3KWPA

Crystal structure of putative methyltransferase from lactobacillus brevis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
228
structure length
228
Chain Sequence
b'TGGHLYLVPTPIGNLDDMTFRAVKTLTAVDLIAAEDTRNTQKLLNHFEITTKQISFHEHNTQERIPQLIAKLKQGMQIAQVSDAGMPSISDPGHELVNACIDAHIPVVPLPGANAGLTALIASGLAPQPFYFYGFLDRKPKDRKAEIAGLAQRPETLIFYEAPHRLKKTLQNLAAGFGDERPAVLCRELTKRYEEFLRGSLAELANWAATDTVRGEFVVLVGGNPAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Predicted methyltransferase
publication title Crystal structure of putative methyltransferase from Lactobacillus brevis
rcsb
source organism Lactobacillus brevis atcc 367
molecule tags Transferase
total genus 64
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3kwpA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3kwpA01
2EJZA 2DSGA 2E8QA 2E0KA 2EGSA 2PCAA 2PB5A 2EGLA 4E16A 2EKAA 3ND1A 2PB6A 2P2XA 3NUTA 2OWFA 2OWKA 2YBQA 1VCEA 2DEKA 2HUXA 2E4NA 2E8SA 2OWGA 2EK3A 2P6DA 2DSHA 2E8HA 3I4TA 2DSIA 2EK4A 1VE2A 2E0NA 2EMRA 1WYZA 2DV7A 1V9AA 2ZVCA 1CBFA 2EHLA 2ELEA 2YBOA 2EH2A 2DXWA 2E7RA 2EJKA 2P6IA 2DV3A 2Z6RA 3FQ6A 2ENIA 2EMUA 2EN5A 1WNGA 2E15A 2EL1A 2EEQA 2DXXA 1VA0A 2EGBA 1PJTA 1WDEA 2NPNA 3HH1A 2BB3A 2PCHA 3KWPA 2PCMA 2P6KA 2EL3A 2DXVA 2CBFA 2P5CA 2PB4A 2OWVA 2EK2A 1PJQA 3NEIA 2EHCA 2P5FA 2E16A 2HUVA 2EL0A 2P9DA 2HR8A 2ZVBA 2EH4A 2E07A 2E4RA 2EH5A 2E8RA 2PCKA 2ELDA 2EK7A 2E17A 2PCGA 2DV4A 2P6LA 2QBUA 2E08A 2HUQA 2ED5A 5HW4A 3NDCA 2PCIA 2OWUA 2EL2A 1S4DA 1VHVA 3FFYA 2ED3A 2HUTA 2EJJA 2DV5A 1PJSA
chains in the Genus database with same CATH superfamily
4MUYA 2EJZA 2DSGA 2E8QA 2E0KA 2EGSA 2PCAA 2PB5A 2EGLA 3URKA 4E16A 3UTDA 2EKAA 3ND1A 2PB6A 2P2XA 3KE8A 3NUTA 3T0FA 2OWFA 2OWKA 3KE9A 2YBQA 3LMMA 1VCEA 4MV0A 2DEKA 2HUXA 4H4EA 2E4NA 2E8SA 2OWGA 2EK3A 3SZOA 2P6DA 2DSHA 2E8HA 3I4TA 2DSIA 2EK4A 3UWMA 1VE2A 3UTCA 2E0NA 2EMRA 1WYZA 3UV3A 4EB3A 3T0GA 2DV7A 1V9AA 2ZVCA 1CBFA 2EHLA 2ELEA 4MUXA 2YBOA 2EH2A 3TIXB 3ZGNA 3UV6A 2DXWA 2E7RA 2EJKA 2P6IA 4H4DA 3KEFA 2DV3A 2Z6RA 3FQ6A 2ENIA 2EMUA 2EN5A 1WNGA 2E15A 3UV7A 2EL1A 4N7BA 2EEQA 3F7TA 4MV5A 4H4CA 2DXXA 1VA0A 2EGBA 1PJTA 1WDEA 2NPNA 3HH1A 2BB3A 2PCHA 3KWPA 3SZLA 2PCMA 2P6KA 2EL3A 2DXVA 2CBFA 2P5CA 2PB4A 2OWVA 2EK2A 1PJQA 3KEMA 3NEIA 2EHCA 2P5FA 2E16A 2HUVA 2EL0A 2P9DA 2HR8A 3SZUA 2ZVBA 2EH4A 2E07A 2E4RA 2EH5A 3KELA 2E8RA 2PCKA 2ELDA 2EK7A 2E17A 2PCGA 2DV4A 2P6LA 2QBUA 2E08A 3ZGLA 3DNFA 2HUQA 2ED5A 5HW4A 3NDCA 2KYYA 2PCIA 2OWUA 2EL2A 1S4DA 1VHVA 3FFYA 2ED3A 2HUTA 2EJJA 2DV5A 1PJSA
chains in the Genus database with same CATH topology
4MUYA 2EJZA 2DSGA 2E8QA 2E0KA 2EGSA 2PCAA 2PB5A 2EGLA 3URKA 4E16A 3UTDA 2EKAA 3ND1A 2PB6A 2P2XA 3KE8A 3NUTA 3T0FA 2OWFA 2OWKA 3KE9A 2YBQA 3LMMA 1VCEA 4MV0A 2DEKA 2HUXA 4H4EA 2E4NA 2E8SA 2OWGA 2EK3A 3SZOA 2P6DA 2DSHA 2E8HA 3I4TA 2DSIA 2EK4A 3UWMA 1VE2A 3UTCA 2E0NA 2EMRA 1WYZA 3UV3A 4EB3A 3T0GA 2DV7A 1V9AA 2ZVCA 1CBFA 2EHLA 2ELEA 4MUXA 2YBOA 2EH2A 3TIXB 3ZGNA 3UV6A 2DXWA 2E7RA 2EJKA 2P6IA 4H4DA 3KEFA 2DV3A 2Z6RA 3FQ6A 2ENIA 2EMUA 2EN5A 1WNGA 2E15A 3UV7A 2EL1A 4N7BA 2EEQA 3F7TA 4MV5A 4H4CA 2DXXA 1VA0A 2EGBA 1PJTA 1WDEA 2NPNA 3HH1A 2BB3A 2PCHA 3KWPA 3SZLA 2PCMA 2P6KA 2EL3A 2DXVA 2CBFA 2P5CA 2PB4A 2OWVA 2EK2A 1PJQA 3KEMA 3NEIA 2EHCA 2P5FA 2E16A 2HUVA 2EL0A 2P9DA 2HR8A 3SZUA 2ZVBA 2EH4A 2E07A 2E4RA 2EH5A 3KELA 2E8RA 2PCKA 2ELDA 2EK7A 2E17A 2PCGA 2DV4A 2P6LA 2QBUA 2E08A 3ZGLA 3DNFA 2HUQA 2ED5A 5HW4A 3NDCA 2KYYA 2PCIA 2OWUA 2EL2A 1S4DA 1VHVA 3FFYA 2ED3A 2HUTA 2EJJA 2DV5A 1PJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJZ A;  2DSG A;  2E8Q A;  2E0K A;  2EGS A;  2PCA A;  2PB5 A;  2EGL A;  4E16 A;  2EKA A;  3ND1 A;  2PB6 A;  2P2X A;  3NUT A;  2OWF A;  2OWK A;  2YBQ A;  1VCE A;  2DEK A;  2HUX A;  2E4N A;  2E8S A;  2OWG A;  2EK3 A;  2P6D A;  2DSH A;  2E8H A;  3I4T A;  2DSI A;  2EK4 A;  1VE2 A;  2E0N A;  2EMR A;  1WYZ A;  2DV7 A;  1V9A A;  2ZVC A;  1CBF A;  2EHL A;  2ELE A;  2YBO A;  2EH2 A;  2DXW A;  2E7R A;  2EJK A;  2P6I A;  2DV3 A;  2Z6R A;  3FQ6 A;  2ENI A;  2EMU A;  2EN5 A;  1WNG A;  2E15 A;  2EL1 A;  2EEQ A;  2DXX A;  1VA0 A;  2EGB A;  1PJT A;  1WDE A;  2NPN A;  3HH1 A;  2BB3 A;  2PCH A;  3KWP A;  2PCM A;  2P6K A;  2EL3 A;  2DXV A;  2CBF A;  2P5C A;  2PB4 A;  2OWV A;  2EK2 A;  1PJQ A;  3NEI A;  2EHC A;  2P5F A;  2E16 A;  2HUV A;  2EL0 A;  2P9D A;  2HR8 A;  2ZVB A;  2EH4 A;  2E07 A;  2E4R A;  2EH5 A;  2E8R A;  2PCK A;  2ELD A;  2EK7 A;  2E17 A;  2PCG A;  2DV4 A;  2P6L A;  2QBU A;  2E08 A;  2HUQ A;  2ED5 A;  5HW4 A;  3NDC A;  2PCI A;  2OWU A;  2EL2 A;  1S4D A;  1VHV A;  3FFY A;  2ED3 A;  2HUT A;  2EJJ A;  2DV5 A;  1PJS A; 
#chains in the Genus database with same CATH topology
 4MUY A;  2EJZ A;  2DSG A;  2E8Q A;  2E0K A;  2EGS A;  2PCA A;  2PB5 A;  2EGL A;  3URK A;  4E16 A;  3UTD A;  2EKA A;  3ND1 A;  2PB6 A;  2P2X A;  3KE8 A;  3NUT A;  3T0F A;  2OWF A;  2OWK A;  3KE9 A;  2YBQ A;  3LMM A;  1VCE A;  4MV0 A;  2DEK A;  2HUX A;  4H4E A;  2E4N A;  2E8S A;  2OWG A;  2EK3 A;  3SZO A;  2P6D A;  2DSH A;  2E8H A;  3I4T A;  2DSI A;  2EK4 A;  3UWM A;  1VE2 A;  3UTC A;  2E0N A;  2EMR A;  1WYZ A;  3UV3 A;  4EB3 A;  3T0G A;  2DV7 A;  1V9A A;  2ZVC A;  1CBF A;  2EHL A;  2ELE A;  4MUX A;  2YBO A;  2EH2 A;  3TIX B;  3ZGN A;  3UV6 A;  2DXW A;  2E7R A;  2EJK A;  2P6I A;  4H4D A;  3KEF A;  2DV3 A;  2Z6R A;  3FQ6 A;  2ENI A;  2EMU A;  2EN5 A;  1WNG A;  2E15 A;  3UV7 A;  2EL1 A;  4N7B A;  2EEQ A;  3F7T A;  4MV5 A;  4H4C A;  2DXX A;  1VA0 A;  2EGB A;  1PJT A;  1WDE A;  2NPN A;  3HH1 A;  2BB3 A;  2PCH A;  3KWP A;  3SZL A;  2PCM A;  2P6K A;  2EL3 A;  2DXV A;  2CBF A;  2P5C A;  2PB4 A;  2OWV A;  2EK2 A;  1PJQ A;  3KEM A;  3NEI A;  2EHC A;  2P5F A;  2E16 A;  2HUV A;  2EL0 A;  2P9D A;  2HR8 A;  3SZU A;  2ZVB A;  2EH4 A;  2E07 A;  2E4R A;  2EH5 A;  3KEL A;  2E8R A;  2PCK A;  2ELD A;  2EK7 A;  2E17 A;  2PCG A;  2DV4 A;  2P6L A;  2QBU A;  2E08 A;  3ZGL A;  3DNF A;  2HUQ A;  2ED5 A;  5HW4 A;  3NDC A;  2KYY A;  2PCI A;  2OWU A;  2EL2 A;  1S4D A;  1VHV A;  3FFY A;  2ED3 A;  2HUT A;  2EJJ A;  2DV5 A;  1PJS A; 
#chains in the Genus database with same CATH homology
 4MUY A;  2EJZ A;  2DSG A;  2E8Q A;  2E0K A;  2EGS A;  2PCA A;  2PB5 A;  2EGL A;  3URK A;  4E16 A;  3UTD A;  2EKA A;  3ND1 A;  2PB6 A;  2P2X A;  3KE8 A;  3NUT A;  3T0F A;  2OWF A;  2OWK A;  3KE9 A;  2YBQ A;  3LMM A;  1VCE A;  4MV0 A;  2DEK A;  2HUX A;  4H4E A;  2E4N A;  2E8S A;  2OWG A;  2EK3 A;  3SZO A;  2P6D A;  2DSH A;  2E8H A;  3I4T A;  2DSI A;  2EK4 A;  3UWM A;  1VE2 A;  3UTC A;  2E0N A;  2EMR A;  1WYZ A;  3UV3 A;  4EB3 A;  3T0G A;  2DV7 A;  1V9A A;  2ZVC A;  1CBF A;  2EHL A;  2ELE A;  4MUX A;  2YBO A;  2EH2 A;  3TIX B;  3ZGN A;  3UV6 A;  2DXW A;  2E7R A;  2EJK A;  2P6I A;  4H4D A;  3KEF A;  2DV3 A;  2Z6R A;  3FQ6 A;  2ENI A;  2EMU A;  2EN5 A;  1WNG A;  2E15 A;  3UV7 A;  2EL1 A;  4N7B A;  2EEQ A;  3F7T A;  4MV5 A;  4H4C A;  2DXX A;  1VA0 A;  2EGB A;  1PJT A;  1WDE A;  2NPN A;  3HH1 A;  2BB3 A;  2PCH A;  3KWP A;  3SZL A;  2PCM A;  2P6K A;  2EL3 A;  2DXV A;  2CBF A;  2P5C A;  2PB4 A;  2OWV A;  2EK2 A;  1PJQ A;  3KEM A;  3NEI A;  2EHC A;  2P5F A;  2E16 A;  2HUV A;  2EL0 A;  2P9D A;  2HR8 A;  3SZU A;  2ZVB A;  2EH4 A;  2E07 A;  2E4R A;  2EH5 A;  3KEL A;  2E8R A;  2PCK A;  2ELD A;  2EK7 A;  2E17 A;  2PCG A;  2DV4 A;  2P6L A;  2QBU A;  2E08 A;  3ZGL A;  3DNF A;  2HUQ A;  2ED5 A;  5HW4 A;  3NDC A;  2KYY A;  2PCI A;  2OWU A;  2EL2 A;  1S4D A;  1VHV A;  3FFY A;  2ED3 A;  2HUT A;  2EJJ A;  2DV5 A;  1PJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...