2OPEA

Crystal structure of the neisseria meningitidis minor type iv pilin, pilx, in space group p43
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
FEKGYQSQLYTEMVGINNISKQFILKNPLDDNQTIKSKLERFVSGYKMNPKIAEKYNVSVHFVNKEKPRAYSLVGVPKTGTGYTLSVWMNSVGDGYKCRDAASARAHLETLSSDVGCEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilX
publication title 3D structure/function analysis of PilX reveals how minor pilins can modulate the virulence properties of type IV pili.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Cell adhesion
total genus 36
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11530 Pilin_PilX Minor type IV pilin, PilX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.20 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase; Chain A, domain 1 2opeA00
2OPDA 2OPEA
chains in the Genus database with same CATH superfamily
1YYZA 2F3BA 1FJ9A 1INPA 1FPGA 3KBZA 1K9YA 4O7IA 5IZ1A 5EYGA 3KC1A 1FTAA 4IR8A 1FBFA 1DCUA 2HHMA 5IZ3A 2QFLA 1CNQA 3KC0A 1NV4A 2F3DA 1NV2A 1LBXA 2QVVA 1RDYA 1FBPA 5IZ3B 1LBWA 4GWZA 3ROJA 1NUXA 2QVUA 2FBPA 2PCRA 4GBVA 1FRPA 5ET7A 1AWBA 1DK4A 1FPIA 3D1RA 4HE2A 4H46A 4I3YA 1IMCA 3A29A 1NUWA 1K9ZA 1DBZA 2FVZA 5ET5A 3IFCA 1BK4A 5LDZA 2Q8MA 4AS4A 1G0IA 1NI9A 4N81A 3T0JA 1EYJA 3BIGA 5EQ7A 1IMDA 5A5LA 4HXVA 1LBVA 1FPLA 1QGXA 1KZ8A 1LEVA 1EYIA 1LBYA 1FPKA 1NV0A 1FPEA 3QMFA 1FBDA 5DW8A 1D9QA 1FPJA 5FBPA 5J16A 5EQ8A 1FPDA 1KA1A 1IMEA 4MJOA 1SPIA 4PTKA 2WBBA 4GX6A 2Q74A 4GWXA 2OPDA 1G0HA 4GWSA 4GWYA 5EYHA 1NV5A 1YXIA 2P3VA 4GWUA 1NV6A 2WEFA 4KXPA 1IMAA 2CZIA 2Y5KA 2FHYA 2P3NA 4GX4A 1YZ0A 1NV1A 2VT5A 2Y5LA 4H45A 2JJKA 1NV3A 5F24A 3LUZA 1IMBA 1RDZA 4GBWA 4GWWA 1FJ6A 1FPBA 2R8TA 3RYDA 3BIHA 5ESYA 2FIXA 2CZKA 2BJIA 1EYKA 1LBZA 1NUYA 2WBDA 3B8BA 2OWZA 5T3JA 4HE0A 1Q9DA 1IMFA 2CZHA 1KA0A 3IFAA 4G61A 2GQ1A 5EQAA 2OPEA 4FBPA 1NV7A 5ET8A 1FBGA 1FBHA 1FSAA 4AS5A 2FIEA 4I3EA 1XI6A 2QVRA 1JP4A 4GX3A 3RPLA 2OX3A 3LV0A 5EQ9A 1NUZA 3FBPA 5ET6A 1FPFA 4I40A 1FBCA 1VDWA 3RPLB 2DDKA 4QXDA 5I3SA 1RDXA 1FBEA 4HE1A
chains in the Genus database with same CATH topology
2OPDA 2OPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPD A;  2OPE A; 
#chains in the Genus database with same CATH topology
 1YYZ A;  2F3B A;  1FJ9 A;  1INP A;  1FPG A;  3KBZ A;  1K9Y A;  4O7I A;  5IZ1 A;  5EYG A;  3KC1 A;  1FTA A;  4IR8 A;  1FBF A;  1DCU A;  2HHM A;  5IZ3 A;  2QFL A;  1CNQ A;  3KC0 A;  1NV4 A;  2F3D A;  1NV2 A;  1LBX A;  2QVV A;  1RDY A;  1FBP A;  5IZ3 B;  1LBW A;  4GWZ A;  3ROJ A;  1NUX A;  2QVU A;  2FBP A;  2PCR A;  4GBV A;  1FRP A;  5ET7 A;  1AWB A;  1DK4 A;  1FPI A;  3D1R A;  4HE2 A;  4H46 A;  4I3Y A;  1IMC A;  3A29 A;  1NUW A;  1K9Z A;  1DBZ A;  2FVZ A;  5ET5 A;  3IFC A;  1BK4 A;  5LDZ A;  2Q8M A;  4AS4 A;  1G0I A;  1NI9 A;  4N81 A;  3T0J A;  1EYJ A;  3BIG A;  5EQ7 A;  1IMD A;  5A5L A;  4HXV A;  1LBV A;  1FPL A;  1QGX A;  1KZ8 A;  1LEV A;  1EYI A;  1LBY A;  1FPK A;  1NV0 A;  1FPE A;  3QMF A;  1FBD A;  5DW8 A;  1D9Q A;  1FPJ A;  5FBP A;  5J16 A;  5EQ8 A;  1FPD A;  1KA1 A;  1IME A;  4MJO A;  1SPI A;  4PTK A;  2WBB A;  4GX6 A;  2Q74 A;  4GWX A;  2OPD A;  1G0H A;  4GWS A;  4GWY A;  5EYH A;  1NV5 A;  1YXI A;  2P3V A;  4GWU A;  1NV6 A;  2WEF A;  4KXP A;  1IMA A;  2CZI A;  2Y5K A;  2FHY A;  2P3N A;  4GX4 A;  1YZ0 A;  1NV1 A;  2VT5 A;  2Y5L A;  4H45 A;  2JJK A;  1NV3 A;  5F24 A;  3LUZ A;  1IMB A;  1RDZ A;  4GBW A;  4GWW A;  1FJ6 A;  1FPB A;  2R8T A;  3RYD A;  3BIH A;  5ESY A;  2FIX A;  2CZK A;  2BJI A;  1EYK A;  1LBZ A;  1NUY A;  2WBD A;  3B8B A;  2OWZ A;  5T3J A;  4HE0 A;  1Q9D A;  1IMF A;  2CZH A;  1KA0 A;  3IFA A;  4G61 A;  2GQ1 A;  5EQA A;  2OPE A;  4FBP A;  1NV7 A;  5ET8 A;  1FBG A;  1FBH A;  1FSA A;  4AS5 A;  2FIE A;  4I3E A;  1XI6 A;  2QVR A;  1JP4 A;  4GX3 A;  3RPL A;  2OX3 A;  3LV0 A;  5EQ9 A;  1NUZ A;  3FBP A;  5ET6 A;  1FPF A;  4I40 A;  1FBC A;  1VDW A;  3RPL B;  2DDK A;  4QXD A;  5I3S A;  1RDX A;  1FBE A;  4HE1 A; 
#chains in the Genus database with same CATH homology
 2OPD A;  2OPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...