2BMUA

Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
225
structure length
225
Chain Sequence
MRIVFDIGGSVLVPENPDIDFIKEIAYQLTKVSEDHEVAVVVGGGKLARKYIEVAEKFNSSETFKDFIGIQITRANAMLLIAALREKAYPVVVEDFWEAWKAVQLKKIPVMGGTHPGHTTDAVAALLAEFLKADLLVVITNVDGVYTADPKKDPTAKKIKKMKPEELLEIVGKGIEKAGSSSVIDPLAAKIIARSGIKTIVIGKEDAKDLFRVIKGDHNGTTIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLATE KINASE
publication title The Crystal Structure of Pyrococcus Furiosus Ump Kinase Provides Insight Into Catalysis and Regulation in Microbial Pyrimidine Nucleotide Biosynthesis.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 72
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 2bmuA00
2J5VA 2WE5A 2V5HA 3C1MA 3ZZIA 3C20A 2BNDA 2JI5A 4NDOA 4USJA 4NDPA 3KZFA 3C1NA 3L76A 2RD5A 3EK5A 3L86A 2BUFA 3D2MA 3LL5A 2A1FA 2J0WA 2AKOA 3S6GA 4JZ9A 3B8GA 2OGXB 4NDOB 4NDPB 3S6KA 3TVIA 4A7WA 4F6TA 3ZZFA 4JZ7A 2J0XA 3LKKA 1Z9DA 2IJ9A 2OGXA 1E19A 2BNFA 3K4OA 1OH9A 2J4LA 1B7BA 3K56A 3AAWA 3QVFA 3ZZGA 2X2WA 4F6TB 2R98A 2BTYA 2BNEA 2JJXA 4AB7A 3QVHA 4JZ8A 3K4YA 2V4YA 3QURA 4OLCA 2E9YA 2J4KA 2CDQA 3ZZHA 3QUNA 1GS5A 4AXSA 3K52A 4NDQA 4NDRB 4I49A 4KZTA 1OHBA 3WWMA 2J4JA 3AB4A 3LL9A 2VA1A 2J5TA 2JJ4A 2BRIA 1GSJA 2R8VA 4Q1TA 3NWYA 4NDRA 3S6HA 2W21A 2HMFA 3D41A 4NDQB 2BRXA 2WXBA 1YBDA 2AP9A 3AB2A 3D40A 3U6UA 2WE4A 1OHAA 3D2PA 2BMUA 3EK6A 4A7XA 3QUOA 3T7BA 3WWNA
chains in the Genus database with same CATH superfamily
2J5VA 2WE5A 2V5HA 3C1MA 3ZZIA 3C20A 2BNDA 2JI5A 4NDOA 4USJA 4NDPA 3KZFA 3C1NA 3L76A 2RD5A 3EK5A 3L86A 2BUFA 3D2MA 3LL5A 2A1FA 2J0WA 2AKOA 3S6GA 4JZ9A 3B8GA 2OGXB 4NDOB 4NDPB 3S6KA 3TVIA 4A7WA 4F6TA 3ZZFA 4JZ7A 2J0XA 3LKKA 1Z9DA 2IJ9A 2OGXA 1E19A 2BNFA 3K4OA 1OH9A 2J4LA 1B7BA 3K56A 3AAWA 3QVFA 3ZZGA 2X2WA 4F6TB 2R98A 2BTYA 2BNEA 2JJXA 4AB7A 3QVHA 4JZ8A 3K4YA 2V4YA 3QURA 4OLCA 2E9YA 2J4KA 2CDQA 3ZZHA 3QUNA 1GS5A 4AXSA 3K52A 4NDQA 4NDRB 4I49A 4KZTA 1OHBA 3WWMA 2J4JA 3AB4A 3LL9A 2VA1A 2J5TA 2JJ4A 2BRIA 1GSJA 2R8VA 4Q1TA 3NWYA 4NDRA 3S6HA 2W21A 2HMFA 3D41A 4NDQB 2BRXA 2WXBA 1YBDA 2AP9A 3AB2A 3D40A 3U6UA 2WE4A 1OHAA 3D2PA 2BMUA 3EK6A 4A7XA 3QUOA 3T7BA 3WWNA
chains in the Genus database with same CATH topology
2J5VA 2WE5A 2V5HA 3C1MA 3ZZIA 3C20A 2BNDA 2JI5A 4NDOA 4USJA 4NDPA 3KZFA 3C1NA 3L76A 2RD5A 3EK5A 3L86A 2BUFA 3D2MA 3LL5A 2A1FA 2J0WA 2AKOA 3S6GA 4JZ9A 3B8GA 2OGXB 4NDOB 4NDPB 3S6KA 3TVIA 4A7WA 4F6TA 3ZZFA 4JZ7A 2J0XA 3LKKA 1Z9DA 2IJ9A 2OGXA 1E19A 2BNFA 3K4OA 1OH9A 2J4LA 1B7BA 3K56A 3AAWA 3QVFA 3ZZGA 2X2WA 4F6TB 2R98A 2BTYA 2BNEA 2JJXA 4AB7A 3QVHA 4JZ8A 3K4YA 2V4YA 3QURA 4OLCA 2E9YA 2J4KA 2CDQA 3ZZHA 3QUNA 1GS5A 4AXSA 3K52A 4NDQA 4NDRB 4I49A 4KZTA 1OHBA 3WWMA 2J4JA 3AB4A 3LL9A 2VA1A 2J5TA 2JJ4A 2BRIA 1GSJA 2R8VA 4Q1TA 3NWYA 4NDRA 3S6HA 2W21A 2HMFA 3D41A 4NDQB 2BRXA 2WXBA 1YBDA 2AP9A 3AB2A 3D40A 3U6UA 2WE4A 1OHAA 3D2PA 2BMUA 3EK6A 4A7XA 3QUOA 3T7BA 3WWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5V A;  2WE5 A;  2V5H A;  3C1M A;  3ZZI A;  3C20 A;  2BND A;  2JI5 A;  4NDO A;  4USJ A;  4NDP A;  3KZF A;  3C1N A;  3L76 A;  2RD5 A;  3EK5 A;  3L86 A;  2BUF A;  3D2M A;  3LL5 A;  2A1F A;  2J0W A;  2AKO A;  3S6G A;  4JZ9 A;  3B8G A;  2OGX B;  4NDO B;  4NDP B;  3S6K A;  3TVI A;  4A7W A;  4F6T A;  3ZZF A;  4JZ7 A;  2J0X A;  3LKK A;  1Z9D A;  2IJ9 A;  2OGX A;  1E19 A;  2BNF A;  3K4O A;  1OH9 A;  2J4L A;  1B7B A;  3K56 A;  3AAW A;  3QVF A;  3ZZG A;  2X2W A;  4F6T B;  2R98 A;  2BTY A;  2BNE A;  2JJX A;  4AB7 A;  3QVH A;  4JZ8 A;  3K4Y A;  2V4Y A;  3QUR A;  4OLC A;  2E9Y A;  2J4K A;  2CDQ A;  3ZZH A;  3QUN A;  1GS5 A;  4AXS A;  3K52 A;  4NDQ A;  4NDR B;  4I49 A;  4KZT A;  1OHB A;  3WWM A;  2J4J A;  3AB4 A;  3LL9 A;  2VA1 A;  2J5T A;  2JJ4 A;  2BRI A;  1GSJ A;  2R8V A;  4Q1T A;  3NWY A;  4NDR A;  3S6H A;  2W21 A;  2HMF A;  3D41 A;  4NDQ B;  2BRX A;  2WXB A;  1YBD A;  2AP9 A;  3AB2 A;  3D40 A;  3U6U A;  2WE4 A;  1OHA A;  3D2P A;  2BMU A;  3EK6 A;  4A7X A;  3QUO A;  3T7B A;  3WWN A; 
#chains in the Genus database with same CATH topology
 2J5V A;  2WE5 A;  2V5H A;  3C1M A;  3ZZI A;  3C20 A;  2BND A;  2JI5 A;  4NDO A;  4USJ A;  4NDP A;  3KZF A;  3C1N A;  3L76 A;  2RD5 A;  3EK5 A;  3L86 A;  2BUF A;  3D2M A;  3LL5 A;  2A1F A;  2J0W A;  2AKO A;  3S6G A;  4JZ9 A;  3B8G A;  2OGX B;  4NDO B;  4NDP B;  3S6K A;  3TVI A;  4A7W A;  4F6T A;  3ZZF A;  4JZ7 A;  2J0X A;  3LKK A;  1Z9D A;  2IJ9 A;  2OGX A;  1E19 A;  2BNF A;  3K4O A;  1OH9 A;  2J4L A;  1B7B A;  3K56 A;  3AAW A;  3QVF A;  3ZZG A;  2X2W A;  4F6T B;  2R98 A;  2BTY A;  2BNE A;  2JJX A;  4AB7 A;  3QVH A;  4JZ8 A;  3K4Y A;  2V4Y A;  3QUR A;  4OLC A;  2E9Y A;  2J4K A;  2CDQ A;  3ZZH A;  3QUN A;  1GS5 A;  4AXS A;  3K52 A;  4NDQ A;  4NDR B;  4I49 A;  4KZT A;  1OHB A;  3WWM A;  2J4J A;  3AB4 A;  3LL9 A;  2VA1 A;  2J5T A;  2JJ4 A;  2BRI A;  1GSJ A;  2R8V A;  4Q1T A;  3NWY A;  4NDR A;  3S6H A;  2W21 A;  2HMF A;  3D41 A;  4NDQ B;  2BRX A;  2WXB A;  1YBD A;  2AP9 A;  3AB2 A;  3D40 A;  3U6U A;  2WE4 A;  1OHA A;  3D2P A;  2BMU A;  3EK6 A;  4A7X A;  3QUO A;  3T7B A;  3WWN A; 
#chains in the Genus database with same CATH homology
 2J5V A;  2WE5 A;  2V5H A;  3C1M A;  3ZZI A;  3C20 A;  2BND A;  2JI5 A;  4NDO A;  4USJ A;  4NDP A;  3KZF A;  3C1N A;  3L76 A;  2RD5 A;  3EK5 A;  3L86 A;  2BUF A;  3D2M A;  3LL5 A;  2A1F A;  2J0W A;  2AKO A;  3S6G A;  4JZ9 A;  3B8G A;  2OGX B;  4NDO B;  4NDP B;  3S6K A;  3TVI A;  4A7W A;  4F6T A;  3ZZF A;  4JZ7 A;  2J0X A;  3LKK A;  1Z9D A;  2IJ9 A;  2OGX A;  1E19 A;  2BNF A;  3K4O A;  1OH9 A;  2J4L A;  1B7B A;  3K56 A;  3AAW A;  3QVF A;  3ZZG A;  2X2W A;  4F6T B;  2R98 A;  2BTY A;  2BNE A;  2JJX A;  4AB7 A;  3QVH A;  4JZ8 A;  3K4Y A;  2V4Y A;  3QUR A;  4OLC A;  2E9Y A;  2J4K A;  2CDQ A;  3ZZH A;  3QUN A;  1GS5 A;  4AXS A;  3K52 A;  4NDQ A;  4NDR B;  4I49 A;  4KZT A;  1OHB A;  3WWM A;  2J4J A;  3AB4 A;  3LL9 A;  2VA1 A;  2J5T A;  2JJ4 A;  2BRI A;  1GSJ A;  2R8V A;  4Q1T A;  3NWY A;  4NDR A;  3S6H A;  2W21 A;  2HMF A;  3D41 A;  4NDQ B;  2BRX A;  2WXB A;  1YBD A;  2AP9 A;  3AB2 A;  3D40 A;  3U6U A;  2WE4 A;  1OHA A;  3D2P A;  2BMU A;  3EK6 A;  4A7X A;  3QUO A;  3T7B A;  3WWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...