2OPEA

Crystal structure of the neisseria meningitidis minor type iv pilin, pilx, in space group p43
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
FEKGYQSQLYTEMVGINNISKQFILKNPLDDNQTIKSKLERFVSGYKMNPKIAEKYNVSVHFVNKEKPRAYSLVGVPKTGTGYTLSVWMNSVGDGYKCRDAASARAHLETLSSDVGCEAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords PilX
publication title 3D structure/function analysis of PilX reveals how minor pilins can modulate the virulence properties of type IV pili.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 36
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11530 Pilin_PilX Minor type IV pilin, PilX
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.20 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase; Chain A, domain 1 2opeA00
2OPDA 2OPEA
chains in the Genus database with same CATH superfamily
1K9YA 1JP4A 4H46A 4KXPA 3ROJA 1IMCA 4AS5A 5EQ8A 1XI6A 1DBZA 1RDZA 1NUWA 4GWXA 1RDYA 2DDKA 5ESYA 1IMBA 1FJ6A 1FBPA 1DCUA 4GBWA 2F3BA 1EYIA 5EQ7A 1IMFA 1FBDA 3LUZA 1G0IA 2FIXA 1EYKA 1BK4A 4H45A 1YZ0A 4AS4A 1FPKA 2FHYA 2Y5LA 5F24A 1FBCA 4GX3A 5A5LA 4QXDA 1NV7A 2F3DA 2VT5A 2JJKA 1FPLA 1G0HA 1VDWA 2WBBA 1INPA 1SPIA 4GBVA 1FPJA 1FBHA 1LBWA 4MJOA 1AWBA 2FIEA 4IR8A 1FBEA 1FTAA 3IFCA 1EYJA 1LBZA 5EQAA 2CZKA 1CNQA 1KA1A 4GWWA 1FSAA 1Q9DA 1FPIA 4GWSA 1NV1A 5ET5A 5EYGA 1FPDA 1LBYA 4GX6A 5IZ3B 1NUZA 2WBDA 2QVUA 2R8TA 1YXIA 1NUYA 5ET7A 2QFLA 4HE0A 5EQ9A 1FBGA 2Q74A 2WEFA 2Q8MA 1D9QA 1NV0A 2PCRA 1KZ8A 3RPLA 3FBPA 5FBPA 4HXVA 2CZIA 1LEVA 1NV4A 1FPEA 2FBPA 3D1RA 4GWUA 2P3VA 3A29A 4I3YA 1YYZA 1NI9A 4I40A 1KA0A 1NV2A 5IZ1A 2QVVA 3KC0A 5J16A 3LV0A 2OPDA 2OWZA 5ET6A 1FPFA 2HHMA 1DK4A 1K9ZA 2Y5KA 1FPGA 5I3SA 4I3EA 1FPBA 3QMFA 1QGXA 1FRPA 1FJ9A 5T3JA 2FVZA 3RYDA 4G61A 1NUXA 3BIHA 3KC1A 1IMDA 2OPEA 4GWZA 4HE2A 1NV6A 4O7IA 2QVRA 3KBZA 5DW8A 1IMAA 4PTKA 1NV3A 1LBVA 3T0JA 1IMEA 1RDXA 2GQ1A 5ET8A 4N81A 5LDZA 4GX4A 1FBFA 1NV5A 2CZHA 3BIGA 5EYHA 3RPLB 4HE1A 2BJIA 4GWYA 5IZ3A 3IFAA 3B8BA 2OX3A 1LBXA 2P3NA 4FBPA
chains in the Genus database with same CATH topology
2OPDA 2OPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPD A;  2OPE A; 
#chains in the Genus database with same CATH topology
 1K9Y A;  1JP4 A;  4H46 A;  4KXP A;  3ROJ A;  1IMC A;  4AS5 A;  5EQ8 A;  1XI6 A;  1DBZ A;  1RDZ A;  1NUW A;  4GWX A;  1RDY A;  2DDK A;  5ESY A;  1IMB A;  1FJ6 A;  1FBP A;  1DCU A;  4GBW A;  2F3B A;  1EYI A;  5EQ7 A;  1IMF A;  1FBD A;  3LUZ A;  1G0I A;  2FIX A;  1EYK A;  1BK4 A;  4H45 A;  1YZ0 A;  4AS4 A;  1FPK A;  2FHY A;  2Y5L A;  5F24 A;  1FBC A;  4GX3 A;  5A5L A;  4QXD A;  1NV7 A;  2F3D A;  2VT5 A;  2JJK A;  1FPL A;  1G0H A;  1VDW A;  2WBB A;  1INP A;  1SPI A;  4GBV A;  1FPJ A;  1FBH A;  1LBW A;  4MJO A;  1AWB A;  2FIE A;  4IR8 A;  1FBE A;  1FTA A;  3IFC A;  1EYJ A;  1LBZ A;  5EQA A;  2CZK A;  1CNQ A;  1KA1 A;  4GWW A;  1FSA A;  1Q9D A;  1FPI A;  4GWS A;  1NV1 A;  5ET5 A;  5EYG A;  1FPD A;  1LBY A;  4GX6 A;  5IZ3 B;  1NUZ A;  2WBD A;  2QVU A;  2R8T A;  1YXI A;  1NUY A;  5ET7 A;  2QFL A;  4HE0 A;  5EQ9 A;  1FBG A;  2Q74 A;  2WEF A;  2Q8M A;  1D9Q A;  1NV0 A;  2PCR A;  1KZ8 A;  3RPL A;  3FBP A;  5FBP A;  4HXV A;  2CZI A;  1LEV A;  1NV4 A;  1FPE A;  2FBP A;  3D1R A;  4GWU A;  2P3V A;  3A29 A;  4I3Y A;  1YYZ A;  1NI9 A;  4I40 A;  1KA0 A;  1NV2 A;  5IZ1 A;  2QVV A;  3KC0 A;  5J16 A;  3LV0 A;  2OPD A;  2OWZ A;  5ET6 A;  1FPF A;  2HHM A;  1DK4 A;  1K9Z A;  2Y5K A;  1FPG A;  5I3S A;  4I3E A;  1FPB A;  3QMF A;  1QGX A;  1FRP A;  1FJ9 A;  5T3J A;  2FVZ A;  3RYD A;  4G61 A;  1NUX A;  3BIH A;  3KC1 A;  1IMD A;  2OPE A;  4GWZ A;  4HE2 A;  1NV6 A;  4O7I A;  2QVR A;  3KBZ A;  5DW8 A;  1IMA A;  4PTK A;  1NV3 A;  1LBV A;  3T0J A;  1IME A;  1RDX A;  2GQ1 A;  5ET8 A;  4N81 A;  5LDZ A;  4GX4 A;  1FBF A;  1NV5 A;  2CZH A;  3BIG A;  5EYH A;  3RPL B;  4HE1 A;  2BJI A;  4GWY A;  5IZ3 A;  3IFA A;  3B8B A;  2OX3 A;  1LBX A;  2P3N A;  4FBP A; 
#chains in the Genus database with same CATH homology
 2OPD A;  2OPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...