1VE2A

Crystal structure of uroporphyrin-iii-c-methyltransferase from thermus thermophilus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
235
structure length
222
Chain Sequence
MRGKVYLVGAGFGGPEHLTLKALRVLEVAEVVLHDRLVHPGVLALAKGELVPVKTPQEAITARLIALAREGRVVARLKGGDPMVFGRGGEEALALRRAGIPFEVVPGVTSAVGALSALGLPLTHRGLARSFAVATGHDPALPLPRADTLVLLMGLKERLLERFPPETPLALLARVGWPGEAVRLGRVEDLPGLGEGLPSPALLVVGKVVGLYGELLPKDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uroporphyrin-III-C-Methyltrans from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Uroporphyrin-III C-methyltransferase
total genus 59
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1ve2A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1ve2A01
2DV7A 2EK4A 2P6LA 2E4RA 2EN5A 3HH1A 2E16A 2EGBA 1CBFA 2EL0A 2DV3A 2P5FA 1PJTA 1V9AA 2QBUA 2NPNA 2PB4A 3ND1A 2EH5A 1VA0A 2P6KA 2ELEA 2E17A 2E8HA 2ED5A 2P6DA 2P5CA 2EMUA 2P2XA 2ENIA 2DXWA 2E0KA 2EJJA 1WDEA 2EL3A 3NDCA 2HUQA 2PCIA 2EJZA 2PCGA 2YBOA 2DSHA 2DEKA 1WYZA 2E7RA 1VE2A 2E8RA 2PCKA 1PJSA 2EK2A 2HUVA 2PCAA 2DV4A 2EKAA 2BB3A 3KWPA 2E8SA 2E15A 2EGSA 2ZVBA 2OWKA 2E08A 2HUTA 2PCMA 1WNGA 2EGLA 2EL2A 2E07A 2HR8A 2HUXA 2EHLA 2ZVCA 2E0NA 2OWFA 2PB5A 3FQ6A 2EH4A 2OWUA 4E16A 2ED3A 1PJQA 1VCEA 3NUTA 3NEIA 1VHVA 2ELDA 2YBQA 2DV5A 3I4TA 2E8QA 2EL1A 2EH2A 2P6IA 2Z6RA 2EEQA 2EK7A 2EK3A 2DSIA 2PCHA 2CBFA 2EHCA 1S4DA 3FFYA 2EJKA 2DXXA 5HW4A 2EMRA 2OWVA 2PB6A 2P9DA 2OWGA 2DXVA 2DSGA 2E4NA
chains in the Genus database with same CATH superfamily
2DV7A 2EK4A 2P6LA 2E4RA 2EN5A 3HH1A 2E16A 2EGBA 1CBFA 2EL0A 2DV3A 2P5FA 1PJTA 1V9AA 2QBUA 4MUXA 2NPNA 2PB4A 3ND1A 2EH5A 1VA0A 3ZGNA 3UV3A 2P6KA 2ELEA 2E17A 2E8HA 2ED5A 2P6DA 2P5CA 2EMUA 2P2XA 2ENIA 2DXWA 2E0KA 2EJJA 3LMMA 1WDEA 4H4DA 3T0GA 2EL3A 3NDCA 2HUQA 2PCIA 2EJZA 2PCGA 2YBOA 3UV6A 3SZLA 2DSHA 2DEKA 1WYZA 3T0FA 4H4EA 3F7TA 2E7RA 4MUYA 1VE2A 2E8RA 2PCKA 4N7BA 3KE9A 1PJSA 3SZUA 4MV0A 2EK2A 2HUVA 3KEMA 2KYYA 2PCAA 3TIXB 3URKA 2DV4A 2EKAA 2BB3A 3KWPA 2E8SA 3DNFA 2E15A 2EGSA 2ZVBA 3UTDA 2OWKA 2E08A 2HUTA 2PCMA 1WNGA 2EGLA 3KEFA 2EL2A 2E07A 3KELA 4EB3A 2HR8A 2HUXA 2EHLA 2ZVCA 2E0NA 2OWFA 2PB5A 3KE8A 3FQ6A 3UWMA 2EH4A 2OWUA 4MV5A 4E16A 2ED3A 1PJQA 1VCEA 3NUTA 3SZOA 3NEIA 1VHVA 2ELDA 3UTCA 2YBQA 2DV5A 3I4TA 2E8QA 2EL1A 3ZGLA 2EH2A 4H4CA 2P6IA 2Z6RA 2EEQA 2EK7A 2EK3A 2DSIA 2PCHA 3UV7A 2CBFA 2EHCA 1S4DA 3FFYA 2EJKA 2DXXA 5HW4A 2EMRA 2OWVA 2PB6A 2P9DA 2OWGA 2DXVA 2DSGA 2E4NA
chains in the Genus database with same CATH topology
2DV7A 2EK4A 2P6LA 2E4RA 2EN5A 3HH1A 2E16A 2EGBA 1CBFA 2EL0A 2DV3A 2P5FA 1PJTA 1V9AA 2QBUA 4MUXA 2NPNA 2PB4A 3ND1A 2EH5A 1VA0A 3ZGNA 3UV3A 2P6KA 2ELEA 2E17A 2E8HA 2ED5A 2P6DA 2P5CA 2EMUA 2P2XA 2ENIA 2DXWA 2E0KA 2EJJA 3LMMA 1WDEA 4H4DA 3T0GA 2EL3A 3NDCA 2HUQA 2PCIA 2EJZA 2PCGA 2YBOA 3UV6A 3SZLA 2DSHA 2DEKA 1WYZA 3T0FA 4H4EA 3F7TA 2E7RA 4MUYA 1VE2A 2E8RA 2PCKA 4N7BA 3KE9A 1PJSA 3SZUA 4MV0A 2EK2A 2HUVA 3KEMA 2KYYA 2PCAA 3TIXB 3URKA 2DV4A 2EKAA 2BB3A 3KWPA 2E8SA 3DNFA 2E15A 2EGSA 2ZVBA 3UTDA 2OWKA 2E08A 2HUTA 2PCMA 1WNGA 2EGLA 3KEFA 2EL2A 2E07A 3KELA 4EB3A 2HR8A 2HUXA 2EHLA 2ZVCA 2E0NA 2OWFA 2PB5A 3KE8A 3FQ6A 3UWMA 2EH4A 2OWUA 4MV5A 4E16A 2ED3A 1PJQA 1VCEA 3NUTA 3SZOA 3NEIA 1VHVA 2ELDA 3UTCA 2YBQA 2DV5A 3I4TA 2E8QA 2EL1A 3ZGLA 2EH2A 4H4CA 2P6IA 2Z6RA 2EEQA 2EK7A 2EK3A 2DSIA 2PCHA 3UV7A 2CBFA 2EHCA 1S4DA 3FFYA 2EJKA 2DXXA 5HW4A 2EMRA 2OWVA 2PB6A 2P9DA 2OWGA 2DXVA 2DSGA 2E4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DV7 A;  2EK4 A;  2P6L A;  2E4R A;  2EN5 A;  3HH1 A;  2E16 A;  2EGB A;  1CBF A;  2EL0 A;  2DV3 A;  2P5F A;  1PJT A;  1V9A A;  2QBU A;  2NPN A;  2PB4 A;  3ND1 A;  2EH5 A;  1VA0 A;  2P6K A;  2ELE A;  2E17 A;  2E8H A;  2ED5 A;  2P6D A;  2P5C A;  2EMU A;  2P2X A;  2ENI A;  2DXW A;  2E0K A;  2EJJ A;  1WDE A;  2EL3 A;  3NDC A;  2HUQ A;  2PCI A;  2EJZ A;  2PCG A;  2YBO A;  2DSH A;  2DEK A;  1WYZ A;  2E7R A;  1VE2 A;  2E8R A;  2PCK A;  1PJS A;  2EK2 A;  2HUV A;  2PCA A;  2DV4 A;  2EKA A;  2BB3 A;  3KWP A;  2E8S A;  2E15 A;  2EGS A;  2ZVB A;  2OWK A;  2E08 A;  2HUT A;  2PCM A;  1WNG A;  2EGL A;  2EL2 A;  2E07 A;  2HR8 A;  2HUX A;  2EHL A;  2ZVC A;  2E0N A;  2OWF A;  2PB5 A;  3FQ6 A;  2EH4 A;  2OWU A;  4E16 A;  2ED3 A;  1PJQ A;  1VCE A;  3NUT A;  3NEI A;  1VHV A;  2ELD A;  2YBQ A;  2DV5 A;  3I4T A;  2E8Q A;  2EL1 A;  2EH2 A;  2P6I A;  2Z6R A;  2EEQ A;  2EK7 A;  2EK3 A;  2DSI A;  2PCH A;  2CBF A;  2EHC A;  1S4D A;  3FFY A;  2EJK A;  2DXX A;  5HW4 A;  2EMR A;  2OWV A;  2PB6 A;  2P9D A;  2OWG A;  2DXV A;  2DSG A;  2E4N A; 
#chains in the Genus database with same CATH topology
 2DV7 A;  2EK4 A;  2P6L A;  2E4R A;  2EN5 A;  3HH1 A;  2E16 A;  2EGB A;  1CBF A;  2EL0 A;  2DV3 A;  2P5F A;  1PJT A;  1V9A A;  2QBU A;  4MUX A;  2NPN A;  2PB4 A;  3ND1 A;  2EH5 A;  1VA0 A;  3ZGN A;  3UV3 A;  2P6K A;  2ELE A;  2E17 A;  2E8H A;  2ED5 A;  2P6D A;  2P5C A;  2EMU A;  2P2X A;  2ENI A;  2DXW A;  2E0K A;  2EJJ A;  3LMM A;  1WDE A;  4H4D A;  3T0G A;  2EL3 A;  3NDC A;  2HUQ A;  2PCI A;  2EJZ A;  2PCG A;  2YBO A;  3UV6 A;  3SZL A;  2DSH A;  2DEK A;  1WYZ A;  3T0F A;  4H4E A;  3F7T A;  2E7R A;  4MUY A;  1VE2 A;  2E8R A;  2PCK A;  4N7B A;  3KE9 A;  1PJS A;  3SZU A;  4MV0 A;  2EK2 A;  2HUV A;  3KEM A;  2KYY A;  2PCA A;  3TIX B;  3URK A;  2DV4 A;  2EKA A;  2BB3 A;  3KWP A;  2E8S A;  3DNF A;  2E15 A;  2EGS A;  2ZVB A;  3UTD A;  2OWK A;  2E08 A;  2HUT A;  2PCM A;  1WNG A;  2EGL A;  3KEF A;  2EL2 A;  2E07 A;  3KEL A;  4EB3 A;  2HR8 A;  2HUX A;  2EHL A;  2ZVC A;  2E0N A;  2OWF A;  2PB5 A;  3KE8 A;  3FQ6 A;  3UWM A;  2EH4 A;  2OWU A;  4MV5 A;  4E16 A;  2ED3 A;  1PJQ A;  1VCE A;  3NUT A;  3SZO A;  3NEI A;  1VHV A;  2ELD A;  3UTC A;  2YBQ A;  2DV5 A;  3I4T A;  2E8Q A;  2EL1 A;  3ZGL A;  2EH2 A;  4H4C A;  2P6I A;  2Z6R A;  2EEQ A;  2EK7 A;  2EK3 A;  2DSI A;  2PCH A;  3UV7 A;  2CBF A;  2EHC A;  1S4D A;  3FFY A;  2EJK A;  2DXX A;  5HW4 A;  2EMR A;  2OWV A;  2PB6 A;  2P9D A;  2OWG A;  2DXV A;  2DSG A;  2E4N A; 
#chains in the Genus database with same CATH homology
 2DV7 A;  2EK4 A;  2P6L A;  2E4R A;  2EN5 A;  3HH1 A;  2E16 A;  2EGB A;  1CBF A;  2EL0 A;  2DV3 A;  2P5F A;  1PJT A;  1V9A A;  2QBU A;  4MUX A;  2NPN A;  2PB4 A;  3ND1 A;  2EH5 A;  1VA0 A;  3ZGN A;  3UV3 A;  2P6K A;  2ELE A;  2E17 A;  2E8H A;  2ED5 A;  2P6D A;  2P5C A;  2EMU A;  2P2X A;  2ENI A;  2DXW A;  2E0K A;  2EJJ A;  3LMM A;  1WDE A;  4H4D A;  3T0G A;  2EL3 A;  3NDC A;  2HUQ A;  2PCI A;  2EJZ A;  2PCG A;  2YBO A;  3UV6 A;  3SZL A;  2DSH A;  2DEK A;  1WYZ A;  3T0F A;  4H4E A;  3F7T A;  2E7R A;  4MUY A;  1VE2 A;  2E8R A;  2PCK A;  4N7B A;  3KE9 A;  1PJS A;  3SZU A;  4MV0 A;  2EK2 A;  2HUV A;  3KEM A;  2KYY A;  2PCA A;  3TIX B;  3URK A;  2DV4 A;  2EKA A;  2BB3 A;  3KWP A;  2E8S A;  3DNF A;  2E15 A;  2EGS A;  2ZVB A;  3UTD A;  2OWK A;  2E08 A;  2HUT A;  2PCM A;  1WNG A;  2EGL A;  3KEF A;  2EL2 A;  2E07 A;  3KEL A;  4EB3 A;  2HR8 A;  2HUX A;  2EHL A;  2ZVC A;  2E0N A;  2OWF A;  2PB5 A;  3KE8 A;  3FQ6 A;  3UWM A;  2EH4 A;  2OWU A;  4MV5 A;  4E16 A;  2ED3 A;  1PJQ A;  1VCE A;  3NUT A;  3SZO A;  3NEI A;  1VHV A;  2ELD A;  3UTC A;  2YBQ A;  2DV5 A;  3I4T A;  2E8Q A;  2EL1 A;  3ZGL A;  2EH2 A;  4H4C A;  2P6I A;  2Z6R A;  2EEQ A;  2EK7 A;  2EK3 A;  2DSI A;  2PCH A;  3UV7 A;  2CBF A;  2EHC A;  1S4D A;  3FFY A;  2EJK A;  2DXX A;  5HW4 A;  2EMR A;  2OWV A;  2PB6 A;  2P9D A;  2OWG A;  2DXV A;  2DSG A;  2E4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...