3ND1A

Crystal structure of precorrin-6a synthase from rhodobacter capsulatus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
253
structure length
244
Chain Sequence
b'HMIELSLIGIGTGNPRHITGQAVDAMNAADLILIPLKGADKSDLAGLRRQICAAHLTNPATKVIDFALPVRGVDDWHDAIAETWLSEITAHVPGLEGRVALLVWGDPSLYDSTLRIAERLKSRLPLTTKVIPGITAIQALCAAHAIPLNDIGAPVVITTGRQLRDHGWPAGTETVVAMLDGECSFQSLPPDGLTIFWGACVAMPEEVLIRGPVAEVTDEILQARADLRARHGWVMDIYLLRRNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Precorrin-6A synthase/CobF protein
publication title Crystal structure of Precorrin-6A synthase from Rhodobacter capsulatus
rcsb
source organism Rhodobacter capsulatus
molecule tags Transferase
total genus 70
structure length 244
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2010-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3nd1A02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3nd1A01
2HR8A 2P6DA 2NPNA 2PCAA 2E16A 2Z6RA 2E15A 2EGBA 2ELDA 1PJTA 2DSHA 2EGSA 2EL2A 2DEKA 2EK3A 2P9DA 2E7RA 2EL3A 3NUTA 2P5FA 2E4NA 2ELEA 2EH5A 1CBFA 3FFYA 2ZVCA 1VCEA 2EHLA 2E8SA 2EKAA 2E8HA 2OWUA 1VHVA 3I4TA 2PCIA 2BB3A 1PJSA 2DXVA 1WNGA 1PJQA 2EJZA 2OWGA 2DSGA 2PCHA 2HUTA 2EH4A 2E4RA 2EGLA 2EMUA 2DSIA 2ZVBA 2EK4A 2PCGA 2HUVA 1VE2A 2ENIA 2EN5A 2EJJA 2OWKA 2QBUA 2DV3A 2E08A 2HUQA 2E0KA 2PCMA 1V9AA 2HUXA 2CBFA 2EEQA 3NEIA 2P6IA 2PB4A 2ED5A 2E0NA 2DXWA 3FQ6A 2EL0A 2YBOA 2ED3A 2PB6A 2DV5A 5HW4A 1WDEA 3ND1A 2OWVA 2DV4A 3KWPA 2EJKA 3NDCA 2YBQA 1WYZA 2E8RA 2EMRA 1VA0A 2PCKA 2EK7A 2EL1A 2OWFA 2P6LA 2PB5A 2P6KA 2P2XA 3HH1A 1S4DA 2DV7A 2EHCA 2E17A 4E16A 2DXXA 2E8QA 2E07A 2EH2A 2P5CA 2EK2A
chains in the Genus database with same CATH superfamily
2HR8A 2P6DA 2NPNA 2PCAA 3T0FA 2E16A 2Z6RA 4H4EA 2E15A 4H4DA 2EGBA 3UV7A 2ELDA 1PJTA 4MUYA 3URKA 2DSHA 2EGSA 2EL2A 2DEKA 2EK3A 2P9DA 2E7RA 2EL3A 3NUTA 2P5FA 2E4NA 4N7BA 2ELEA 3UV6A 3F7TA 2EH5A 1CBFA 3FFYA 2ZVCA 4H4CA 3TIXB 1VCEA 2EHLA 2E8SA 2EKAA 2E8HA 2OWUA 1VHVA 3I4TA 2PCIA 2KYYA 2BB3A 1PJSA 2DXVA 1WNGA 3T0GA 1PJQA 2EJZA 2OWGA 2DSGA 2PCHA 2HUTA 3UWMA 4MV0A 2EH4A 3LMMA 3ZGNA 2E4RA 2EGLA 2EMUA 2DSIA 2ZVBA 2EK4A 2PCGA 2HUVA 1VE2A 2ENIA 2EN5A 2EJJA 2OWKA 2QBUA 3UTDA 2DV3A 2E08A 4EB3A 2HUQA 2E0KA 2PCMA 1V9AA 2HUXA 2CBFA 2EEQA 3NEIA 2P6IA 3KELA 2PB4A 2ED5A 3SZLA 2E0NA 2DXWA 3FQ6A 2EL0A 2YBOA 2ED3A 2PB6A 3UV3A 2DV5A 5HW4A 1WDEA 3ND1A 2OWVA 2DV4A 3KWPA 2EJKA 3SZUA 3NDCA 2YBQA 3KE8A 3KEFA 3SZOA 3KEMA 1WYZA 2E8RA 2EMRA 1VA0A 2PCKA 2EK7A 2EL1A 3DNFA 2OWFA 2P6LA 2PB5A 3ZGLA 2P6KA 2P2XA 3HH1A 1S4DA 2DV7A 4MUXA 2EHCA 2E17A 4E16A 2DXXA 2E8QA 2E07A 3UTCA 2EH2A 2P5CA 4MV5A 2EK2A 3KE9A
chains in the Genus database with same CATH topology
2HR8A 2P6DA 2NPNA 2PCAA 3T0FA 2E16A 2Z6RA 4H4EA 2E15A 4H4DA 2EGBA 3UV7A 2ELDA 1PJTA 4MUYA 3URKA 2DSHA 2EGSA 2EL2A 2DEKA 2EK3A 2P9DA 2E7RA 2EL3A 3NUTA 2P5FA 2E4NA 4N7BA 2ELEA 3UV6A 3F7TA 2EH5A 1CBFA 3FFYA 2ZVCA 4H4CA 3TIXB 1VCEA 2EHLA 2E8SA 2EKAA 2E8HA 2OWUA 1VHVA 3I4TA 2PCIA 2KYYA 2BB3A 1PJSA 2DXVA 1WNGA 3T0GA 1PJQA 2EJZA 2OWGA 2DSGA 2PCHA 2HUTA 3UWMA 4MV0A 2EH4A 3LMMA 3ZGNA 2E4RA 2EGLA 2EMUA 2DSIA 2ZVBA 2EK4A 2PCGA 2HUVA 1VE2A 2ENIA 2EN5A 2EJJA 2OWKA 2QBUA 3UTDA 2DV3A 2E08A 4EB3A 2HUQA 2E0KA 2PCMA 1V9AA 2HUXA 2CBFA 2EEQA 3NEIA 2P6IA 3KELA 2PB4A 2ED5A 3SZLA 2E0NA 2DXWA 3FQ6A 2EL0A 2YBOA 2ED3A 2PB6A 3UV3A 2DV5A 5HW4A 1WDEA 3ND1A 2OWVA 2DV4A 3KWPA 2EJKA 3SZUA 3NDCA 2YBQA 3KE8A 3KEFA 3SZOA 3KEMA 1WYZA 2E8RA 2EMRA 1VA0A 2PCKA 2EK7A 2EL1A 3DNFA 2OWFA 2P6LA 2PB5A 3ZGLA 2P6KA 2P2XA 3HH1A 1S4DA 2DV7A 4MUXA 2EHCA 2E17A 4E16A 2DXXA 2E8QA 2E07A 3UTCA 2EH2A 2P5CA 4MV5A 2EK2A 3KE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR8 A;  2P6D A;  2NPN A;  2PCA A;  2E16 A;  2Z6R A;  2E15 A;  2EGB A;  2ELD A;  1PJT A;  2DSH A;  2EGS A;  2EL2 A;  2DEK A;  2EK3 A;  2P9D A;  2E7R A;  2EL3 A;  3NUT A;  2P5F A;  2E4N A;  2ELE A;  2EH5 A;  1CBF A;  3FFY A;  2ZVC A;  1VCE A;  2EHL A;  2E8S A;  2EKA A;  2E8H A;  2OWU A;  1VHV A;  3I4T A;  2PCI A;  2BB3 A;  1PJS A;  2DXV A;  1WNG A;  1PJQ A;  2EJZ A;  2OWG A;  2DSG A;  2PCH A;  2HUT A;  2EH4 A;  2E4R A;  2EGL A;  2EMU A;  2DSI A;  2ZVB A;  2EK4 A;  2PCG A;  2HUV A;  1VE2 A;  2ENI A;  2EN5 A;  2EJJ A;  2OWK A;  2QBU A;  2DV3 A;  2E08 A;  2HUQ A;  2E0K A;  2PCM A;  1V9A A;  2HUX A;  2CBF A;  2EEQ A;  3NEI A;  2P6I A;  2PB4 A;  2ED5 A;  2E0N A;  2DXW A;  3FQ6 A;  2EL0 A;  2YBO A;  2ED3 A;  2PB6 A;  2DV5 A;  5HW4 A;  1WDE A;  3ND1 A;  2OWV A;  2DV4 A;  3KWP A;  2EJK A;  3NDC A;  2YBQ A;  1WYZ A;  2E8R A;  2EMR A;  1VA0 A;  2PCK A;  2EK7 A;  2EL1 A;  2OWF A;  2P6L A;  2PB5 A;  2P6K A;  2P2X A;  3HH1 A;  1S4D A;  2DV7 A;  2EHC A;  2E17 A;  4E16 A;  2DXX A;  2E8Q A;  2E07 A;  2EH2 A;  2P5C A;  2EK2 A; 
#chains in the Genus database with same CATH topology
 2HR8 A;  2P6D A;  2NPN A;  2PCA A;  3T0F A;  2E16 A;  2Z6R A;  4H4E A;  2E15 A;  4H4D A;  2EGB A;  3UV7 A;  2ELD A;  1PJT A;  4MUY A;  3URK A;  2DSH A;  2EGS A;  2EL2 A;  2DEK A;  2EK3 A;  2P9D A;  2E7R A;  2EL3 A;  3NUT A;  2P5F A;  2E4N A;  4N7B A;  2ELE A;  3UV6 A;  3F7T A;  2EH5 A;  1CBF A;  3FFY A;  2ZVC A;  4H4C A;  3TIX B;  1VCE A;  2EHL A;  2E8S A;  2EKA A;  2E8H A;  2OWU A;  1VHV A;  3I4T A;  2PCI A;  2KYY A;  2BB3 A;  1PJS A;  2DXV A;  1WNG A;  3T0G A;  1PJQ A;  2EJZ A;  2OWG A;  2DSG A;  2PCH A;  2HUT A;  3UWM A;  4MV0 A;  2EH4 A;  3LMM A;  3ZGN A;  2E4R A;  2EGL A;  2EMU A;  2DSI A;  2ZVB A;  2EK4 A;  2PCG A;  2HUV A;  1VE2 A;  2ENI A;  2EN5 A;  2EJJ A;  2OWK A;  2QBU A;  3UTD A;  2DV3 A;  2E08 A;  4EB3 A;  2HUQ A;  2E0K A;  2PCM A;  1V9A A;  2HUX A;  2CBF A;  2EEQ A;  3NEI A;  2P6I A;  3KEL A;  2PB4 A;  2ED5 A;  3SZL A;  2E0N A;  2DXW A;  3FQ6 A;  2EL0 A;  2YBO A;  2ED3 A;  2PB6 A;  3UV3 A;  2DV5 A;  5HW4 A;  1WDE A;  3ND1 A;  2OWV A;  2DV4 A;  3KWP A;  2EJK A;  3SZU A;  3NDC A;  2YBQ A;  3KE8 A;  3KEF A;  3SZO A;  3KEM A;  1WYZ A;  2E8R A;  2EMR A;  1VA0 A;  2PCK A;  2EK7 A;  2EL1 A;  3DNF A;  2OWF A;  2P6L A;  2PB5 A;  3ZGL A;  2P6K A;  2P2X A;  3HH1 A;  1S4D A;  2DV7 A;  4MUX A;  2EHC A;  2E17 A;  4E16 A;  2DXX A;  2E8Q A;  2E07 A;  3UTC A;  2EH2 A;  2P5C A;  4MV5 A;  2EK2 A;  3KE9 A; 
#chains in the Genus database with same CATH homology
 2HR8 A;  2P6D A;  2NPN A;  2PCA A;  3T0F A;  2E16 A;  2Z6R A;  4H4E A;  2E15 A;  4H4D A;  2EGB A;  3UV7 A;  2ELD A;  1PJT A;  4MUY A;  3URK A;  2DSH A;  2EGS A;  2EL2 A;  2DEK A;  2EK3 A;  2P9D A;  2E7R A;  2EL3 A;  3NUT A;  2P5F A;  2E4N A;  4N7B A;  2ELE A;  3UV6 A;  3F7T A;  2EH5 A;  1CBF A;  3FFY A;  2ZVC A;  4H4C A;  3TIX B;  1VCE A;  2EHL A;  2E8S A;  2EKA A;  2E8H A;  2OWU A;  1VHV A;  3I4T A;  2PCI A;  2KYY A;  2BB3 A;  1PJS A;  2DXV A;  1WNG A;  3T0G A;  1PJQ A;  2EJZ A;  2OWG A;  2DSG A;  2PCH A;  2HUT A;  3UWM A;  4MV0 A;  2EH4 A;  3LMM A;  3ZGN A;  2E4R A;  2EGL A;  2EMU A;  2DSI A;  2ZVB A;  2EK4 A;  2PCG A;  2HUV A;  1VE2 A;  2ENI A;  2EN5 A;  2EJJ A;  2OWK A;  2QBU A;  3UTD A;  2DV3 A;  2E08 A;  4EB3 A;  2HUQ A;  2E0K A;  2PCM A;  1V9A A;  2HUX A;  2CBF A;  2EEQ A;  3NEI A;  2P6I A;  3KEL A;  2PB4 A;  2ED5 A;  3SZL A;  2E0N A;  2DXW A;  3FQ6 A;  2EL0 A;  2YBO A;  2ED3 A;  2PB6 A;  3UV3 A;  2DV5 A;  5HW4 A;  1WDE A;  3ND1 A;  2OWV A;  2DV4 A;  3KWP A;  2EJK A;  3SZU A;  3NDC A;  2YBQ A;  3KE8 A;  3KEF A;  3SZO A;  3KEM A;  1WYZ A;  2E8R A;  2EMR A;  1VA0 A;  2PCK A;  2EK7 A;  2EL1 A;  3DNF A;  2OWF A;  2P6L A;  2PB5 A;  3ZGL A;  2P6K A;  2P2X A;  3HH1 A;  1S4D A;  2DV7 A;  4MUX A;  2EHC A;  2E17 A;  4E16 A;  2DXX A;  2E8Q A;  2E07 A;  3UTC A;  2EH2 A;  2P5C A;  4MV5 A;  2EK2 A;  3KE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...