3ND1A

Crystal structure of precorrin-6a synthase from rhodobacter capsulatus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
253
structure length
244
Chain Sequence
HMIELSLIGIGTGNPRHITGQAVDAMNAADLILIPLKGADKSDLAGLRRQICAAHLTNPATKVIDFALPVRGVDDWHDAIAETWLSEITAHVPGLEGRVALLVWGDPSLYDSTLRIAERLKSRLPLTTKVIPGITAIQALCAAHAIPLNDIGAPVVITTGRQLRDHGWPAGTETVVAMLDGECSFQSLPPDGLTIFWGACVAMPEEVLIRGPVAEVTDEILQARADLRARHGWVMDIYLLRRNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Precorrin-6A synthase from Rhodobacter capsulatus
rcsb
source organism Rhodobacter capsulatus
molecule tags Transferase
molecule keywords Precorrin-6A synthase/CobF protein
total genus 70
structure length 244
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3nd1A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3nd1A01
2EL1A 2OWUA 2DV3A 3NEIA 2E0KA 2ED5A 2PCKA 2PB6A 2EKAA 1PJQA 2P6IA 2DSGA 2E0NA 2EJKA 2EJZA 2EJJA 2PB5A 2PCHA 2EGBA 2YBOA 2E8HA 2EN5A 2HUXA 2ZVCA 3FQ6A 2PB4A 1WDEA 2DSHA 2E4NA 2E17A 2HR8A 2E4RA 2EH2A 2EEQA 1CBFA 2P6LA 2E8RA 1VE2A 1PJTA 2E8SA 2OWVA 2E07A 1WYZA 1WNGA 2PCGA 2BB3A 2DV7A 3HH1A 2DV5A 3NUTA 2EMUA 2EH5A 2DXXA 2NPNA 2EL0A 2P5CA 2DXWA 1VHVA 2E16A 2E15A 2EK7A 2ED3A 3FFYA 1VCEA 2CBFA 2ELDA 2QBUA 2HUVA 2E7RA 2OWGA 2YBQA 2DXVA 2OWFA 2EL2A 2P2XA 1PJSA 2EMRA 2ELEA 2OWKA 2PCMA 4E16A 2EK3A 2HUTA 1VA0A 3KWPA 1V9AA 2EGLA 2EHLA 2DEKA 2EK2A 2Z6RA 2EHCA 2PCIA 2HUQA 2E8QA 2EL3A 2P5FA 2P6KA 2E08A 2P6DA 2ZVBA 2EH4A 2DV4A 2P9DA 3NDCA 2DSIA 2EGSA 2PCAA 3ND1A 5HW4A 2EK4A 1S4DA 2ENIA 3I4TA
chains in the Genus database with same CATH superfamily
2EL1A 2OWUA 2DV3A 4H4CA 4MUYA 3SZLA 3NEIA 2E0KA 4MV5A 2ED5A 2PCKA 2PB6A 2EKAA 3UV3A 1PJQA 2P6IA 3UTCA 4H4EA 2DSGA 2E0NA 2EJKA 2EJZA 2EJJA 4MUXA 2PB5A 3TIXB 2PCHA 2EGBA 2YBOA 2E8HA 2EN5A 2HUXA 2ZVCA 3FQ6A 2PB4A 1WDEA 4H4DA 2DSHA 3KEMA 2E4NA 2E17A 3ZGNA 3T0GA 2HR8A 2E4RA 2EH2A 2EEQA 3DNFA 1CBFA 2P6LA 2E8RA 3URKA 1VE2A 1PJTA 2E8SA 2OWVA 3LMMA 2E07A 1WYZA 1WNGA 2PCGA 2BB3A 2DV7A 3KELA 3UTDA 3UV7A 3HH1A 4N7BA 2DV5A 3NUTA 2EMUA 2EH5A 2DXXA 2NPNA 2EL0A 2P5CA 2DXWA 1VHVA 2E16A 2KYYA 3KE9A 2E15A 2EK7A 2ED3A 3FFYA 1VCEA 2CBFA 2ELDA 2QBUA 2HUVA 3T0FA 2E7RA 2OWGA 2YBQA 2DXVA 2OWFA 2EL2A 2P2XA 3KEFA 1PJSA 2EMRA 2ELEA 2OWKA 3UWMA 2PCMA 4E16A 2EK3A 2HUTA 1VA0A 4EB3A 3KWPA 1V9AA 2EGLA 2EHLA 2DEKA 2EK2A 2Z6RA 2EHCA 2PCIA 3UV6A 2HUQA 3F7TA 3KE8A 3SZOA 2E8QA 2EL3A 2P5FA 2P6KA 2E08A 2P6DA 2ZVBA 2EH4A 2DV4A 2P9DA 4MV0A 3NDCA 2DSIA 2EGSA 2PCAA 3ND1A 5HW4A 2EK4A 1S4DA 3SZUA 3ZGLA 2ENIA 3I4TA
chains in the Genus database with same CATH topology
2EL1A 2OWUA 2DV3A 4H4CA 4MUYA 3SZLA 3NEIA 2E0KA 4MV5A 2ED5A 2PCKA 2PB6A 2EKAA 3UV3A 1PJQA 2P6IA 3UTCA 4H4EA 2DSGA 2E0NA 2EJKA 2EJZA 2EJJA 4MUXA 2PB5A 3TIXB 2PCHA 2EGBA 2YBOA 2E8HA 2EN5A 2HUXA 2ZVCA 3FQ6A 2PB4A 1WDEA 4H4DA 2DSHA 3KEMA 2E4NA 2E17A 3ZGNA 3T0GA 2HR8A 2E4RA 2EH2A 2EEQA 3DNFA 1CBFA 2P6LA 2E8RA 3URKA 1VE2A 1PJTA 2E8SA 2OWVA 3LMMA 2E07A 1WYZA 1WNGA 2PCGA 2BB3A 2DV7A 3KELA 3UTDA 3UV7A 3HH1A 4N7BA 2DV5A 3NUTA 2EMUA 2EH5A 2DXXA 2NPNA 2EL0A 2P5CA 2DXWA 1VHVA 2E16A 2KYYA 3KE9A 2E15A 2EK7A 2ED3A 3FFYA 1VCEA 2CBFA 2ELDA 2QBUA 2HUVA 3T0FA 2E7RA 2OWGA 2YBQA 2DXVA 2OWFA 2EL2A 2P2XA 3KEFA 1PJSA 2EMRA 2ELEA 2OWKA 3UWMA 2PCMA 4E16A 2EK3A 2HUTA 1VA0A 4EB3A 3KWPA 1V9AA 2EGLA 2EHLA 2DEKA 2EK2A 2Z6RA 2EHCA 2PCIA 3UV6A 2HUQA 3F7TA 3KE8A 3SZOA 2E8QA 2EL3A 2P5FA 2P6KA 2E08A 2P6DA 2ZVBA 2EH4A 2DV4A 2P9DA 4MV0A 3NDCA 2DSIA 2EGSA 2PCAA 3ND1A 5HW4A 2EK4A 1S4DA 3SZUA 3ZGLA 2ENIA 3I4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EL1 A;  2OWU A;  2DV3 A;  3NEI A;  2E0K A;  2ED5 A;  2PCK A;  2PB6 A;  2EKA A;  1PJQ A;  2P6I A;  2DSG A;  2E0N A;  2EJK A;  2EJZ A;  2EJJ A;  2PB5 A;  2PCH A;  2EGB A;  2YBO A;  2E8H A;  2EN5 A;  2HUX A;  2ZVC A;  3FQ6 A;  2PB4 A;  1WDE A;  2DSH A;  2E4N A;  2E17 A;  2HR8 A;  2E4R A;  2EH2 A;  2EEQ A;  1CBF A;  2P6L A;  2E8R A;  1VE2 A;  1PJT A;  2E8S A;  2OWV A;  2E07 A;  1WYZ A;  1WNG A;  2PCG A;  2BB3 A;  2DV7 A;  3HH1 A;  2DV5 A;  3NUT A;  2EMU A;  2EH5 A;  2DXX A;  2NPN A;  2EL0 A;  2P5C A;  2DXW A;  1VHV A;  2E16 A;  2E15 A;  2EK7 A;  2ED3 A;  3FFY A;  1VCE A;  2CBF A;  2ELD A;  2QBU A;  2HUV A;  2E7R A;  2OWG A;  2YBQ A;  2DXV A;  2OWF A;  2EL2 A;  2P2X A;  1PJS A;  2EMR A;  2ELE A;  2OWK A;  2PCM A;  4E16 A;  2EK3 A;  2HUT A;  1VA0 A;  3KWP A;  1V9A A;  2EGL A;  2EHL A;  2DEK A;  2EK2 A;  2Z6R A;  2EHC A;  2PCI A;  2HUQ A;  2E8Q A;  2EL3 A;  2P5F A;  2P6K A;  2E08 A;  2P6D A;  2ZVB A;  2EH4 A;  2DV4 A;  2P9D A;  3NDC A;  2DSI A;  2EGS A;  2PCA A;  3ND1 A;  5HW4 A;  2EK4 A;  1S4D A;  2ENI A;  3I4T A; 
#chains in the Genus database with same CATH topology
 2EL1 A;  2OWU A;  2DV3 A;  4H4C A;  4MUY A;  3SZL A;  3NEI A;  2E0K A;  4MV5 A;  2ED5 A;  2PCK A;  2PB6 A;  2EKA A;  3UV3 A;  1PJQ A;  2P6I A;  3UTC A;  4H4E A;  2DSG A;  2E0N A;  2EJK A;  2EJZ A;  2EJJ A;  4MUX A;  2PB5 A;  3TIX B;  2PCH A;  2EGB A;  2YBO A;  2E8H A;  2EN5 A;  2HUX A;  2ZVC A;  3FQ6 A;  2PB4 A;  1WDE A;  4H4D A;  2DSH A;  3KEM A;  2E4N A;  2E17 A;  3ZGN A;  3T0G A;  2HR8 A;  2E4R A;  2EH2 A;  2EEQ A;  3DNF A;  1CBF A;  2P6L A;  2E8R A;  3URK A;  1VE2 A;  1PJT A;  2E8S A;  2OWV A;  3LMM A;  2E07 A;  1WYZ A;  1WNG A;  2PCG A;  2BB3 A;  2DV7 A;  3KEL A;  3UTD A;  3UV7 A;  3HH1 A;  4N7B A;  2DV5 A;  3NUT A;  2EMU A;  2EH5 A;  2DXX A;  2NPN A;  2EL0 A;  2P5C A;  2DXW A;  1VHV A;  2E16 A;  2KYY A;  3KE9 A;  2E15 A;  2EK7 A;  2ED3 A;  3FFY A;  1VCE A;  2CBF A;  2ELD A;  2QBU A;  2HUV A;  3T0F A;  2E7R A;  2OWG A;  2YBQ A;  2DXV A;  2OWF A;  2EL2 A;  2P2X A;  3KEF A;  1PJS A;  2EMR A;  2ELE A;  2OWK A;  3UWM A;  2PCM A;  4E16 A;  2EK3 A;  2HUT A;  1VA0 A;  4EB3 A;  3KWP A;  1V9A A;  2EGL A;  2EHL A;  2DEK A;  2EK2 A;  2Z6R A;  2EHC A;  2PCI A;  3UV6 A;  2HUQ A;  3F7T A;  3KE8 A;  3SZO A;  2E8Q A;  2EL3 A;  2P5F A;  2P6K A;  2E08 A;  2P6D A;  2ZVB A;  2EH4 A;  2DV4 A;  2P9D A;  4MV0 A;  3NDC A;  2DSI A;  2EGS A;  2PCA A;  3ND1 A;  5HW4 A;  2EK4 A;  1S4D A;  3SZU A;  3ZGL A;  2ENI A;  3I4T A; 
#chains in the Genus database with same CATH homology
 2EL1 A;  2OWU A;  2DV3 A;  4H4C A;  4MUY A;  3SZL A;  3NEI A;  2E0K A;  4MV5 A;  2ED5 A;  2PCK A;  2PB6 A;  2EKA A;  3UV3 A;  1PJQ A;  2P6I A;  3UTC A;  4H4E A;  2DSG A;  2E0N A;  2EJK A;  2EJZ A;  2EJJ A;  4MUX A;  2PB5 A;  3TIX B;  2PCH A;  2EGB A;  2YBO A;  2E8H A;  2EN5 A;  2HUX A;  2ZVC A;  3FQ6 A;  2PB4 A;  1WDE A;  4H4D A;  2DSH A;  3KEM A;  2E4N A;  2E17 A;  3ZGN A;  3T0G A;  2HR8 A;  2E4R A;  2EH2 A;  2EEQ A;  3DNF A;  1CBF A;  2P6L A;  2E8R A;  3URK A;  1VE2 A;  1PJT A;  2E8S A;  2OWV A;  3LMM A;  2E07 A;  1WYZ A;  1WNG A;  2PCG A;  2BB3 A;  2DV7 A;  3KEL A;  3UTD A;  3UV7 A;  3HH1 A;  4N7B A;  2DV5 A;  3NUT A;  2EMU A;  2EH5 A;  2DXX A;  2NPN A;  2EL0 A;  2P5C A;  2DXW A;  1VHV A;  2E16 A;  2KYY A;  3KE9 A;  2E15 A;  2EK7 A;  2ED3 A;  3FFY A;  1VCE A;  2CBF A;  2ELD A;  2QBU A;  2HUV A;  3T0F A;  2E7R A;  2OWG A;  2YBQ A;  2DXV A;  2OWF A;  2EL2 A;  2P2X A;  3KEF A;  1PJS A;  2EMR A;  2ELE A;  2OWK A;  3UWM A;  2PCM A;  4E16 A;  2EK3 A;  2HUT A;  1VA0 A;  4EB3 A;  3KWP A;  1V9A A;  2EGL A;  2EHL A;  2DEK A;  2EK2 A;  2Z6R A;  2EHC A;  2PCI A;  3UV6 A;  2HUQ A;  3F7T A;  3KE8 A;  3SZO A;  2E8Q A;  2EL3 A;  2P5F A;  2P6K A;  2E08 A;  2P6D A;  2ZVB A;  2EH4 A;  2DV4 A;  2P9D A;  4MV0 A;  3NDC A;  2DSI A;  2EGS A;  2PCA A;  3ND1 A;  5HW4 A;  2EK4 A;  1S4D A;  3SZU A;  3ZGL A;  2ENI A;  3I4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...