2OPEA

Crystal structure of the neisseria meningitidis minor type iv pilin, pilx, in space group p43
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
FEKGYQSQLYTEMVGINNISKQFILKNPLDDNQTIKSKLERFVSGYKMNPKIAEKYNVSVHFVNKEKPRAYSLVGVPKTGTGYTLSVWMNSVGDGYKCRDAASARAHLETLSSDVGCEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilX
publication title 3D structure/function analysis of PilX reveals how minor pilins can modulate the virulence properties of type IV pili.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Cell adhesion
total genus 36
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11530 Pilin_PilX Minor type IV pilin, PilX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.20 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase; Chain A, domain 1 2opeA00
2OPEA 2OPDA
chains in the Genus database with same CATH superfamily
2BJIA 2OPDA 2P3NA 1IMDA 3IFAA 4GBWA 4H46A 4IR8A 1FPJA 4I3EA 4GWUA 1LBZA 1INPA 5IZ3A 1K9YA 5DW8A 1K9ZA 3FBPA 4O7IA 5T3JA 1NI9A 1IMAA 1EYIA 4GX6A 4GWXA 5ET5A 1DCUA 2WEFA 1FPBA 2GQ1A 1FTAA 5ET8A 2PCRA 3RPLB 1FBEA 1FJ6A 1NUXA 4QXDA 1FPGA 2R8TA 5IZ3B 1YYZA 2OWZA 3BIHA 4G61A 1KA0A 3LV0A 3KC1A 4MJOA 5ET7A 5I3SA 5ESYA 5A5LA 2CZIA 1D9QA 4GWWA 1FPDA 4GBVA 2JJKA 5EQ8A 2QVUA 1FPEA 1FRPA 1IMEA 4KXPA 5EYGA 2FHYA 1FBGA 1IMFA 2QFLA 4HXVA 3T0JA 1NUWA 1DBZA 2F3DA 2P3VA 2Y5KA 2F3BA 2OPEA 1G0IA 4I40A 1LBWA 5EQAA 2WBDA 3A29A 1LBYA 1CNQA 2DDKA 4HE1A 1RDZA 2WBBA 5EQ9A 2QVVA 5EQ7A 3LUZA 1LBXA 2FIXA 5LDZA 2FIEA 1NV6A 2CZKA 1IMBA 1FPLA 3RPLA 1EYKA 1FBHA 1YZ0A 3KBZA 1NV2A 3KC0A 2FVZA 4N81A 4HE2A 3D1RA 1NUZA 1EYJA 2Y5LA 1NV1A 3RYDA 1JP4A 5ET6A 3IFCA 1LBVA 1FPFA 3B8BA 4AS4A 1NUYA 1AWBA 4GWSA 1RDXA 1FJ9A 2HHMA 1NV3A 4HE0A 1FBFA 5IZ1A 1QGXA 1FSAA 1KA1A 1FPKA 1NV5A 1FBCA 1VDWA 4GWYA 1BK4A 4I3YA 3ROJA 1FBPA 1LEVA 1NV0A 5EYHA 2FBPA 1IMCA 3BIGA 4H45A 1G0HA 2VT5A 4GX3A 1YXIA 2Q8MA 2Q74A 1DK4A 4GWZA 2CZHA 1SPIA 1KZ8A 2OX3A 1NV7A 1FBDA 5J16A 4PTKA 5F24A 3QMFA 5FBPA 1Q9DA 2QVRA 1NV4A 4GX4A 4AS5A 1XI6A 1FPIA 1RDYA 4FBPA
chains in the Genus database with same CATH topology
2OPEA 2OPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPE A;  2OPD A; 
#chains in the Genus database with same CATH topology
 2BJI A;  2OPD A;  2P3N A;  1IMD A;  3IFA A;  4GBW A;  4H46 A;  4IR8 A;  1FPJ A;  4I3E A;  4GWU A;  1LBZ A;  1INP A;  5IZ3 A;  1K9Y A;  5DW8 A;  1K9Z A;  3FBP A;  4O7I A;  5T3J A;  1NI9 A;  1IMA A;  1EYI A;  4GX6 A;  4GWX A;  5ET5 A;  1DCU A;  2WEF A;  1FPB A;  2GQ1 A;  1FTA A;  5ET8 A;  2PCR A;  3RPL B;  1FBE A;  1FJ6 A;  1NUX A;  4QXD A;  1FPG A;  2R8T A;  5IZ3 B;  1YYZ A;  2OWZ A;  3BIH A;  4G61 A;  1KA0 A;  3LV0 A;  3KC1 A;  4MJO A;  5ET7 A;  5I3S A;  5ESY A;  5A5L A;  2CZI A;  1D9Q A;  4GWW A;  1FPD A;  4GBV A;  2JJK A;  5EQ8 A;  2QVU A;  1FPE A;  1FRP A;  1IME A;  4KXP A;  5EYG A;  2FHY A;  1FBG A;  1IMF A;  2QFL A;  4HXV A;  3T0J A;  1NUW A;  1DBZ A;  2F3D A;  2P3V A;  2Y5K A;  2F3B A;  2OPE A;  1G0I A;  4I40 A;  1LBW A;  5EQA A;  2WBD A;  3A29 A;  1LBY A;  1CNQ A;  2DDK A;  4HE1 A;  1RDZ A;  2WBB A;  5EQ9 A;  2QVV A;  5EQ7 A;  3LUZ A;  1LBX A;  2FIX A;  5LDZ A;  2FIE A;  1NV6 A;  2CZK A;  1IMB A;  1FPL A;  3RPL A;  1EYK A;  1FBH A;  1YZ0 A;  3KBZ A;  1NV2 A;  3KC0 A;  2FVZ A;  4N81 A;  4HE2 A;  3D1R A;  1NUZ A;  1EYJ A;  2Y5L A;  1NV1 A;  3RYD A;  1JP4 A;  5ET6 A;  3IFC A;  1LBV A;  1FPF A;  3B8B A;  4AS4 A;  1NUY A;  1AWB A;  4GWS A;  1RDX A;  1FJ9 A;  2HHM A;  1NV3 A;  4HE0 A;  1FBF A;  5IZ1 A;  1QGX A;  1FSA A;  1KA1 A;  1FPK A;  1NV5 A;  1FBC A;  1VDW A;  4GWY A;  1BK4 A;  4I3Y A;  3ROJ A;  1FBP A;  1LEV A;  1NV0 A;  5EYH A;  2FBP A;  1IMC A;  3BIG A;  4H45 A;  1G0H A;  2VT5 A;  4GX3 A;  1YXI A;  2Q8M A;  2Q74 A;  1DK4 A;  4GWZ A;  2CZH A;  1SPI A;  1KZ8 A;  2OX3 A;  1NV7 A;  1FBD A;  5J16 A;  4PTK A;  5F24 A;  3QMF A;  5FBP A;  1Q9D A;  2QVR A;  1NV4 A;  4GX4 A;  4AS5 A;  1XI6 A;  1FPI A;  1RDY A;  4FBP A; 
#chains in the Genus database with same CATH homology
 2OPE A;  2OPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...