4NDQ A;  3TVI A;  2BND A;  4NDR B;  4KZT A;  3AB2 A;  3EK6 A;  3NWY A;  3LKK A;  4A7X A;  2BUF A;  4AB7 A;  2J0X A;  4A7W A;  3QUO A;  2HMF A;  3D2M A;  2JI5 A;  4F6T A;  4JZ8 A;  2CDQ A;  2BTY A;  4NDP A;  2JJ4 A;  2W21 A;  4JZ9 A;  3KZF A;  3S6G A;  2WE5 A;  2J5V A;  2WE4 A;  3WWN A;  2E9Y A;  3D41 A;  3ZZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...