2BMUA

Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords URIDYLATE KINASE
total genus 72
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bmuA00
3AAWA 3LL9A 1GS5A 1B7BA 1Z9DA 2J5VA 2JI5A 4NDOB 3TVIA 4JZ8A 1OHBA 2OGXB 3ZZGA 2BNFA 4F6TA 3C20A 4A7WA 3QVHA 3B8GA 3C1MA 2WE4A 2AKOA 2J4LA 3EK5A 3QUNA 4KZTA 3LL5A 2J4JA 2V5HA 3S6KA 2CDQA 4NDPA 4NDRB 3K4YA 3AB4A 3D2PA 2E9YA 3K56A 2BTYA 1OH9A 3WWNA 3ZZIA 4NDQA 2V4YA 2BMUA 4Q1TA 3ZZHA 2IJ9A 3WWMA 3NWYA 3K52A 3QURA 2OGXA 2BRXA 1YBDA 2R8VA 2BNEA 1OHAA 2AP9A 4USJA 3D40A 2J0WA 3QVFA 4F6TB 3S6GA 2JJXA 3L76A 2BNDA 1E19A 3K4OA 2RD5A 3EK6A 4OLCA 2HMFA 2JJ4A 2BUFA 3T7BA 4A7XA 2J4KA 4NDRA 4JZ7A 3AB2A 4NDQB 3D41A 3C1NA 4NDOA 4AXSA 3D2MA 3ZZFA 2R98A 4AB7A 3L86A 2VA1A 3KZFA 3S6HA 2W21A 3QUOA 4JZ9A 4NDPB 2J5TA 2A1FA 3U6UA 3LKKA 2WE5A 2BRIA 4I49A 2J0XA 2WXBA 1GSJA 2X2WA
chains in the Genus database with same CATH superfamily
3AAWA 3LL9A 1GS5A 1B7BA 1Z9DA 2J5VA 2JI5A 4NDOB 3TVIA 4JZ8A 1OHBA 2OGXB 3ZZGA 2BNFA 4F6TA 3C20A 4A7WA 3QVHA 3B8GA 3C1MA 2WE4A 2AKOA 2J4LA 3EK5A 3QUNA 4KZTA 3LL5A 2J4JA 2V5HA 3S6KA 2CDQA 4NDPA 4NDRB 3K4YA 3AB4A 3D2PA 2E9YA 3K56A 2BTYA 1OH9A 3WWNA 3ZZIA 4NDQA 2V4YA 2BMUA 4Q1TA 3ZZHA 2IJ9A 3WWMA 3NWYA 3K52A 3QURA 2OGXA 2BRXA 1YBDA 2R8VA 2BNEA 1OHAA 2AP9A 4USJA 3D40A 2J0WA 3QVFA 4F6TB 3S6GA 2JJXA 3L76A 2BNDA 1E19A 3K4OA 2RD5A 3EK6A 4OLCA 2HMFA 2JJ4A 2BUFA 3T7BA 4A7XA 2J4KA 4NDRA 4JZ7A 3AB2A 4NDQB 3D41A 3C1NA 4NDOA 4AXSA 3D2MA 3ZZFA 2R98A 4AB7A 3L86A 2VA1A 3KZFA 3S6HA 2W21A 3QUOA 4JZ9A 4NDPB 2J5TA 2A1FA 3U6UA 3LKKA 2WE5A 2BRIA 4I49A 2J0XA 2WXBA 1GSJA 2X2WA
chains in the Genus database with same CATH topology
3AAWA 3LL9A 1GS5A 1B7BA 1Z9DA 2J5VA 2JI5A 4NDOB 3TVIA 4JZ8A 1OHBA 2OGXB 3ZZGA 2BNFA 4F6TA 3C20A 4A7WA 3QVHA 3B8GA 3C1MA 2WE4A 2AKOA 2J4LA 3EK5A 3QUNA 4KZTA 3LL5A 2J4JA 2V5HA 3S6KA 2CDQA 4NDPA 4NDRB 3K4YA 3AB4A 3D2PA 2E9YA 3K56A 2BTYA 1OH9A 3WWNA 3ZZIA 4NDQA 2V4YA 2BMUA 4Q1TA 3ZZHA 2IJ9A 3WWMA 3NWYA 3K52A 3QURA 2OGXA 2BRXA 1YBDA 2R8VA 2BNEA 1OHAA 2AP9A 4USJA 3D40A 2J0WA 3QVFA 4F6TB 3S6GA 2JJXA 3L76A 2BNDA 1E19A 3K4OA 2RD5A 3EK6A 4OLCA 2HMFA 2JJ4A 2BUFA 3T7BA 4A7XA 2J4KA 4NDRA 4JZ7A 3AB2A 4NDQB 3D41A 3C1NA 4NDOA 4AXSA 3D2MA 3ZZFA 2R98A 4AB7A 3L86A 2VA1A 3KZFA 3S6HA 2W21A 3QUOA 4JZ9A 4NDPB 2J5TA 2A1FA 3U6UA 3LKKA 2WE5A 2BRIA 4I49A 2J0XA 2WXBA 1GSJA 2X2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAW A;  3LL9 A;  1GS5 A;  1B7B A;  1Z9D A;  2J5V A;  2JI5 A;  4NDO B;  3TVI A;  4JZ8 A;  1OHB A;  2OGX B;  3ZZG A;  2BNF A;  4F6T A;  3C20 A;  4A7W A;  3QVH A;  3B8G A;  3C1M A;  2WE4 A;  2AKO A;  2J4L A;  3EK5 A;  3QUN A;  4KZT A;  3LL5 A;  2J4J A;  2V5H A;  3S6K A;  2CDQ A;  4NDP A;  4NDR B;  3K4Y A;  3AB4 A;  3D2P A;  2E9Y A;  3K56 A;  2BTY A;  1OH9 A;  3WWN A;  3ZZI A;  4NDQ A;  2V4Y A;  2BMU A;  4Q1T A;  3ZZH A;  2IJ9 A;  3WWM A;  3NWY A;  3K52 A;  3QUR A;  2OGX A;  2BRX A;  1YBD A;  2R8V A;  2BNE A;  1OHA A;  2AP9 A;  4USJ A;  3D40 A;  2J0W A;  3QVF A;  4F6T B;  3S6G A;  2JJX A;  3L76 A;  2BND A;  1E19 A;  3K4O A;  2RD5 A;  3EK6 A;  4OLC A;  2HMF A;  2JJ4 A;  2BUF A;  3T7B A;  4A7X A;  2J4K A;  4NDR A;  4JZ7 A;  3AB2 A;  4NDQ B;  3D41 A;  3C1N A;  4NDO A;  4AXS A;  3D2M A;  3ZZF A;  2R98 A;  4AB7 A;  3L86 A;  2VA1 A;  3KZF A;  3S6H A;  2W21 A;  3QUO A;  4JZ9 A;  4NDP B;  2J5T A;  2A1F A;  3U6U A;  3LKK A;  2WE5 A;  2BRI A;  4I49 A;  2J0X A;  2WXB A;  1GSJ A;  2X2W A; 
#chains in the Genus database with same CATH topology
 3AAW A;  3LL9 A;  1GS5 A;  1B7B A;  1Z9D A;  2J5V A;  2JI5 A;  4NDO B;  3TVI A;  4JZ8 A;  1OHB A;  2OGX B;  3ZZG A;  2BNF A;  4F6T A;  3C20 A;  4A7W A;  3QVH A;  3B8G A;  3C1M A;  2WE4 A;  2AKO A;  2J4L A;  3EK5 A;  3QUN A;  4KZT A;  3LL5 A;  2J4J A;  2V5H A;  3S6K A;  2CDQ A;  4NDP A;  4NDR B;  3K4Y A;  3AB4 A;  3D2P A;  2E9Y A;  3K56 A;  2BTY A;  1OH9 A;  3WWN A;  3ZZI A;  4NDQ A;  2V4Y A;  2BMU A;  4Q1T A;  3ZZH A;  2IJ9 A;  3WWM A;  3NWY A;  3K52 A;  3QUR A;  2OGX A;  2BRX A;  1YBD A;  2R8V A;  2BNE A;  1OHA A;  2AP9 A;  4USJ A;  3D40 A;  2J0W A;  3QVF A;  4F6T B;  3S6G A;  2JJX A;  3L76 A;  2BND A;  1E19 A;  3K4O A;  2RD5 A;  3EK6 A;  4OLC A;  2HMF A;  2JJ4 A;  2BUF A;  3T7B A;  4A7X A;  2J4K A;  4NDR A;  4JZ7 A;  3AB2 A;  4NDQ B;  3D41 A;  3C1N A;  4NDO A;  4AXS A;  3D2M A;  3ZZF A;  2R98 A;  4AB7 A;  3L86 A;  2VA1 A;  3KZF A;  3S6H A;  2W21 A;  3QUO A;  4JZ9 A;  4NDP B;  2J5T A;  2A1F A;  3U6U A;  3LKK A;  2WE5 A;  2BRI A;  4I49 A;  2J0X A;  2WXB A;  1GSJ A;  2X2W A; 
#chains in the Genus database with same CATH homology
 3AAW A;  3LL9 A;  1GS5 A;  1B7B A;  1Z9D A;  2J5V A;  2JI5 A;  4NDO B;  3TVI A;  4JZ8 A;  1OHB A;  2OGX B;  3ZZG A;  2BNF A;  4F6T A;  3C20 A;  4A7W A;  3QVH A;  3B8G A;  3C1M A;  2WE4 A;  2AKO A;  2J4L A;  3EK5 A;  3QUN A;  4KZT A;  3LL5 A;  2J4J A;  2V5H A;  3S6K A;  2CDQ A;  4NDP A;  4NDR B;  3K4Y A;  3AB4 A;  3D2P A;  2E9Y A;  3K56 A;  2BTY A;  1OH9 A;  3WWN A;  3ZZI A;  4NDQ A;  2V4Y A;  2BMU A;  4Q1T A;  3ZZH A;  2IJ9 A;  3WWM A;  3NWY A;  3K52 A;  3QUR A;  2OGX A;  2BRX A;  1YBD A;  2R8V A;  2BNE A;  1OHA A;  2AP9 A;  4USJ A;  3D40 A;  2J0W A;  3QVF A;  4F6T B;  3S6G A;  2JJX A;  3L76 A;  2BND A;  1E19 A;  3K4O A;  2RD5 A;  3EK6 A;  4OLC A;  2HMF A;  2JJ4 A;  2BUF A;  3T7B A;  4A7X A;  2J4K A;  4NDR A;  4JZ7 A;  3AB2 A;  4NDQ B;  3D41 A;  3C1N A;  4NDO A;  4AXS A;  3D2M A;  3ZZF A;  2R98 A;  4AB7 A;  3L86 A;  2VA1 A;  3KZF A;  3S6H A;  2W21 A;  3QUO A;  4JZ9 A;  4NDP B;  2J5T A;  2A1F A;  3U6U A;  3LKK A;  2WE5 A;  2BRI A;  4I49 A;  2J0X A;  2WXB A;  1GSJ A;  2X2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...