3HH1A

The structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
113
structure length
113
Chain Sequence
b'AHKGTLYVVATPLGNLDDMTFRAVNTLRNAGAIACEDTRRTSILLKHFGIEGKRLVSYHSFNEERAVRQVIELLEEGSDVALVTDAGTPAISDPGYTMASAAHAAGLPVVPVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrapyrrole methylase family protein
publication title The Structure of a Tetrapyrrole methylase family protein domain from Chlorobium tepidum TLS.
rcsb
source organism Chlorobaculum tepidum
molecule tags Transferase
total genus 38
structure length 113
sequence length 113
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3hh1A00
3I4TA 3HH1A 2E0NA 2E17A 2E08A 2EH5A 2OWFA 2E4NA 1PJSA 2EL1A 2EGBA 2PB4A 2EMUA 2E16A 1PJQA 2E15A 2P6DA 2ENIA 2EK2A 5HW4A 2CBFA 2ELEA 4E16A 2PCAA 2DXXA 2YBQA 2ZVCA 1VCEA 2EHCA 2ED5A 2OWUA 2PCIA 3ND1A 1V9AA 2Z6RA 2P6IA 1VE2A 2EH2A 1WNGA 2P2XA 2EEQA 2EK7A 1CBFA 2HUTA 2DV4A 2E0KA 1VHVA 1WDEA 1PJTA 2HUVA 2EL3A 2P5CA 2EL0A 2E4RA 2EJJA 1VA0A 2ED3A 2E8SA 2OWKA 2DSHA 2EGSA 2ELDA 2EH4A 2EJKA 2DSGA 2PCMA 2EGLA 2HUQA 2PCHA 2OWGA 2P6LA 2HR8A 2PCGA 2EN5A 2ZVBA 3NEIA 3NUTA 2EKAA 1WYZA 2DV3A 2DEKA 2EK4A 2EHLA 2OWVA 2P9DA 2EMRA 2P6KA 3KWPA 2PB5A 2DXVA 2PB6A 2PCKA 2BB3A 2EL2A 2NPNA 2HUXA 2E8QA 1S4DA 2DV7A 2DXWA 2QBUA 2E8RA 2EJZA 2P5FA 2DV5A 2YBOA 3NDCA 2EK3A 2E07A 2DSIA 2E7RA 2E8HA
chains in the Genus database with same CATH superfamily
3I4TA 3HH1A 2E0NA 2E17A 3ZGLA 2E08A 2EH5A 3KEFA 3T0GA 4H4DA 3UV7A 3ZGNA 2OWFA 3SZUA 4MUXA 2E4NA 1PJSA 2EL1A 2EGBA 2PB4A 2EMUA 2E16A 1PJQA 2E15A 2P6DA 2ENIA 3URKA 2EK2A 5HW4A 2CBFA 2ELEA 4E16A 2PCAA 2DXXA 3T0FA 2YBQA 3DNFA 2ZVCA 4H4EA 1VCEA 3UWMA 2EHCA 2ED5A 3KELA 2OWUA 2PCIA 3ND1A 4MV5A 3UTDA 3UV3A 1V9AA 2Z6RA 3UV6A 2P6IA 1VE2A 3UTCA 2EH2A 1WNGA 3KE9A 2P2XA 2EEQA 2EK7A 1CBFA 2HUTA 2DV4A 2E0KA 1VHVA 1WDEA 1PJTA 2HUVA 2EL3A 3KEMA 2P5CA 2EL0A 2E4RA 2EJJA 1VA0A 2ED3A 4H4CA 2E8SA 2OWKA 2DSHA 2EGSA 3TIXB 2ELDA 2EH4A 2EJKA 2DSGA 2PCMA 2EGLA 2HUQA 2PCHA 4EB3A 2OWGA 2P6LA 2HR8A 2PCGA 2EN5A 2ZVBA 3NEIA 3NUTA 2EKAA 3SZLA 1WYZA 2DV3A 2DEKA 2EK4A 2EHLA 2OWVA 2P9DA 2EMRA 2P6KA 3KWPA 4MV0A 2PB5A 2DXVA 2PB6A 2PCKA 2BB3A 2EL2A 2NPNA 2HUXA 3KE8A 2E8QA 4N7BA 1S4DA 2DV7A 2DXWA 2QBUA 2E8RA 2EJZA 2P5FA 2DV5A 2YBOA 3NDCA 2EK3A 2E07A 2DSIA 3F7TA 2E7RA 2E8HA 4MUYA 3SZOA
chains in the Genus database with same CATH topology
3I4TA 3HH1A 2E0NA 2E17A 3ZGLA 2E08A 2EH5A 3KEFA 3T0GA 4H4DA 3UV7A 3ZGNA 2OWFA 3SZUA 4MUXA 2E4NA 1PJSA 2EL1A 2EGBA 2PB4A 2EMUA 2E16A 1PJQA 2E15A 2P6DA 2ENIA 3URKA 2EK2A 5HW4A 2CBFA 2ELEA 4E16A 2PCAA 2DXXA 3T0FA 2YBQA 3DNFA 2ZVCA 4H4EA 1VCEA 3UWMA 2EHCA 2ED5A 3KELA 2OWUA 2PCIA 3ND1A 4MV5A 3UTDA 3UV3A 1V9AA 2Z6RA 3UV6A 2P6IA 1VE2A 3UTCA 2EH2A 1WNGA 3KE9A 2P2XA 2EEQA 2EK7A 1CBFA 2HUTA 2DV4A 2E0KA 1VHVA 1WDEA 1PJTA 2HUVA 2EL3A 3KEMA 2P5CA 2EL0A 2E4RA 2EJJA 1VA0A 2ED3A 4H4CA 2E8SA 2OWKA 2DSHA 2EGSA 3TIXB 2ELDA 2EH4A 2EJKA 2DSGA 2PCMA 2EGLA 2HUQA 2PCHA 4EB3A 2OWGA 2P6LA 2HR8A 2PCGA 2EN5A 2ZVBA 3NEIA 3NUTA 2EKAA 3SZLA 1WYZA 2DV3A 2DEKA 2EK4A 2EHLA 2OWVA 2P9DA 2EMRA 2P6KA 3KWPA 4MV0A 2PB5A 2DXVA 2PB6A 2PCKA 2BB3A 2EL2A 2NPNA 2HUXA 3KE8A 2E8QA 4N7BA 1S4DA 2DV7A 2DXWA 2QBUA 2E8RA 2EJZA 2P5FA 2DV5A 2YBOA 3NDCA 2EK3A 2E07A 2DSIA 3F7TA 2E7RA 2E8HA 4MUYA 3SZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4T A;  3HH1 A;  2E0N A;  2E17 A;  2E08 A;  2EH5 A;  2OWF A;  2E4N A;  1PJS A;  2EL1 A;  2EGB A;  2PB4 A;  2EMU A;  2E16 A;  1PJQ A;  2E15 A;  2P6D A;  2ENI A;  2EK2 A;  5HW4 A;  2CBF A;  2ELE A;  4E16 A;  2PCA A;  2DXX A;  2YBQ A;  2ZVC A;  1VCE A;  2EHC A;  2ED5 A;  2OWU A;  2PCI A;  3ND1 A;  1V9A A;  2Z6R A;  2P6I A;  1VE2 A;  2EH2 A;  1WNG A;  2P2X A;  2EEQ A;  2EK7 A;  1CBF A;  2HUT A;  2DV4 A;  2E0K A;  1VHV A;  1WDE A;  1PJT A;  2HUV A;  2EL3 A;  2P5C A;  2EL0 A;  2E4R A;  2EJJ A;  1VA0 A;  2ED3 A;  2E8S A;  2OWK A;  2DSH A;  2EGS A;  2ELD A;  2EH4 A;  2EJK A;  2DSG A;  2PCM A;  2EGL A;  2HUQ A;  2PCH A;  2OWG A;  2P6L A;  2HR8 A;  2PCG A;  2EN5 A;  2ZVB A;  3NEI A;  3NUT A;  2EKA A;  1WYZ A;  2DV3 A;  2DEK A;  2EK4 A;  2EHL A;  2OWV A;  2P9D A;  2EMR A;  2P6K A;  3KWP A;  2PB5 A;  2DXV A;  2PB6 A;  2PCK A;  2BB3 A;  2EL2 A;  2NPN A;  2HUX A;  2E8Q A;  1S4D A;  2DV7 A;  2DXW A;  2QBU A;  2E8R A;  2EJZ A;  2P5F A;  2DV5 A;  2YBO A;  3NDC A;  2EK3 A;  2E07 A;  2DSI A;  2E7R A;  2E8H A; 
#chains in the Genus database with same CATH topology
 3I4T A;  3HH1 A;  2E0N A;  2E17 A;  3ZGL A;  2E08 A;  2EH5 A;  3KEF A;  3T0G A;  4H4D A;  3UV7 A;  3ZGN A;  2OWF A;  3SZU A;  4MUX A;  2E4N A;  1PJS A;  2EL1 A;  2EGB A;  2PB4 A;  2EMU A;  2E16 A;  1PJQ A;  2E15 A;  2P6D A;  2ENI A;  3URK A;  2EK2 A;  5HW4 A;  2CBF A;  2ELE A;  4E16 A;  2PCA A;  2DXX A;  3T0F A;  2YBQ A;  3DNF A;  2ZVC A;  4H4E A;  1VCE A;  3UWM A;  2EHC A;  2ED5 A;  3KEL A;  2OWU A;  2PCI A;  3ND1 A;  4MV5 A;  3UTD A;  3UV3 A;  1V9A A;  2Z6R A;  3UV6 A;  2P6I A;  1VE2 A;  3UTC A;  2EH2 A;  1WNG A;  3KE9 A;  2P2X A;  2EEQ A;  2EK7 A;  1CBF A;  2HUT A;  2DV4 A;  2E0K A;  1VHV A;  1WDE A;  1PJT A;  2HUV A;  2EL3 A;  3KEM A;  2P5C A;  2EL0 A;  2E4R A;  2EJJ A;  1VA0 A;  2ED3 A;  4H4C A;  2E8S A;  2OWK A;  2DSH A;  2EGS A;  3TIX B;  2ELD A;  2EH4 A;  2EJK A;  2DSG A;  2PCM A;  2EGL A;  2HUQ A;  2PCH A;  4EB3 A;  2OWG A;  2P6L A;  2HR8 A;  2PCG A;  2EN5 A;  2ZVB A;  3NEI A;  3NUT A;  2EKA A;  3SZL A;  1WYZ A;  2DV3 A;  2DEK A;  2EK4 A;  2EHL A;  2OWV A;  2P9D A;  2EMR A;  2P6K A;  3KWP A;  4MV0 A;  2PB5 A;  2DXV A;  2PB6 A;  2PCK A;  2BB3 A;  2EL2 A;  2NPN A;  2HUX A;  3KE8 A;  2E8Q A;  4N7B A;  1S4D A;  2DV7 A;  2DXW A;  2QBU A;  2E8R A;  2EJZ A;  2P5F A;  2DV5 A;  2YBO A;  3NDC A;  2EK3 A;  2E07 A;  2DSI A;  3F7T A;  2E7R A;  2E8H A;  4MUY A;  3SZO A; 
#chains in the Genus database with same CATH homology
 3I4T A;  3HH1 A;  2E0N A;  2E17 A;  3ZGL A;  2E08 A;  2EH5 A;  3KEF A;  3T0G A;  4H4D A;  3UV7 A;  3ZGN A;  2OWF A;  3SZU A;  4MUX A;  2E4N A;  1PJS A;  2EL1 A;  2EGB A;  2PB4 A;  2EMU A;  2E16 A;  1PJQ A;  2E15 A;  2P6D A;  2ENI A;  3URK A;  2EK2 A;  5HW4 A;  2CBF A;  2ELE A;  4E16 A;  2PCA A;  2DXX A;  3T0F A;  2YBQ A;  3DNF A;  2ZVC A;  4H4E A;  1VCE A;  3UWM A;  2EHC A;  2ED5 A;  3KEL A;  2OWU A;  2PCI A;  3ND1 A;  4MV5 A;  3UTD A;  3UV3 A;  1V9A A;  2Z6R A;  3UV6 A;  2P6I A;  1VE2 A;  3UTC A;  2EH2 A;  1WNG A;  3KE9 A;  2P2X A;  2EEQ A;  2EK7 A;  1CBF A;  2HUT A;  2DV4 A;  2E0K A;  1VHV A;  1WDE A;  1PJT A;  2HUV A;  2EL3 A;  3KEM A;  2P5C A;  2EL0 A;  2E4R A;  2EJJ A;  1VA0 A;  2ED3 A;  4H4C A;  2E8S A;  2OWK A;  2DSH A;  2EGS A;  3TIX B;  2ELD A;  2EH4 A;  2EJK A;  2DSG A;  2PCM A;  2EGL A;  2HUQ A;  2PCH A;  4EB3 A;  2OWG A;  2P6L A;  2HR8 A;  2PCG A;  2EN5 A;  2ZVB A;  3NEI A;  3NUT A;  2EKA A;  3SZL A;  1WYZ A;  2DV3 A;  2DEK A;  2EK4 A;  2EHL A;  2OWV A;  2P9D A;  2EMR A;  2P6K A;  3KWP A;  4MV0 A;  2PB5 A;  2DXV A;  2PB6 A;  2PCK A;  2BB3 A;  2EL2 A;  2NPN A;  2HUX A;  3KE8 A;  2E8Q A;  4N7B A;  1S4D A;  2DV7 A;  2DXW A;  2QBU A;  2E8R A;  2EJZ A;  2P5F A;  2DV5 A;  2YBO A;  3NDC A;  2EK3 A;  2E07 A;  2DSI A;  3F7T A;  2E7R A;  2E8H A;  4MUY A;  3SZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...