4E16A

Precorrin-4 c(11)-methyltransferase from clostridium difficile
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
232
structure length
229
Chain Sequence
MNKVHFVGAGPGDKELITLKGYKLLSNADVVIYAGSLVNPELLEYCKEDCQIHNSAHMDLQEIIDVMREGIENNKSVVRLQTGDFSIYGSIREQVEDLNKLNIDYDCTPGVSSFLGAASSLGVEYTVPEISQSVIITRMTPVPEKESIQSYAKHQTSMVIFLSVQEIEKVVSKLLEGGYPKDTPIAVIYKATWADEKIVKGTLSDIAVKVKENNINKTALIMVGRFLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Precorrin-4 C(11)-methyltransferase from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Transferase
molecule keywords precorrin-4 C(11)-methyltransferase
total genus 65
structure length 229
sequence length 232
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 4e16A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 4e16A01
2EK2A 2EMRA 2EL1A 2PCKA 3FQ6A 2P6LA 2ZVCA 1PJSA 2DXWA 2E7RA 2EJZA 2DXVA 2YBOA 2EK7A 2P6DA 2PCMA 2EL2A 2EMUA 2EJKA 2P6IA 2E0KA 2HUTA 2CBFA 2HUVA 2EH2A 2DV4A 1PJQA 2E07A 2EL3A 2DXXA 2PB5A 2EHCA 2PCAA 2DSGA 1PJTA 2OWVA 2DEKA 1VCEA 2EGBA 1V9AA 2ED5A 2ELDA 2ED3A 2PCIA 2HUXA 2EKAA 2OWUA 2YBQA 3NEIA 2QBUA 2E8RA 2DV3A 1VA0A 2P2XA 2DV7A 2PB4A 2E8HA 2OWKA 3FFYA 2PCHA 2EL0A 2EH5A 2DSIA 2OWGA 2EH4A 2EJJA 1S4DA 2P5CA 3HH1A 2HR8A 2EEQA 2E16A 1WDEA 1VE2A 3ND1A 2E4RA 2P6KA 2EK3A 2PB6A 2Z6RA 2EGLA 2ENIA 2EN5A 1CBFA 2E4NA 2NPNA 4E16A 2ELEA 2DV5A 2HUQA 5HW4A 3NUTA 2OWFA 3KWPA 2E17A 2E8QA 2EK4A 2E8SA 1WNGA 2EGSA 2DSHA 1VHVA 3I4TA 2E0NA 1WYZA 2BB3A 2E15A 2ZVBA 3NDCA 2E08A 2P5FA 2EHLA 2PCGA 2P9DA
chains in the Genus database with same CATH superfamily
2EK2A 2EMRA 2EL1A 2PCKA 3UV3A 3FQ6A 2P6LA 3SZUA 2ZVCA 1PJSA 2DXWA 2E7RA 2EJZA 2DXVA 2YBOA 2EK7A 2P6DA 2PCMA 2EL2A 2EMUA 2EJKA 2P6IA 2E0KA 3LMMA 2HUTA 2CBFA 2HUVA 4MUXA 3SZOA 2EH2A 2DV4A 4MUYA 1PJQA 4H4CA 4N7BA 2E07A 2EL3A 2DXXA 2PB5A 2EHCA 2PCAA 4EB3A 2DSGA 1PJTA 2OWVA 2DEKA 1VCEA 2EGBA 1V9AA 3UV7A 2ED5A 2ELDA 2ED3A 2PCIA 2HUXA 2EKAA 2OWUA 2YBQA 3NEIA 2QBUA 2E8RA 2DV3A 1VA0A 2P2XA 4MV5A 2DV7A 3ZGNA 3F7TA 2PB4A 3URKA 2E8HA 2OWKA 3FFYA 2PCHA 2EL0A 2EH5A 3KE8A 2DSIA 3TIXB 3SZLA 2OWGA 2EH4A 2EJJA 4H4DA 1S4DA 2P5CA 3HH1A 3UV6A 2HR8A 2EEQA 3UTCA 2E16A 1WDEA 4MV0A 1VE2A 3T0FA 3ND1A 2E4RA 3DNFA 2P6KA 2EK3A 2PB6A 2Z6RA 2EGLA 2ENIA 2EN5A 3UWMA 1CBFA 3UTDA 2E4NA 2NPNA 4E16A 2ELEA 2DV5A 2HUQA 3ZGLA 5HW4A 4H4EA 3KEMA 3KEFA 3NUTA 2OWFA 3KWPA 2E17A 2E8QA 2EK4A 2E8SA 3KE9A 3KELA 1WNGA 2EGSA 3T0GA 2DSHA 1VHVA 3I4TA 2E0NA 1WYZA 2BB3A 2E15A 2KYYA 2ZVBA 2E08A 2P5FA 3NDCA 2EHLA 2PCGA 2P9DA
chains in the Genus database with same CATH topology
2EK2A 2EMRA 2EL1A 2PCKA 3UV3A 3FQ6A 2P6LA 3SZUA 2ZVCA 1PJSA 2DXWA 2E7RA 2EJZA 2DXVA 2YBOA 2EK7A 2P6DA 2PCMA 2EL2A 2EMUA 2EJKA 2P6IA 2E0KA 3LMMA 2HUTA 2CBFA 2HUVA 4MUXA 3SZOA 2EH2A 2DV4A 4MUYA 1PJQA 4H4CA 4N7BA 2E07A 2EL3A 2DXXA 2PB5A 2EHCA 2PCAA 4EB3A 2DSGA 1PJTA 2OWVA 2DEKA 1VCEA 2EGBA 1V9AA 3UV7A 2ED5A 2ELDA 2ED3A 2PCIA 2HUXA 2EKAA 2OWUA 2YBQA 3NEIA 2QBUA 2E8RA 2DV3A 1VA0A 2P2XA 4MV5A 2DV7A 3ZGNA 3F7TA 2PB4A 3URKA 2E8HA 2OWKA 3FFYA 2PCHA 2EL0A 2EH5A 3KE8A 2DSIA 3TIXB 3SZLA 2OWGA 2EH4A 2EJJA 4H4DA 1S4DA 2P5CA 3HH1A 3UV6A 2HR8A 2EEQA 3UTCA 2E16A 1WDEA 4MV0A 1VE2A 3T0FA 3ND1A 2E4RA 3DNFA 2P6KA 2EK3A 2PB6A 2Z6RA 2EGLA 2ENIA 2EN5A 3UWMA 1CBFA 3UTDA 2E4NA 2NPNA 4E16A 2ELEA 2DV5A 2HUQA 3ZGLA 5HW4A 4H4EA 3KEMA 3KEFA 3NUTA 2OWFA 3KWPA 2E17A 2E8QA 2EK4A 2E8SA 3KE9A 3KELA 1WNGA 2EGSA 3T0GA 2DSHA 1VHVA 3I4TA 2E0NA 1WYZA 2BB3A 2E15A 2KYYA 2ZVBA 2E08A 2P5FA 3NDCA 2EHLA 2PCGA 2P9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK2 A;  2EMR A;  2EL1 A;  2PCK A;  3FQ6 A;  2P6L A;  2ZVC A;  1PJS A;  2DXW A;  2E7R A;  2EJZ A;  2DXV A;  2YBO A;  2EK7 A;  2P6D A;  2PCM A;  2EL2 A;  2EMU A;  2EJK A;  2P6I A;  2E0K A;  2HUT A;  2CBF A;  2HUV A;  2EH2 A;  2DV4 A;  1PJQ A;  2E07 A;  2EL3 A;  2DXX A;  2PB5 A;  2EHC A;  2PCA A;  2DSG A;  1PJT A;  2OWV A;  2DEK A;  1VCE A;  2EGB A;  1V9A A;  2ED5 A;  2ELD A;  2ED3 A;  2PCI A;  2HUX A;  2EKA A;  2OWU A;  2YBQ A;  3NEI A;  2QBU A;  2E8R A;  2DV3 A;  1VA0 A;  2P2X A;  2DV7 A;  2PB4 A;  2E8H A;  2OWK A;  3FFY A;  2PCH A;  2EL0 A;  2EH5 A;  2DSI A;  2OWG A;  2EH4 A;  2EJJ A;  1S4D A;  2P5C A;  3HH1 A;  2HR8 A;  2EEQ A;  2E16 A;  1WDE A;  1VE2 A;  3ND1 A;  2E4R A;  2P6K A;  2EK3 A;  2PB6 A;  2Z6R A;  2EGL A;  2ENI A;  2EN5 A;  1CBF A;  2E4N A;  2NPN A;  4E16 A;  2ELE A;  2DV5 A;  2HUQ A;  5HW4 A;  3NUT A;  2OWF A;  3KWP A;  2E17 A;  2E8Q A;  2EK4 A;  2E8S A;  1WNG A;  2EGS A;  2DSH A;  1VHV A;  3I4T A;  2E0N A;  1WYZ A;  2BB3 A;  2E15 A;  2ZVB A;  3NDC A;  2E08 A;  2P5F A;  2EHL A;  2PCG A;  2P9D A; 
#chains in the Genus database with same CATH topology
 2EK2 A;  2EMR A;  2EL1 A;  2PCK A;  3UV3 A;  3FQ6 A;  2P6L A;  3SZU A;  2ZVC A;  1PJS A;  2DXW A;  2E7R A;  2EJZ A;  2DXV A;  2YBO A;  2EK7 A;  2P6D A;  2PCM A;  2EL2 A;  2EMU A;  2EJK A;  2P6I A;  2E0K A;  3LMM A;  2HUT A;  2CBF A;  2HUV A;  4MUX A;  3SZO A;  2EH2 A;  2DV4 A;  4MUY A;  1PJQ A;  4H4C A;  4N7B A;  2E07 A;  2EL3 A;  2DXX A;  2PB5 A;  2EHC A;  2PCA A;  4EB3 A;  2DSG A;  1PJT A;  2OWV A;  2DEK A;  1VCE A;  2EGB A;  1V9A A;  3UV7 A;  2ED5 A;  2ELD A;  2ED3 A;  2PCI A;  2HUX A;  2EKA A;  2OWU A;  2YBQ A;  3NEI A;  2QBU A;  2E8R A;  2DV3 A;  1VA0 A;  2P2X A;  4MV5 A;  2DV7 A;  3ZGN A;  3F7T A;  2PB4 A;  3URK A;  2E8H A;  2OWK A;  3FFY A;  2PCH A;  2EL0 A;  2EH5 A;  3KE8 A;  2DSI A;  3TIX B;  3SZL A;  2OWG A;  2EH4 A;  2EJJ A;  4H4D A;  1S4D A;  2P5C A;  3HH1 A;  3UV6 A;  2HR8 A;  2EEQ A;  3UTC A;  2E16 A;  1WDE A;  4MV0 A;  1VE2 A;  3T0F A;  3ND1 A;  2E4R A;  3DNF A;  2P6K A;  2EK3 A;  2PB6 A;  2Z6R A;  2EGL A;  2ENI A;  2EN5 A;  3UWM A;  1CBF A;  3UTD A;  2E4N A;  2NPN A;  4E16 A;  2ELE A;  2DV5 A;  2HUQ A;  3ZGL A;  5HW4 A;  4H4E A;  3KEM A;  3KEF A;  3NUT A;  2OWF A;  3KWP A;  2E17 A;  2E8Q A;  2EK4 A;  2E8S A;  3KE9 A;  3KEL A;  1WNG A;  2EGS A;  3T0G A;  2DSH A;  1VHV A;  3I4T A;  2E0N A;  1WYZ A;  2BB3 A;  2E15 A;  2KYY A;  2ZVB A;  2E08 A;  2P5F A;  3NDC A;  2EHL A;  2PCG A;  2P9D A; 
#chains in the Genus database with same CATH homology
 2EK2 A;  2EMR A;  2EL1 A;  2PCK A;  3UV3 A;  3FQ6 A;  2P6L A;  3SZU A;  2ZVC A;  1PJS A;  2DXW A;  2E7R A;  2EJZ A;  2DXV A;  2YBO A;  2EK7 A;  2P6D A;  2PCM A;  2EL2 A;  2EMU A;  2EJK A;  2P6I A;  2E0K A;  3LMM A;  2HUT A;  2CBF A;  2HUV A;  4MUX A;  3SZO A;  2EH2 A;  2DV4 A;  4MUY A;  1PJQ A;  4H4C A;  4N7B A;  2E07 A;  2EL3 A;  2DXX A;  2PB5 A;  2EHC A;  2PCA A;  4EB3 A;  2DSG A;  1PJT A;  2OWV A;  2DEK A;  1VCE A;  2EGB A;  1V9A A;  3UV7 A;  2ED5 A;  2ELD A;  2ED3 A;  2PCI A;  2HUX A;  2EKA A;  2OWU A;  2YBQ A;  3NEI A;  2QBU A;  2E8R A;  2DV3 A;  1VA0 A;  2P2X A;  4MV5 A;  2DV7 A;  3ZGN A;  3F7T A;  2PB4 A;  3URK A;  2E8H A;  2OWK A;  3FFY A;  2PCH A;  2EL0 A;  2EH5 A;  3KE8 A;  2DSI A;  3TIX B;  3SZL A;  2OWG A;  2EH4 A;  2EJJ A;  4H4D A;  1S4D A;  2P5C A;  3HH1 A;  3UV6 A;  2HR8 A;  2EEQ A;  3UTC A;  2E16 A;  1WDE A;  4MV0 A;  1VE2 A;  3T0F A;  3ND1 A;  2E4R A;  3DNF A;  2P6K A;  2EK3 A;  2PB6 A;  2Z6R A;  2EGL A;  2ENI A;  2EN5 A;  3UWM A;  1CBF A;  3UTD A;  2E4N A;  2NPN A;  4E16 A;  2ELE A;  2DV5 A;  2HUQ A;  3ZGL A;  5HW4 A;  4H4E A;  3KEM A;  3KEF A;  3NUT A;  2OWF A;  3KWP A;  2E17 A;  2E8Q A;  2EK4 A;  2E8S A;  3KE9 A;  3KEL A;  1WNG A;  2EGS A;  3T0G A;  2DSH A;  1VHV A;  3I4T A;  2E0N A;  1WYZ A;  2BB3 A;  2E15 A;  2KYY A;  2ZVB A;  2E08 A;  2P5F A;  3NDC A;  2EHL A;  2PCG A;  2P9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...