3HH1A

The structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
AHKGTLYVVATPLGNLDDMTFRAVNTLRNAGAIACEDTRRTSILLKHFGIEGKRLVSYHSFNEERAVRQVIELLEEGSDVALVTDAGTPAISDPGYTMASAAHAAGLPVVPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Tetrapyrrole methylase family protein domain from Chlorobium tepidum TLS.
rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
molecule keywords Tetrapyrrole methylase family protein
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3hh1A00
2OWGA 2PB6A 2P5FA 1WDEA 2DV5A 3KWPA 2E0NA 2EMUA 2YBOA 2Z6RA 2OWVA 2YBQA 2ELDA 2DEKA 2EL0A 1PJTA 2DXWA 2EL3A 2HUVA 2EK2A 1VHVA 1S4DA 2OWFA 2ENIA 2E4RA 2EH2A 1VCEA 2ED5A 2HR8A 5HW4A 2OWUA 2E16A 2EGBA 2EL1A 1V9AA 2DXVA 2EMRA 2P6LA 2ZVCA 2DV4A 4E16A 2EK4A 2EGLA 2OWKA 2QBUA 2PCMA 1WNGA 2DSIA 2HUXA 3ND1A 2PCGA 2DV3A 2PCKA 2EHCA 3I4TA 2BB3A 2E15A 2P5CA 2EH4A 2P2XA 2E07A 1PJQA 2PCAA 3NUTA 2P6KA 1CBFA 2E8HA 2PB4A 3HH1A 2DXXA 2E7RA 2DV7A 2HUQA 2EK7A 2EJZA 2E8QA 2E0KA 2EEQA 2DSHA 2P6DA 2E8RA 2P9DA 2EHLA 2EK3A 1VE2A 2EKAA 2EH5A 2E4NA 2P6IA 2E8SA 2PCHA 2NPNA 2E17A 2PB5A 1WYZA 2DSGA 2EJKA 2ED3A 2HUTA 2E08A 1PJSA 2EN5A 2EJJA 2ELEA 2CBFA 3NEIA 2ZVBA 2EGSA 1VA0A 2PCIA 3NDCA 2EL2A
chains in the Genus database with same CATH superfamily
2OWGA 2PB6A 2P5FA 1WDEA 2DV5A 3KWPA 2E0NA 2EMUA 2YBOA 2Z6RA 2OWVA 2YBQA 2ELDA 4MV0A 2DEKA 2EL0A 1PJTA 2DXWA 4H4DA 3UTDA 3T0GA 2EL3A 2HUVA 2EK2A 1VHVA 1S4DA 2OWFA 2ENIA 3UTCA 2E4RA 2EH2A 1VCEA 2ED5A 2HR8A 3DNFA 3TIXB 5HW4A 2OWUA 2E16A 2EGBA 2EL1A 1V9AA 2DXVA 2EMRA 2P6LA 2ZVCA 3UV7A 2DV4A 3UV3A 4E16A 2EK4A 2EGLA 2OWKA 4H4EA 2QBUA 2PCMA 1WNGA 2DSIA 2HUXA 3KEMA 4N7BA 3ND1A 4MV5A 2PCGA 2DV3A 2PCKA 2EHCA 3I4TA 2BB3A 3KE9A 2E15A 2P5CA 2EH4A 3URKA 2P2XA 2E07A 3KELA 1PJQA 3SZOA 2PCAA 3NUTA 2P6KA 3SZLA 1CBFA 2E8HA 2PB4A 3ZGNA 3KE8A 3HH1A 2DXXA 2E7RA 2DV7A 2HUQA 3UWMA 3F7TA 2EK7A 2EJZA 2E8QA 2E0KA 2EEQA 2DSHA 2P6DA 2E8RA 2P9DA 2EHLA 2EK3A 1VE2A 2EKAA 3SZUA 2EH5A 2E4NA 2P6IA 2E8SA 2PCHA 2NPNA 2E17A 2PB5A 1WYZA 2DSGA 2EJKA 3T0FA 2ED3A 2HUTA 4MUXA 4EB3A 2E08A 1PJSA 2EN5A 2EJJA 3ZGLA 2ELEA 2CBFA 3NEIA 3KEFA 2ZVBA 4H4CA 3UV6A 2EGSA 1VA0A 2PCIA 4MUYA 3NDCA 2EL2A
chains in the Genus database with same CATH topology
2OWGA 2PB6A 2P5FA 1WDEA 2DV5A 3KWPA 2E0NA 2EMUA 2YBOA 2Z6RA 2OWVA 2YBQA 2ELDA 4MV0A 2DEKA 2EL0A 1PJTA 2DXWA 4H4DA 3UTDA 3T0GA 2EL3A 2HUVA 2EK2A 1VHVA 1S4DA 2OWFA 2ENIA 3UTCA 2E4RA 2EH2A 1VCEA 2ED5A 2HR8A 3DNFA 3TIXB 5HW4A 2OWUA 2E16A 2EGBA 2EL1A 1V9AA 2DXVA 2EMRA 2P6LA 2ZVCA 3UV7A 2DV4A 3UV3A 4E16A 2EK4A 2EGLA 2OWKA 4H4EA 2QBUA 2PCMA 1WNGA 2DSIA 2HUXA 3KEMA 4N7BA 3ND1A 4MV5A 2PCGA 2DV3A 2PCKA 2EHCA 3I4TA 2BB3A 3KE9A 2E15A 2P5CA 2EH4A 3URKA 2P2XA 2E07A 3KELA 1PJQA 3SZOA 2PCAA 3NUTA 2P6KA 3SZLA 1CBFA 2E8HA 2PB4A 3ZGNA 3KE8A 3HH1A 2DXXA 2E7RA 2DV7A 2HUQA 3UWMA 3F7TA 2EK7A 2EJZA 2E8QA 2E0KA 2EEQA 2DSHA 2P6DA 2E8RA 2P9DA 2EHLA 2EK3A 1VE2A 2EKAA 3SZUA 2EH5A 2E4NA 2P6IA 2E8SA 2PCHA 2NPNA 2E17A 2PB5A 1WYZA 2DSGA 2EJKA 3T0FA 2ED3A 2HUTA 4MUXA 4EB3A 2E08A 1PJSA 2EN5A 2EJJA 3ZGLA 2ELEA 2CBFA 3NEIA 3KEFA 2ZVBA 4H4CA 3UV6A 2EGSA 1VA0A 2PCIA 4MUYA 3NDCA 2EL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWG A;  2PB6 A;  2P5F A;  1WDE A;  2DV5 A;  3KWP A;  2E0N A;  2EMU A;  2YBO A;  2Z6R A;  2OWV A;  2YBQ A;  2ELD A;  2DEK A;  2EL0 A;  1PJT A;  2DXW A;  2EL3 A;  2HUV A;  2EK2 A;  1VHV A;  1S4D A;  2OWF A;  2ENI A;  2E4R A;  2EH2 A;  1VCE A;  2ED5 A;  2HR8 A;  5HW4 A;  2OWU A;  2E16 A;  2EGB A;  2EL1 A;  1V9A A;  2DXV A;  2EMR A;  2P6L A;  2ZVC A;  2DV4 A;  4E16 A;  2EK4 A;  2EGL A;  2OWK A;  2QBU A;  2PCM A;  1WNG A;  2DSI A;  2HUX A;  3ND1 A;  2PCG A;  2DV3 A;  2PCK A;  2EHC A;  3I4T A;  2BB3 A;  2E15 A;  2P5C A;  2EH4 A;  2P2X A;  2E07 A;  1PJQ A;  2PCA A;  3NUT A;  2P6K A;  1CBF A;  2E8H A;  2PB4 A;  3HH1 A;  2DXX A;  2E7R A;  2DV7 A;  2HUQ A;  2EK7 A;  2EJZ A;  2E8Q A;  2E0K A;  2EEQ A;  2DSH A;  2P6D A;  2E8R A;  2P9D A;  2EHL A;  2EK3 A;  1VE2 A;  2EKA A;  2EH5 A;  2E4N A;  2P6I A;  2E8S A;  2PCH A;  2NPN A;  2E17 A;  2PB5 A;  1WYZ A;  2DSG A;  2EJK A;  2ED3 A;  2HUT A;  2E08 A;  1PJS A;  2EN5 A;  2EJJ A;  2ELE A;  2CBF A;  3NEI A;  2ZVB A;  2EGS A;  1VA0 A;  2PCI A;  3NDC A;  2EL2 A; 
#chains in the Genus database with same CATH topology
 2OWG A;  2PB6 A;  2P5F A;  1WDE A;  2DV5 A;  3KWP A;  2E0N A;  2EMU A;  2YBO A;  2Z6R A;  2OWV A;  2YBQ A;  2ELD A;  4MV0 A;  2DEK A;  2EL0 A;  1PJT A;  2DXW A;  4H4D A;  3UTD A;  3T0G A;  2EL3 A;  2HUV A;  2EK2 A;  1VHV A;  1S4D A;  2OWF A;  2ENI A;  3UTC A;  2E4R A;  2EH2 A;  1VCE A;  2ED5 A;  2HR8 A;  3DNF A;  3TIX B;  5HW4 A;  2OWU A;  2E16 A;  2EGB A;  2EL1 A;  1V9A A;  2DXV A;  2EMR A;  2P6L A;  2ZVC A;  3UV7 A;  2DV4 A;  3UV3 A;  4E16 A;  2EK4 A;  2EGL A;  2OWK A;  4H4E A;  2QBU A;  2PCM A;  1WNG A;  2DSI A;  2HUX A;  3KEM A;  4N7B A;  3ND1 A;  4MV5 A;  2PCG A;  2DV3 A;  2PCK A;  2EHC A;  3I4T A;  2BB3 A;  3KE9 A;  2E15 A;  2P5C A;  2EH4 A;  3URK A;  2P2X A;  2E07 A;  3KEL A;  1PJQ A;  3SZO A;  2PCA A;  3NUT A;  2P6K A;  3SZL A;  1CBF A;  2E8H A;  2PB4 A;  3ZGN A;  3KE8 A;  3HH1 A;  2DXX A;  2E7R A;  2DV7 A;  2HUQ A;  3UWM A;  3F7T A;  2EK7 A;  2EJZ A;  2E8Q A;  2E0K A;  2EEQ A;  2DSH A;  2P6D A;  2E8R A;  2P9D A;  2EHL A;  2EK3 A;  1VE2 A;  2EKA A;  3SZU A;  2EH5 A;  2E4N A;  2P6I A;  2E8S A;  2PCH A;  2NPN A;  2E17 A;  2PB5 A;  1WYZ A;  2DSG A;  2EJK A;  3T0F A;  2ED3 A;  2HUT A;  4MUX A;  4EB3 A;  2E08 A;  1PJS A;  2EN5 A;  2EJJ A;  3ZGL A;  2ELE A;  2CBF A;  3NEI A;  3KEF A;  2ZVB A;  4H4C A;  3UV6 A;  2EGS A;  1VA0 A;  2PCI A;  4MUY A;  3NDC A;  2EL2 A; 
#chains in the Genus database with same CATH homology
 2OWG A;  2PB6 A;  2P5F A;  1WDE A;  2DV5 A;  3KWP A;  2E0N A;  2EMU A;  2YBO A;  2Z6R A;  2OWV A;  2YBQ A;  2ELD A;  4MV0 A;  2DEK A;  2EL0 A;  1PJT A;  2DXW A;  4H4D A;  3UTD A;  3T0G A;  2EL3 A;  2HUV A;  2EK2 A;  1VHV A;  1S4D A;  2OWF A;  2ENI A;  3UTC A;  2E4R A;  2EH2 A;  1VCE A;  2ED5 A;  2HR8 A;  3DNF A;  3TIX B;  5HW4 A;  2OWU A;  2E16 A;  2EGB A;  2EL1 A;  1V9A A;  2DXV A;  2EMR A;  2P6L A;  2ZVC A;  3UV7 A;  2DV4 A;  3UV3 A;  4E16 A;  2EK4 A;  2EGL A;  2OWK A;  4H4E A;  2QBU A;  2PCM A;  1WNG A;  2DSI A;  2HUX A;  3KEM A;  4N7B A;  3ND1 A;  4MV5 A;  2PCG A;  2DV3 A;  2PCK A;  2EHC A;  3I4T A;  2BB3 A;  3KE9 A;  2E15 A;  2P5C A;  2EH4 A;  3URK A;  2P2X A;  2E07 A;  3KEL A;  1PJQ A;  3SZO A;  2PCA A;  3NUT A;  2P6K A;  3SZL A;  1CBF A;  2E8H A;  2PB4 A;  3ZGN A;  3KE8 A;  3HH1 A;  2DXX A;  2E7R A;  2DV7 A;  2HUQ A;  3UWM A;  3F7T A;  2EK7 A;  2EJZ A;  2E8Q A;  2E0K A;  2EEQ A;  2DSH A;  2P6D A;  2E8R A;  2P9D A;  2EHL A;  2EK3 A;  1VE2 A;  2EKA A;  3SZU A;  2EH5 A;  2E4N A;  2P6I A;  2E8S A;  2PCH A;  2NPN A;  2E17 A;  2PB5 A;  1WYZ A;  2DSG A;  2EJK A;  3T0F A;  2ED3 A;  2HUT A;  4MUX A;  4EB3 A;  2E08 A;  1PJS A;  2EN5 A;  2EJJ A;  3ZGL A;  2ELE A;  2CBF A;  3NEI A;  3KEF A;  2ZVB A;  4H4C A;  3UV6 A;  2EGS A;  1VA0 A;  2PCI A;  4MUY A;  3NDC A;  2EL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...