4E16A

Precorrin-4 c(11)-methyltransferase from clostridium difficile
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
232
structure length
229
Chain Sequence
b'MNKVHFVGAGPGDKELITLKGYKLLSNADVVIYAGSLVNPELLEYCKEDCQIHNSAHMDLQEIIDVMREGIENNKSVVRLQTGDFSIYGSIREQVEDLNKLNIDYDCTPGVSSFLGAASSLGVEYTVPEISQSVIITRMTPVPEKESIQSYAKHQTSMVIFLSVQEIEKVVSKLLEGGYPKDTPIAVIYKATWADEKIVKGTLSDIAVKVKENNINKTALIMVGRFLGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords precorrin-4 C(11)-methyltransferase
publication title Precorrin-4 C(11)-methyltransferase from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Transferase
total genus 65
structure length 229
sequence length 232
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 4e16A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 4e16A01
2EJJA 2E4NA 2EMRA 2PCAA 3HH1A 2DV5A 2PB6A 2EJZA 2DXXA 2ELDA 1WYZA 2QBUA 2OWFA 2E8QA 2E0KA 2E7RA 2ZVBA 1CBFA 2HUVA 2EHCA 2EKAA 2P2XA 2OWVA 2CBFA 2EEQA 2EL2A 3KWPA 2P6LA 1V9AA 2DV7A 2ED5A 2OWKA 2ELEA 2ED3A 2DV3A 2PB5A 2ZVCA 2EK4A 2P5FA 2EN5A 5HW4A 2ENIA 2P6KA 1PJQA 2Z6RA 2E08A 2E0NA 2NPNA 1VCEA 2DXWA 1WDEA 2P6DA 3ND1A 2YBQA 2OWUA 1VA0A 2EGLA 2HUQA 2EMUA 2EHLA 2EK3A 2P6IA 2E16A 3NUTA 2EH5A 2P9DA 1S4DA 2E07A 2PCHA 2DSGA 2E8HA 2EK2A 2PCIA 2EJKA 2EGSA 2E4RA 1VE2A 2DV4A 1PJSA 2DXVA 2HUXA 1PJTA 2EGBA 2YBOA 2PCMA 2PCGA 2PCKA 2DSIA 1WNGA 3FQ6A 2HR8A 3FFYA 2EL1A 2E8SA 1VHVA 2P5CA 4E16A 2PB4A 2EH4A 2HUTA 3NEIA 3I4TA 3NDCA 2DSHA 2BB3A 2DEKA 2EH2A 2EL3A 2EK7A 2EL0A 2OWGA 2E15A 2E17A 2E8RA
chains in the Genus database with same CATH superfamily
2EJJA 2E4NA 2EMRA 2PCAA 3HH1A 2DV5A 2PB6A 2EJZA 4H4CA 2DXXA 3URKA 2ELDA 1WYZA 2QBUA 4MUYA 2OWFA 3ZGNA 2E8QA 3DNFA 4EB3A 2E0KA 3UTDA 2E7RA 2ZVBA 1CBFA 2HUVA 2EHCA 4N7BA 2EKAA 2P2XA 2OWVA 3SZUA 2CBFA 2EEQA 2EL2A 3KWPA 2P6LA 1V9AA 2DV7A 2ED5A 3UTCA 2OWKA 2ELEA 2ED3A 2DV3A 2PB5A 2ZVCA 3UV3A 2EK4A 2P5FA 2EN5A 5HW4A 2ENIA 2P6KA 3KE9A 1PJQA 2Z6RA 4MV0A 2E08A 2E0NA 2NPNA 1VCEA 2DXWA 1WDEA 2P6DA 3ND1A 2YBQA 2OWUA 1VA0A 2EGLA 2HUQA 2EMUA 2EHLA 2EK3A 2P6IA 2E16A 3NUTA 2EH5A 2P9DA 1S4DA 2E07A 2PCHA 2DSGA 2E8HA 2EK2A 2PCIA 2EJKA 3UV6A 2EGSA 2E4RA 3SZLA 1VE2A 2DV4A 1PJSA 4MUXA 2DXVA 2HUXA 1PJTA 4H4DA 3UWMA 2EGBA 2YBOA 2PCMA 3SZOA 2PCGA 2PCKA 2DSIA 3F7TA 1WNGA 3FQ6A 3KELA 2HR8A 3FFYA 3KEFA 3TIXB 3UV7A 2EL1A 2E8SA 3ZGLA 1VHVA 2P5CA 4E16A 3KE8A 2PB4A 2EH4A 2HUTA 3NEIA 4MV5A 3LMMA 3I4TA 3NDCA 2DSHA 2BB3A 2DEKA 3KEMA 2EH2A 4H4EA 2EL3A 2EK7A 2EL0A 3T0GA 2OWGA 2E15A 2E17A 3T0FA 2KYYA 2E8RA
chains in the Genus database with same CATH topology
2EJJA 2E4NA 2EMRA 2PCAA 3HH1A 2DV5A 2PB6A 2EJZA 4H4CA 2DXXA 3URKA 2ELDA 1WYZA 2QBUA 4MUYA 2OWFA 3ZGNA 2E8QA 3DNFA 4EB3A 2E0KA 3UTDA 2E7RA 2ZVBA 1CBFA 2HUVA 2EHCA 4N7BA 2EKAA 2P2XA 2OWVA 3SZUA 2CBFA 2EEQA 2EL2A 3KWPA 2P6LA 1V9AA 2DV7A 2ED5A 3UTCA 2OWKA 2ELEA 2ED3A 2DV3A 2PB5A 2ZVCA 3UV3A 2EK4A 2P5FA 2EN5A 5HW4A 2ENIA 2P6KA 3KE9A 1PJQA 2Z6RA 4MV0A 2E08A 2E0NA 2NPNA 1VCEA 2DXWA 1WDEA 2P6DA 3ND1A 2YBQA 2OWUA 1VA0A 2EGLA 2HUQA 2EMUA 2EHLA 2EK3A 2P6IA 2E16A 3NUTA 2EH5A 2P9DA 1S4DA 2E07A 2PCHA 2DSGA 2E8HA 2EK2A 2PCIA 2EJKA 3UV6A 2EGSA 2E4RA 3SZLA 1VE2A 2DV4A 1PJSA 4MUXA 2DXVA 2HUXA 1PJTA 4H4DA 3UWMA 2EGBA 2YBOA 2PCMA 3SZOA 2PCGA 2PCKA 2DSIA 3F7TA 1WNGA 3FQ6A 3KELA 2HR8A 3FFYA 3KEFA 3TIXB 3UV7A 2EL1A 2E8SA 3ZGLA 1VHVA 2P5CA 4E16A 3KE8A 2PB4A 2EH4A 2HUTA 3NEIA 4MV5A 3LMMA 3I4TA 3NDCA 2DSHA 2BB3A 2DEKA 3KEMA 2EH2A 4H4EA 2EL3A 2EK7A 2EL0A 3T0GA 2OWGA 2E15A 2E17A 3T0FA 2KYYA 2E8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJJ A;  2E4N A;  2EMR A;  2PCA A;  3HH1 A;  2DV5 A;  2PB6 A;  2EJZ A;  2DXX A;  2ELD A;  1WYZ A;  2QBU A;  2OWF A;  2E8Q A;  2E0K A;  2E7R A;  2ZVB A;  1CBF A;  2HUV A;  2EHC A;  2EKA A;  2P2X A;  2OWV A;  2CBF A;  2EEQ A;  2EL2 A;  3KWP A;  2P6L A;  1V9A A;  2DV7 A;  2ED5 A;  2OWK A;  2ELE A;  2ED3 A;  2DV3 A;  2PB5 A;  2ZVC A;  2EK4 A;  2P5F A;  2EN5 A;  5HW4 A;  2ENI A;  2P6K A;  1PJQ A;  2Z6R A;  2E08 A;  2E0N A;  2NPN A;  1VCE A;  2DXW A;  1WDE A;  2P6D A;  3ND1 A;  2YBQ A;  2OWU A;  1VA0 A;  2EGL A;  2HUQ A;  2EMU A;  2EHL A;  2EK3 A;  2P6I A;  2E16 A;  3NUT A;  2EH5 A;  2P9D A;  1S4D A;  2E07 A;  2PCH A;  2DSG A;  2E8H A;  2EK2 A;  2PCI A;  2EJK A;  2EGS A;  2E4R A;  1VE2 A;  2DV4 A;  1PJS A;  2DXV A;  2HUX A;  1PJT A;  2EGB A;  2YBO A;  2PCM A;  2PCG A;  2PCK A;  2DSI A;  1WNG A;  3FQ6 A;  2HR8 A;  3FFY A;  2EL1 A;  2E8S A;  1VHV A;  2P5C A;  4E16 A;  2PB4 A;  2EH4 A;  2HUT A;  3NEI A;  3I4T A;  3NDC A;  2DSH A;  2BB3 A;  2DEK A;  2EH2 A;  2EL3 A;  2EK7 A;  2EL0 A;  2OWG A;  2E15 A;  2E17 A;  2E8R A; 
#chains in the Genus database with same CATH topology
 2EJJ A;  2E4N A;  2EMR A;  2PCA A;  3HH1 A;  2DV5 A;  2PB6 A;  2EJZ A;  4H4C A;  2DXX A;  3URK A;  2ELD A;  1WYZ A;  2QBU A;  4MUY A;  2OWF A;  3ZGN A;  2E8Q A;  3DNF A;  4EB3 A;  2E0K A;  3UTD A;  2E7R A;  2ZVB A;  1CBF A;  2HUV A;  2EHC A;  4N7B A;  2EKA A;  2P2X A;  2OWV A;  3SZU A;  2CBF A;  2EEQ A;  2EL2 A;  3KWP A;  2P6L A;  1V9A A;  2DV7 A;  2ED5 A;  3UTC A;  2OWK A;  2ELE A;  2ED3 A;  2DV3 A;  2PB5 A;  2ZVC A;  3UV3 A;  2EK4 A;  2P5F A;  2EN5 A;  5HW4 A;  2ENI A;  2P6K A;  3KE9 A;  1PJQ A;  2Z6R A;  4MV0 A;  2E08 A;  2E0N A;  2NPN A;  1VCE A;  2DXW A;  1WDE A;  2P6D A;  3ND1 A;  2YBQ A;  2OWU A;  1VA0 A;  2EGL A;  2HUQ A;  2EMU A;  2EHL A;  2EK3 A;  2P6I A;  2E16 A;  3NUT A;  2EH5 A;  2P9D A;  1S4D A;  2E07 A;  2PCH A;  2DSG A;  2E8H A;  2EK2 A;  2PCI A;  2EJK A;  3UV6 A;  2EGS A;  2E4R A;  3SZL A;  1VE2 A;  2DV4 A;  1PJS A;  4MUX A;  2DXV A;  2HUX A;  1PJT A;  4H4D A;  3UWM A;  2EGB A;  2YBO A;  2PCM A;  3SZO A;  2PCG A;  2PCK A;  2DSI A;  3F7T A;  1WNG A;  3FQ6 A;  3KEL A;  2HR8 A;  3FFY A;  3KEF A;  3TIX B;  3UV7 A;  2EL1 A;  2E8S A;  3ZGL A;  1VHV A;  2P5C A;  4E16 A;  3KE8 A;  2PB4 A;  2EH4 A;  2HUT A;  3NEI A;  4MV5 A;  3LMM A;  3I4T A;  3NDC A;  2DSH A;  2BB3 A;  2DEK A;  3KEM A;  2EH2 A;  4H4E A;  2EL3 A;  2EK7 A;  2EL0 A;  3T0G A;  2OWG A;  2E15 A;  2E17 A;  3T0F A;  2KYY A;  2E8R A; 
#chains in the Genus database with same CATH homology
 2EJJ A;  2E4N A;  2EMR A;  2PCA A;  3HH1 A;  2DV5 A;  2PB6 A;  2EJZ A;  4H4C A;  2DXX A;  3URK A;  2ELD A;  1WYZ A;  2QBU A;  4MUY A;  2OWF A;  3ZGN A;  2E8Q A;  3DNF A;  4EB3 A;  2E0K A;  3UTD A;  2E7R A;  2ZVB A;  1CBF A;  2HUV A;  2EHC A;  4N7B A;  2EKA A;  2P2X A;  2OWV A;  3SZU A;  2CBF A;  2EEQ A;  2EL2 A;  3KWP A;  2P6L A;  1V9A A;  2DV7 A;  2ED5 A;  3UTC A;  2OWK A;  2ELE A;  2ED3 A;  2DV3 A;  2PB5 A;  2ZVC A;  3UV3 A;  2EK4 A;  2P5F A;  2EN5 A;  5HW4 A;  2ENI A;  2P6K A;  3KE9 A;  1PJQ A;  2Z6R A;  4MV0 A;  2E08 A;  2E0N A;  2NPN A;  1VCE A;  2DXW A;  1WDE A;  2P6D A;  3ND1 A;  2YBQ A;  2OWU A;  1VA0 A;  2EGL A;  2HUQ A;  2EMU A;  2EHL A;  2EK3 A;  2P6I A;  2E16 A;  3NUT A;  2EH5 A;  2P9D A;  1S4D A;  2E07 A;  2PCH A;  2DSG A;  2E8H A;  2EK2 A;  2PCI A;  2EJK A;  3UV6 A;  2EGS A;  2E4R A;  3SZL A;  1VE2 A;  2DV4 A;  1PJS A;  4MUX A;  2DXV A;  2HUX A;  1PJT A;  4H4D A;  3UWM A;  2EGB A;  2YBO A;  2PCM A;  3SZO A;  2PCG A;  2PCK A;  2DSI A;  3F7T A;  1WNG A;  3FQ6 A;  3KEL A;  2HR8 A;  3FFY A;  3KEF A;  3TIX B;  3UV7 A;  2EL1 A;  2E8S A;  3ZGL A;  1VHV A;  2P5C A;  4E16 A;  3KE8 A;  2PB4 A;  2EH4 A;  2HUT A;  3NEI A;  4MV5 A;  3LMM A;  3I4T A;  3NDC A;  2DSH A;  2BB3 A;  2DEK A;  3KEM A;  2EH2 A;  4H4E A;  2EL3 A;  2EK7 A;  2EL0 A;  3T0G A;  2OWG A;  2E15 A;  2E17 A;  3T0F A;  2KYY A;  2E8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...