1VE2A

Crystal structure of uroporphyrin-iii-c-methyltransferase from thermus thermophilus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
235
structure length
222
Chain Sequence
MRGKVYLVGAGFGGPEHLTLKALRVLEVAEVVLHDRLVHPGVLALAKGELVPVKTPQEAITARLIALAREGRVVARLKGGDPMVFGRGGEEALALRRAGIPFEVVPGVTSAVGALSALGLPLTHRGLARSFAVATGHDPALPLPRADTLVLLMGLKERLLERFPPETPLALLARVGWPGEAVRLGRVEDLPGLGEGLPSPALLVVGKVVGLYGELLPKDHGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uroporphyrin-III-C-Methyltrans from Thermus Thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Uroporphyrin-III C-methyltransferase
total genus 59
structure length 222
sequence length 235
chains with identical sequence B
ec nomenclature ec 2.1.1.107: Uroporphyrinogen-III C-methyltransferase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 1ve2A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 1ve2A01
1WYZA 2DEKA 5HW4A 2EK7A 1VA0A 2EGLA 2DV5A 2PB5A 2PCKA 1PJTA 2EHCA 2EK4A 2PCGA 4E16A 2DSGA 2DSIA 2ENIA 2E4NA 2HUVA 1S4DA 2DXWA 2EMUA 2YBQA 2EL3A 2OWVA 2DV3A 1CBFA 2P6IA 3ND1A 2YBOA 1VHVA 2EK2A 1WNGA 1PJSA 3FQ6A 2E16A 3NDCA 2E0KA 3I4TA 2PB6A 2OWGA 2BB3A 2ZVCA 2CBFA 2EK3A 2E7RA 2DV7A 2QBUA 2DV4A 2PCHA 2EKAA 2HR8A 3KWPA 2P6KA 2P6LA 2ED5A 2EJZA 2EGSA 2EH5A 2PCAA 2EJJA 2HUXA 2HUTA 2E8SA 2DXVA 2EN5A 2EGBA 2ZVBA 2PB4A 2Z6RA 2E15A 3FFYA 2EL0A 2E4RA 2P5FA 2PCMA 2OWKA 2ED3A 2EL2A 2EMRA 2E17A 1PJQA 2EH4A 3NEIA 1VE2A 2E07A 2NPNA 2HUQA 2OWUA 1VCEA 1V9AA 1WDEA 2EEQA 2E8HA 2E8RA 2EHLA 2P2XA 2P5CA 3NUTA 2OWFA 2DXXA 2PCIA 2E8QA 2E0NA 2EL1A 2P9DA 2EJKA 2P6DA 2ELEA 2ELDA 3HH1A 2E08A 2DSHA 2EH2A
chains in the Genus database with same CATH superfamily
1WYZA 2DEKA 5HW4A 2EK7A 3UWMA 1VA0A 2EGLA 2DV5A 2PB5A 3DNFA 2PCKA 1PJTA 2EHCA 2EK4A 2PCGA 4E16A 2DSGA 2DSIA 2ENIA 4H4EA 2E4NA 2HUVA 1S4DA 3KE9A 4MV5A 2KYYA 4H4CA 3UTCA 2DXWA 2EMUA 3KEMA 2YBQA 2EL3A 2OWVA 2DV3A 1CBFA 2P6IA 3ND1A 2YBOA 3KE8A 1VHVA 2EK2A 3UV6A 4MUXA 1WNGA 1PJSA 3F7TA 3FQ6A 2E16A 3NDCA 2E0KA 4H4DA 4EB3A 3I4TA 2PB6A 2OWGA 2BB3A 2ZVCA 2CBFA 3T0FA 2EK3A 2E7RA 2DV7A 2QBUA 3T0GA 2DV4A 2PCHA 2EKAA 2HR8A 3KWPA 3KEFA 2P6KA 2P6LA 2ED5A 2EJZA 3KELA 2EGSA 2EH5A 2PCAA 2EJJA 2HUXA 2HUTA 2E8SA 2DXVA 2EN5A 2EGBA 2ZVBA 4MUYA 2PB4A 2Z6RA 2E15A 3FFYA 2EL0A 2E4RA 2P5FA 2PCMA 2OWKA 2ED3A 2EL2A 2EMRA 4N7BA 2E17A 1PJQA 3SZUA 3SZLA 3UTDA 3ZGLA 2EH4A 3NEIA 3ZGNA 1VE2A 4MV0A 2E07A 2NPNA 3UV7A 2HUQA 2OWUA 1VCEA 1V9AA 1WDEA 2EEQA 2E8HA 2E8RA 2EHLA 3UV3A 2P2XA 3TIXB 2P5CA 3NUTA 3URKA 2OWFA 2DXXA 2PCIA 2E8QA 2E0NA 2EL1A 2P9DA 2EJKA 2P6DA 3LMMA 2ELEA 2ELDA 3HH1A 2E08A 2DSHA 3SZOA 2EH2A
chains in the Genus database with same CATH topology
1WYZA 2DEKA 5HW4A 2EK7A 3UWMA 1VA0A 2EGLA 2DV5A 2PB5A 3DNFA 2PCKA 1PJTA 2EHCA 2EK4A 2PCGA 4E16A 2DSGA 2DSIA 2ENIA 4H4EA 2E4NA 2HUVA 1S4DA 3KE9A 4MV5A 2KYYA 4H4CA 3UTCA 2DXWA 2EMUA 3KEMA 2YBQA 2EL3A 2OWVA 2DV3A 1CBFA 2P6IA 3ND1A 2YBOA 3KE8A 1VHVA 2EK2A 3UV6A 4MUXA 1WNGA 1PJSA 3F7TA 3FQ6A 2E16A 3NDCA 2E0KA 4H4DA 4EB3A 3I4TA 2PB6A 2OWGA 2BB3A 2ZVCA 2CBFA 3T0FA 2EK3A 2E7RA 2DV7A 2QBUA 3T0GA 2DV4A 2PCHA 2EKAA 2HR8A 3KWPA 3KEFA 2P6KA 2P6LA 2ED5A 2EJZA 3KELA 2EGSA 2EH5A 2PCAA 2EJJA 2HUXA 2HUTA 2E8SA 2DXVA 2EN5A 2EGBA 2ZVBA 4MUYA 2PB4A 2Z6RA 2E15A 3FFYA 2EL0A 2E4RA 2P5FA 2PCMA 2OWKA 2ED3A 2EL2A 2EMRA 4N7BA 2E17A 1PJQA 3SZUA 3SZLA 3UTDA 3ZGLA 2EH4A 3NEIA 3ZGNA 1VE2A 4MV0A 2E07A 2NPNA 3UV7A 2HUQA 2OWUA 1VCEA 1V9AA 1WDEA 2EEQA 2E8HA 2E8RA 2EHLA 3UV3A 2P2XA 3TIXB 2P5CA 3NUTA 3URKA 2OWFA 2DXXA 2PCIA 2E8QA 2E0NA 2EL1A 2P9DA 2EJKA 2P6DA 3LMMA 2ELEA 2ELDA 3HH1A 2E08A 2DSHA 3SZOA 2EH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYZ A;  2DEK A;  5HW4 A;  2EK7 A;  1VA0 A;  2EGL A;  2DV5 A;  2PB5 A;  2PCK A;  1PJT A;  2EHC A;  2EK4 A;  2PCG A;  4E16 A;  2DSG A;  2DSI A;  2ENI A;  2E4N A;  2HUV A;  1S4D A;  2DXW A;  2EMU A;  2YBQ A;  2EL3 A;  2OWV A;  2DV3 A;  1CBF A;  2P6I A;  3ND1 A;  2YBO A;  1VHV A;  2EK2 A;  1WNG A;  1PJS A;  3FQ6 A;  2E16 A;  3NDC A;  2E0K A;  3I4T A;  2PB6 A;  2OWG A;  2BB3 A;  2ZVC A;  2CBF A;  2EK3 A;  2E7R A;  2DV7 A;  2QBU A;  2DV4 A;  2PCH A;  2EKA A;  2HR8 A;  3KWP A;  2P6K A;  2P6L A;  2ED5 A;  2EJZ A;  2EGS A;  2EH5 A;  2PCA A;  2EJJ A;  2HUX A;  2HUT A;  2E8S A;  2DXV A;  2EN5 A;  2EGB A;  2ZVB A;  2PB4 A;  2Z6R A;  2E15 A;  3FFY A;  2EL0 A;  2E4R A;  2P5F A;  2PCM A;  2OWK A;  2ED3 A;  2EL2 A;  2EMR A;  2E17 A;  1PJQ A;  2EH4 A;  3NEI A;  1VE2 A;  2E07 A;  2NPN A;  2HUQ A;  2OWU A;  1VCE A;  1V9A A;  1WDE A;  2EEQ A;  2E8H A;  2E8R A;  2EHL A;  2P2X A;  2P5C A;  3NUT A;  2OWF A;  2DXX A;  2PCI A;  2E8Q A;  2E0N A;  2EL1 A;  2P9D A;  2EJK A;  2P6D A;  2ELE A;  2ELD A;  3HH1 A;  2E08 A;  2DSH A;  2EH2 A; 
#chains in the Genus database with same CATH topology
 1WYZ A;  2DEK A;  5HW4 A;  2EK7 A;  3UWM A;  1VA0 A;  2EGL A;  2DV5 A;  2PB5 A;  3DNF A;  2PCK A;  1PJT A;  2EHC A;  2EK4 A;  2PCG A;  4E16 A;  2DSG A;  2DSI A;  2ENI A;  4H4E A;  2E4N A;  2HUV A;  1S4D A;  3KE9 A;  4MV5 A;  2KYY A;  4H4C A;  3UTC A;  2DXW A;  2EMU A;  3KEM A;  2YBQ A;  2EL3 A;  2OWV A;  2DV3 A;  1CBF A;  2P6I A;  3ND1 A;  2YBO A;  3KE8 A;  1VHV A;  2EK2 A;  3UV6 A;  4MUX A;  1WNG A;  1PJS A;  3F7T A;  3FQ6 A;  2E16 A;  3NDC A;  2E0K A;  4H4D A;  4EB3 A;  3I4T A;  2PB6 A;  2OWG A;  2BB3 A;  2ZVC A;  2CBF A;  3T0F A;  2EK3 A;  2E7R A;  2DV7 A;  2QBU A;  3T0G A;  2DV4 A;  2PCH A;  2EKA A;  2HR8 A;  3KWP A;  3KEF A;  2P6K A;  2P6L A;  2ED5 A;  2EJZ A;  3KEL A;  2EGS A;  2EH5 A;  2PCA A;  2EJJ A;  2HUX A;  2HUT A;  2E8S A;  2DXV A;  2EN5 A;  2EGB A;  2ZVB A;  4MUY A;  2PB4 A;  2Z6R A;  2E15 A;  3FFY A;  2EL0 A;  2E4R A;  2P5F A;  2PCM A;  2OWK A;  2ED3 A;  2EL2 A;  2EMR A;  4N7B A;  2E17 A;  1PJQ A;  3SZU A;  3SZL A;  3UTD A;  3ZGL A;  2EH4 A;  3NEI A;  3ZGN A;  1VE2 A;  4MV0 A;  2E07 A;  2NPN A;  3UV7 A;  2HUQ A;  2OWU A;  1VCE A;  1V9A A;  1WDE A;  2EEQ A;  2E8H A;  2E8R A;  2EHL A;  3UV3 A;  2P2X A;  3TIX B;  2P5C A;  3NUT A;  3URK A;  2OWF A;  2DXX A;  2PCI A;  2E8Q A;  2E0N A;  2EL1 A;  2P9D A;  2EJK A;  2P6D A;  3LMM A;  2ELE A;  2ELD A;  3HH1 A;  2E08 A;  2DSH A;  3SZO A;  2EH2 A; 
#chains in the Genus database with same CATH homology
 1WYZ A;  2DEK A;  5HW4 A;  2EK7 A;  3UWM A;  1VA0 A;  2EGL A;  2DV5 A;  2PB5 A;  3DNF A;  2PCK A;  1PJT A;  2EHC A;  2EK4 A;  2PCG A;  4E16 A;  2DSG A;  2DSI A;  2ENI A;  4H4E A;  2E4N A;  2HUV A;  1S4D A;  3KE9 A;  4MV5 A;  2KYY A;  4H4C A;  3UTC A;  2DXW A;  2EMU A;  3KEM A;  2YBQ A;  2EL3 A;  2OWV A;  2DV3 A;  1CBF A;  2P6I A;  3ND1 A;  2YBO A;  3KE8 A;  1VHV A;  2EK2 A;  3UV6 A;  4MUX A;  1WNG A;  1PJS A;  3F7T A;  3FQ6 A;  2E16 A;  3NDC A;  2E0K A;  4H4D A;  4EB3 A;  3I4T A;  2PB6 A;  2OWG A;  2BB3 A;  2ZVC A;  2CBF A;  3T0F A;  2EK3 A;  2E7R A;  2DV7 A;  2QBU A;  3T0G A;  2DV4 A;  2PCH A;  2EKA A;  2HR8 A;  3KWP A;  3KEF A;  2P6K A;  2P6L A;  2ED5 A;  2EJZ A;  3KEL A;  2EGS A;  2EH5 A;  2PCA A;  2EJJ A;  2HUX A;  2HUT A;  2E8S A;  2DXV A;  2EN5 A;  2EGB A;  2ZVB A;  4MUY A;  2PB4 A;  2Z6R A;  2E15 A;  3FFY A;  2EL0 A;  2E4R A;  2P5F A;  2PCM A;  2OWK A;  2ED3 A;  2EL2 A;  2EMR A;  4N7B A;  2E17 A;  1PJQ A;  3SZU A;  3SZL A;  3UTD A;  3ZGL A;  2EH4 A;  3NEI A;  3ZGN A;  1VE2 A;  4MV0 A;  2E07 A;  2NPN A;  3UV7 A;  2HUQ A;  2OWU A;  1VCE A;  1V9A A;  1WDE A;  2EEQ A;  2E8H A;  2E8R A;  2EHL A;  3UV3 A;  2P2X A;  3TIX B;  2P5C A;  3NUT A;  3URK A;  2OWF A;  2DXX A;  2PCI A;  2E8Q A;  2E0N A;  2EL1 A;  2P9D A;  2EJK A;  2P6D A;  3LMM A;  2ELE A;  2ELD A;  3HH1 A;  2E08 A;  2DSH A;  3SZO A;  2EH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...