1NI9A

2.0 a structure of glycerol metabolism protein from e. coli
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
327
structure length
291
Chain Sequence
GHMRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEAPMLYIGEKVGTGRGDAVDIAVDPIEGTQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLAGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSIHYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein glpX
publication title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 291
sequence length 327
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1ni9A01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1ni9A02
2CZIA 1IMDA 1XI6A 1D9QA 5ET5A 2FHYA 5FBPA 1FBDA 1K9YA 3KC0A 5I3SA 1YZ0A 1NV3A 4GWUA 1LBWA 5EQ8A 2CZHA 4HE0A 1NI9A 1IMAA 2F3DA 1RDXA 5EQAA 1FJ9A 2Y5KA 4KXPA 2FIEA 4I40A 3RPLB 4HE1A 2Q74A 4IR8A 1LEVA 2WBBA 1IMFA 2PCRA 2QFLA 2BJIA 1NUYA 1KA0A 1RDYA 4GWYA 2QVUA 1FPFA 1JP4A 1NV4A 1LBZA 1Q9DA 3A29A 3BIHA 3ROJA 3LUZA 1FPLA 1FBHA 1NV0A 3B8BA 4GX3A 5EYGA 4GWWA 4AS4A 1NV2A 1FPGA 1FTAA 1IMBA 4G61A 4I3YA 1FPJA 2WEFA 2FVZA 3FBPA 5T3JA 1G0HA 4I3EA 1FBEA 4GX6A 1KA1A 2HHMA 1LBXA 2P3NA 4H46A 1FRPA 1NV7A 1SPIA 1FBGA 1G0IA 1BK4A 3RPLA 1LBYA 1FPDA 1RDZA 3D1RA 3QMFA 1YXIA 3IFCA 5EQ7A 2CZKA 5IZ3B 1EYIA 2OX3A 2P3VA 1NV5A 1FBFA 1FPIA 1FBCA 2GQ1A 1NV1A 1NUWA 1QGXA 3IFAA 5IZ3A 2QVVA 5ESYA 1K9ZA 1NUXA 5IZ1A 1INPA 1NUZA 3T0JA 4O7IA 4N81A 1FPKA 5DW8A 4GBVA 1DK4A 4PTKA 3LV0A 1EYKA 2Y5LA 1LBVA 4GWXA 2OWZA 5ET8A 2DDKA 4AS5A 1FBPA 2FBPA 4GWZA 1KZ8A 1FSAA 5ET7A 2QVRA 2R8TA 2WBDA 1DBZA 1CNQA 2VT5A 5ET6A 5EYHA 4H45A 5A5LA 1YYZA 2FIXA 4QXDA 4MJOA 4GBWA 1EYJA 1IMEA 4FBPA 4HE2A 3BIGA 1FJ6A 3KBZA 2Q8MA 4GX4A 4GWSA 1AWBA 4HXVA 3KC1A 5LDZA 1FPEA 1NV6A 5F24A 5J16A 3RYDA 1IMCA 2JJKA 1FPBA 2F3BA 5EQ9A 1VDWA 1DCUA
chains in the Genus database with same CATH superfamily
3MUQA 1BIYA 1MDQA 4ZEFA 3H6UA 2F7BA 1ZTYA 2UVGA 3K6UA 3C32A 4ZDMA 5JTYA 4N13A 5ITOA 4F29A 3A29A 3BIHA 1N84A 3M3LA 2Y7WA 3B8BA 2VPOA 5DT6A 3MP1A 4JDFA 3TTMA 4HTGA 3ZSFA 2ONSA 4RK2A 5EHMA 1B40A 3PTYA 3SERA 5ITPA 4H0WA 2I6EA 4BDQA 3L6HA 2XA5A 4POWA 1QGXA 2O68A 5KCJB 3V83A 2QPQA 1DSNA 1I6QA 2I3VA 2B4LA 3IAZA 2X26A 4I62A 3TTKA 2HXRA 3E3KA 5EHSA 1NNTA 4OETA 4R2BA 5FTHA 3MVYA 4LP2B 3FV2A 3N6UA 4C1UA 4JBZA 1UTHA 2D5WA 3L6GA 1A8FA 1XHYA 3EN3A 4PE5B 2XXYA 4TOZA 1EYJA 3MP6A 5IGAA 1H45A 3PMXA 2ABHA 3OXNA 3RYDA 2JJKA 1DCUA 5CBSA 1I6BA 2FHYA 1FQEA 2GRVA 4PBQA 2O51A 4YKJA 2UXAA 1TWYA 4BDLA 1B3EA 3CSGA 1PB8A 1B3FA 4XKPA 4DCYA 1B1XA 4JSOA 1P1QA 4FECA 1QULA 3ISPA 4MNCA 4QSEA 4YU0A 2A5TA 4ONYA 5DYHA 1MXXA 4G68B 1B7HA 5I84A 2F6GA 2CEYA 2P3NA 4NF4A 1UTBB 4PFYA 1Z7ME 2XXWA 3TCHA 4GLIA 4Q30B 4Z0IA 2OPEA 4QBAA 1QUJA 2OWSA 1FQAA 1H3DA 1GV8A 1Y9UA 1FBFA 2R9JA 2VD2A 3UP9A 3TEPA 4UA8A 3PV0E 2F8DA 1TXFA 3B50A 4MEVA 3G3FA 4PGNA 5DEXA 1ZMGA 5TPAB 5H8SA 3K4UA 2I4CA 4NF6B 2I58A 3MVZA 3MAMA 3SESA 1AMFA 4X04A 5B7DA 1B7UA 3FXBA 3BIGA 3Q28A 5LDZA 4RY1A 4KD5A 4G4PA 4R9GA 3RPWA 1N3WA 4PE3A 2FNCA 3KJ7A 4YB7A 1MS7A 3JV9A 3KC0A 5I2NB 4F19A 4RXLA 3KOTA 1B52A 3QSLA 2F3DA 5EQAA 3O2AA 5I58A 3RPLB 2XX9A 4R6HA 3VDFA 3VFJA 4PFRA 2O1MA 4ISUA 1XC1A 4OZ9A 4UACA 3E79A 2DP8A 4EXKA 1MQHA 3FJGA 3BFUA 4OERA 4GX3A 1EZOA 4PAKA 1LBBA 4G61A 1KWHA 3DP6A 3HPIA 4ZEIA 2XD2A 1Y1ZA 4O3CA 1NV7A 2ZZVA 1FBGA 1B6HA 4G68C 2PBWA 4GWOA 3OENA 3RTWB 1Y3PA 4ELPA 1DTGA 4JSDA 5B70A 3LR1A 4GVOA 4F2QA 3MVXA 3IFAA 4GD5A 1VSOA 1K9ZA 1PB7A 5LTCA 1MXYA 1TFDA 1OVTA 5L8DA 3E9XA 2ANJA 4F3SA 3LV0A 1SQYA 1VR5A 1LB9A 3KZGA 1B7ZA 4I8CA 3EF7A 1NH8A 1ZKBA 4FBPA 4HXVA 4GWSA 3KC1A 4JVIA 2AL4A 1FQBA 2F3BA 2DQVA 5A5XA 2CZIA 4OFOA 4OA4A 3OD7A 4YB6A 4N8YA 4IB2A 5AA2A 1LBWA 2UYEA 3MPLA 2MKZA 3T96B 4KXPA 2Z22A 2P0SA 3ZKKA 2XHDA 1ZU0A 4TQUQ 2PCRA 4OESA 3K01A 2OJTA 3TYHA 2XXPA 3MSTA 1RKMA 4M4GA 4X8RA 3BFTA 3BBRA 4H6DA 2AL5A 2RF1A 3PPNA 4DI4B 2FVZA 4IY6A 4QFNA 1MPDA 4RPOA 3TCGA 2Z8FA 2OK2A 3TUSA 4LQ2A 2CZKA 3TODA 4M1VA 2F97A 2O7IA 1MY1A 4KYEA 1BP5A 4X1BA 4QFPA 1INPA 1NUZA 4O7IA 3T22A 3PUWE 4GBVA 1H44A 4PTKA 1MG1A 3VLUA 4MBPA 1LBVA 4PC9A 1KZ8A 2I4BA 3KN3A 4PF6A 3RTFB 3TAJA 5EYHA 2F7AA 1WDNA 5IZZA 5HPQA 3HCQA 4OFJA 4N4UA 3QUFA 4FE8A 2YLNA 1LB8A 5KCJA 3O66A 1D9QA 4N07A 3SETA 2OLBA 2DYXA 3K0VA 4MLVA 1HSEA 1D3KA 3RQTA 1LAGE 1TFAA 4BDOA 3CG1A 2E1SA 2PMSA 4F3GA 2ZYKA 1Q1KA 2V84A 1YTVA 2L5VA 4FEBA 3GBBA 4NF8B 1FTMA 3SEVA 2PFYA 3N5LA 1AH5A 4KCDA 1LFGA 4KR5A 1NV2A 1F9BA 4HW8A 4G8NA 4R72A 4XF5A 4HCYA 4H46A 4X1DA 4H8IA 3A3UA 2QS4A 4MNIA 3LC8A 1SYIA 3U93A 4F22A 3TTRA 4R6YA 3IR1A 4OQOA 1LGBC 1P99A 1FQCA 4C0RA 1NKXA 3M3KA 3C4MA 4NEDA 1FPKA 2PFZA 4N6PA 4G68A 2GHBA 2B4MA 1ATGA 1EYKA 4N6KA 5LOMA 2Y7KA 4AS5A 2CEXA 2IEEA 1UTBA 1SW5A 5HBCA 3C9HA 1ZJLA 4U23A 2W7YA 4MJOA 4QSDA 5I57B 1FTKA 3IL1B 1R9LA 1ZIUA 3S4UA 3H06B 1P1WA 4EUOA 5AA2B 5TU0A 2F5XA 4YZZA 4ZEKA 3CIJA 3W9WA 1YZ0A 3C36A 3K6WA 5TPAA 3O6IA 3OEMA 4OANA 2DWJA 2ESNA 3H7MA 4NF6A 3E13X 1LSTA 3EKIA 3EQ1A 5CBRA 4OYVA 3WAFA 3K1NA 1LAXA 2Q8JA 2BJIA 3U94A 4OTEA 3THIA 2WX9A 4MLQA 3B6TA 1IXHA 1UIVA 1A7LA 2Y84A 1P1OA 5CC2A 5I2NA 4IO2A 4NX1A 3KSJA 1SW4A 4KFQA 4P1LA 3OSQA 4U1OA 1OQGA 1WVJA 3PMWA 3MC2A 5IAIA 2UVHA 3LSLA 3RPLA 4F31B 2OWTA 5BUUA 2ZMBA 4MCOA 4GXAA 1FPDA 3T9VA 1SD3A 4F1VA 2PT1A 3G3GA 4H5GA 4H1XA 1QKAA 4NTLA 1A55A 4FJPA 4OVTA 4GFRA 2DE3A 1POTA 3FUZA 4L17A 3IJOB 1IITA 2V3UA 4MAGA 3QUJA 2RINA 3FGSA 1OLAA 1IEJA 1YPNA 4WEDA 4XTCQ 1FBPA 1PC3A 4NN3A 3H6VA 2DWHA 1YAEA 2VGQA 1DMBA 5K2YA 4OVJA 1ELJA 4UABA 4YMBA 4OWDA 1A40A 3OSRA 3FZVA 2F34A 4ESXA 4Q8RA 4PQJA 4IO7A 2GH9A 1RYXA 5I3SA 1JNFA 1P1NA 1B1HA 4GWUA 3HO7A 5CMKA 2F36A 4ELRA 3S9EA 1O63A 2THIA 4MH5A 2VPNA 4HE1A 1B4ZA 2VD3A 2ONKE 4YAHX 5IM2A 2NWJA 2QRYA 3GXAA 1IMFA 2ZNTA 3FVNA 3K6VA 4GWYA 4DXCA 2WYPA 3ROJA 1RYOA 1FPLA 3CRBA 3UIFA 4BDRA 2YJPA 4OFLA 2DSFA 4IO4A 1URDA 5F7VA 1FBEA 1VFDA 1M5BA 3ONMA 4LA9A 3DELB 3PMVA 3TQLA 1POY1 3CFXA 3KSXA 1LBYA 4RNSA 1BKAA 2DXYA 4MMPA 1CE2A 1JEUA 4KYDA 2Q2AA 1OQHA 1FPIA 1B3HA 3I3VA 5IKBA 1DTZA 1XS5A 4FEDA 3MBPA 4O94A 1NUXA 5IZ1A 4N81A 1O64A 3VXBA 2NXOA 2Z8DA 2ZYOA 4PCDA 4XEQA 1US5A 2AYSA 3T66A 3V89B 4JWXA 3IOTA 2QVRA 4LZ7A 2F78A 3OELA 4QXDA 5AA2D 2D21A 4ZE9A 3KFMA 5F24A 4JXIA 2RC8A 2I0BA 3G3KA 4IY5A 3U65A 2XXKA 1MQGA 1K9YA 1B0HA 1NV3A 4PAIA 4AQ4A 3I5OA 4U4XA 4GRKA 1URSA 4FORA 1DOTA 1S50A 1JEVA 3TTNA 3IORA 1Y3NA 1T0KA 3U8QA 2CMOA 3Q26A 5EYGA 1FPGA 5AA4A 3T9HB 3LSXA 3H6WA 1IXCA 2ALUA 5T3JA 4ZS9A 3PUZE 1JETA 4GX6A 1EZ9A 4PGPA 3IB2A 4WEPA 3UORA 1B3GA 1G0IA 1NH7A 4WXJA 2HCAA 1IXIA 3CSBA 1NNPA 4OXVA 4EQ7A 3U92A 2XX8A 1ZBMA 1MXVA 4XFEA 2XXTA 2H98A 1DPPA 3MJNA 4NF8A 3C34A 2V25A 3QAXA 3VV5A 1HSLA 1OVBA 2DOJA 3KN8A 3VVDA 2OCUA 1MY0A 3IOWA 4NF0A 2ZZXA 2B3BA 5HM4B 3PPRA 4GOTA 4DLDA 3FATA 1YYZA 2FIXA 1IXGA 5DVIA 2Q88A 3KBZA 1AWBA 3JYRA 4P47A 1FPEA 4P0GA 1WODA 4QHQA 1NV6A 4LZ8A 4NE4A 2QS1A 2I3WA 3C33A 4LONB 2XWKA 1MH3A 1IMDA 1XI6A 1XVYA 5CMCA 1JW1A 3AXFA 2UYFA 1S7YA 4DI3D 2HQ0A 2ZYNA 1NNKA 3RT6B 1RDXA 4R74A 3B7DA 4PDHA 1MH4A 2GHAA 3I6VA 5KZTA 3V5AA 3LSWA 4XKRA 5I57A 2B3FA 4POXA 2QFLA 3UN6A 4H5FA 1NUYA 3PPQA 1LBZA 3SEYA 4KHZE 1MXUA 4ELQA 5TP9B 4N15A 4ZE8A 1FW0A 1N76A 4AS4A 2Q9TA 1IMBA 4OEVA 4NMYA 2WEFA 1CB6A 3T93B 2PX1A 5H8NB 3S9NC 2DE2A 4GXSB 5H8FB 3T9XB 5ELVA 2O6AA 4XXUA 1B5HA 2FYIA 1N7XA 1S9TA 3FXRA 3PPPA 3CG3A 3GBAA 1LAFE 4E0WA 4RJZA 3FD3A 4K3FA 2HAVA 2HFBA 2DWAA 4TLLB 4DE8A 3U72A 3KBRA 2Y5LA 3KGCA 2GFEA 2OWZA 3TDJA 1FSAA 4R75A 2O1LA 5ET6A 5ISUA 5CMBA 2H5YA 4F1UA 4U4SA 4G8MA 1B58A 3K1PA 1XOCA 2OPDA 5EQ9A 4DXBA 1FBDA 4JWYA 3FV1A 4YKPA 5ICTA 4U1ZA 5EQ8A 5K2XA 4YICA 4N6DA 4NWCA 3EPEA 4I40A 4ZZEA 3LUYA 1R6ZA 1GVCA 4IR8A 3IK6B 4PFIA 1N7WA 4KYSA 3W15C 4PFBA 4Q0CA 2Q2CA 4H67A 2M8CA 3W9VA 3PGFA 3IJXB 1H76A 1MXWA 1Q9DA 2G93A 5AA4B 3N6TA 1USYH 1SI0A 4NQ8A 1N0TA 3VE1B 1KA1A 4AB6A 1OLCA 3HV1A 4MNPA 5I5PA 3TTLA 5F1QA 2XXUA 1IZ1A 4FATA 2OX3A 4EXLA 3VVFA 3FJMA 1HSJA 1FBCA 1QUIA 3CFZA 3ZS6A 1FCKA 3KOSA 4XKQA 2V3TA 5L9MA 1O7TA 4MF3A 1IUDA 4QFKA 5DW8A 1TT1A 2XWIA 3RLFE 2DWIA 1Z7NE 4I9DA 2REJA 3FXUA 3Q27A 3QK6A 2HEUA 3NOHA 5ICQA 3HHFA 3ODBA 4O7MA 1SI1A 4FAJA 4PP0A 4OEUA 2Q8MA 4DDDA 2Y7PA 1PEBA 1SBPA 1PDAA 3TELA 2V93A 4GF8A 4KI0E 4HS7A 5ET5A 1JVXA 3IO6A 3Q25A 3A09A 3K02A 2Z23A 1B5IA 1MM6A 3S2VA 4MX6A 4O3BA 4YKIA 3TCFA 4PBHA 4C1TA 1MQJA 3RY3A 1PBPA 3RNNA 4EQBA 1RDYA 5I56B 3D4CA 1JP4A 5J1DA 1J1NA 1P1UA 3OO7A 3CFLA 2KQZA 1LBXA 3MP8A 3CR9A 4QFLA 3O29A 1SPIA 1BK4A 1EU8A 1GR2A 1MM7A 1FQDA 1NFTA 5FHNA 4P1EA 3D1RA 1MPCA 1AIVA 3FJ7A 5H8HB 3RUMA 1A99A 4MFIA 5IZ3A 2V4CA 5I59B 3G3HA 3KG2A 5DVFA 1SYHA 2BJJX 4BLAA 1N3XA 4GWXA 3HN0A 3VVEA 3VXCA 1Y4TA 4IO5A 4OVRA 1CNQA 2B65A 3S9MC 1B4HA 2DVZA 4GQOA 4U21A 2RKMA 4GX4A 3N26A 2XXIA 3U1OA 3RN8A 1IMCA 2HZLA 1FPBA 3H6TA 4PFWA 3MWBA 1XT8A 1NL5A 1MDP1 5CRYA 1SW2A 2F35A 1B9JA 1XVXA 2UVIA 4OVQA 1FTLA 3C31A 4H65A 2H99A 5JEIA 4DXUA 2WBBA 4GL8A 1PBQA 3RGYA 5M2VA 4PFUA 1USYE 2Y7RA 1A8EA 5AA1A 1KA0A 1GGGA 1LBCA 2LAOA 1IIWA 1Y20A 4NGUA 1JQFA 5CI5A 3K2DA 2NVUB 2G29A 4ND9A 2V3QA 3MW0A 1EYIA 4OVSA 3PU5A 3PUYE 3T1BA 2GQ1A 4KPTA 1R1NA 4GL0A 5ESYA 5FHOA 5TP9A 3T0JA 3G7WA 2X7QA 5H8NA 5ET8A 2ZXTA 5H8FA 3O97A 2P2AA 3OEKA 1VFEA 1DBZA 4MIJA 1MY2A 4RA1A 4GBWA 2VOZA 3LBSA 5BWJA 4Z7EA 2H9BA 4NF5B 5I2KB 1LFHA 4MHFA 1M5DA 4LZ5A 4JVDA 4DIGA 4EQ9A 3KN7A 3SEWA 3O28A 2O69A 3VLVA 1US4A 2CZHA 4HE0A 3USDA 2Y7IA 5FTIA 2FIEA 4ZEBA 1OMPA 2R71A 1M5CA 4OMBA 4KQPA 3O6GA 4P8BA 4F39A 4WKMA 4O8MA 3K1MA 1II5A 4LUBA 2XX7A 1DPEA 1LAHE 2QVUA 1FPFA 3RT8A 1QJMA 3M8UA 1D9YA 3FIRA 4G77A 3WAEA 2XXQA 3E78A 2ZZWA 3MZBA 4R6KA 3UGWA 3UK4A 1FPJA 1B2HA 2ZNUA 3IB1A 4THIA 5KDTB 1B5JA 2HHMA 3IB0A 3KJTA 1QW0A 3DP8A 4LQ5A 1LCTA 4YMAA 2P1SA 4BDNA 1GTKA 1YXIA 2OZZA 5IZ3B 4P9KA 2P3VA 1NV5A 3VLWA 4RK9A 2QVVA 3P7IA 3MPKA 3MYUA 2DXRA 3HFUA 2HZKA 2WKYA 4QFOA 3OMBA 2FBPA 2YPNA 3CVGA 2R8TA 5L9OA 4F2OA 2WBDA 2ONRA 2VT5A 5JTYB 5A5LA 4PETA 4IGTA 3IOVA 1IMEA 3H03A 1AOVA 1MQDA 4N8GA 1OIBA 4U2RA 5FHMA 3HSTA 1LLSA 1AL3A 4N17A 3SEXA 3TZAA 1VDWA 2WYKA 5CMMA 5FBPA 3IX1A 2RCAA 2XXVA 3SKPA 4E0XA 1EZPA 1H43A 4KCCA 1MY3A 2F6PA 2O84X 1ANFA 2VHAA 2VP1A 4IGRA 4PDDA 3KEIA 1IQ7A 2QSXA 2QJEA 1FJ9A 3DP4A 4OENA 2Q74A 4F3PA 1R9QA 2H25A 2Q89A 4PAFA 3FVGA 4JWOA 4YKKA 3H3GA 1MPBA 3LUZA 3OO8A 3OO9A 3ILTB 3SEUA 4NG7A 4GWWA 1QUKA 2HXWA 3GLBA 3ECRA 3ILUB 1G0HA 3V8XB 4YB5A 3K6XA 3BKIB 1UTHB 3A3CA 3DLNA 1FTOA 4F18A 1FTJA 2I0CA 1A54A 4JVCA 2DS9A 2XWVA 5I7IA 3CI8A 5I56A 3HHGA 1SW1A 2PYYA 2QL3A 2H4IA 1ZLQA 3FVKA 3R7XA 5H8QA 2QS3A 2XXRA 1PB9A 2XWOA 4GWZA 4N91A 3S9LC 2DE4A 3O6HA 1SDXA 2RC7A 2RCBA 4H8JA 4HE2A 1B46A 4PFTA 2A5TB 5H8HA 3EHSA 4IO6A 5I59A 1B3LA 4ZZAA 1LFIA 2NUVA 2QS2A 4P0IA 4EF2A 3MZ9A 3K00A 1NI9A 4NF4B 2Y5KA 4EDPA 3G3IA 1LEVA 5AE4A 4DZ1A 4ZECA 4ESWA 4F3BA 2NOOA 3CHGA 1NV4A 4TLMB 1B32A 1NNFA 2HPGA 4I3YA 2XXXA 3R26A 5DEXB 2R6GE 1B05A 4JB7A 2F7CA 1QVSA 4G8HA 3FBPA 3N94A 4PF8A 1MRPA 4O3AA 4XIGQ 2XXHA 1FRPA 4RYAA 1UIUA 3GZGA 4X48A 2PVUA 1LCFA 2E0SA 1B51A 3MZ1A 3C35A 3TFLA 3QYTA 4U22A 1QKBA 4R2FA 3EHTA 1M5FA 1B0LA 1M5EA 1YCJA 3PUVE 1NV1A 1NUWA 4ELOA 5DVJA 4LATA 2I49A 2AIXA 2Z8EA 2ZYMA 3D4GA 3G3JA 2O7UA 1BTJA 1DK4A 4R9FA 1Y1MA 2A5SA 5ET7A 5I58B 4P3LA 3UA8A 2KLFA 3R6UA 5CM6A 3B6QA 3PD8A 1I69A 4LVQA 1FJ6A 4NAPA 1NMUA 5AA3A 1MQIA 3LSFB 3SDFA 2XD3A 2QMWA 5J16A 4QF9A 3B6WA 3O9PA 3OO6A 4P56A 3TQWA 3TPAA 3M3FA 3EHUA 1IMAA 4BDMA 4R73A 1N04A 3E4RA 1Y4CA 3PUXE 2KR0A 3IO4A 1MY4A 4F1YA 4QRZA 4FIMA 1URGA 1BLFA 2PT2A 4NF5A 4NWDA 3T9UA 4IO3A 5I2KA 2RC9A 4Q5TA 3FXQA 3ZKLA 4OHNA 1FBHA 1NV0A 2IA4A 1FTAA 4QSCA 4NHBA 4X9TA 4I3EA 5L9SA 5EYFA 2CZLA 2QMXA 1FQFA 3Q29A 3TKDA 3SZPA 2UVJA 1D9VA 3TMGA 1RDZA 2HAUA 3QMFA 3IFCA 5EQ7A 4HCWA 4AB5A 3GYYA 3OOAA 3MVWA 1I6AA 3QXMA 1MXZA 3PD9A 4ECFA 2OBGA 2FA7A 4I1DA 3DM0A 3FASA 1JW4A 2I48A 5H8QB 1SVXB 5A5XB 3IOUA 1JVYA 1Y3QA 3H4ZA 3PPOA 1Q35A 1D4NA 4GIZA 2DDKA 1L5TA 1UQWA 5KDTA 4G2ZA 4OVPA 3FVOA 1VE4A 4H45A 4LN5A 2REGA 4EF1A 2ZNSA 4P11A 1EH3A 4ZEDA 2DVCA 3JZJA 5DTBA 2X7PA 1JW5A 3MQ9A 5JK4A 3QIMA 4RPNA 4XKNA 4DCXA 3F11A 2D3IA
chains in the Genus database with same CATH topology
1IMDA 1XI6A 1D9QA 4JVDA 4DI3D 2CZHA 4HE0A 1RDXA 2FIEA 4PDHA 4P8BA 4O8MA 2QFLA 1NUYA 2QVUA 1FPFA 2L5VA 1LBZA 3A29A 3BIHA 3E78A 2PFYA 2ZZWA 3B8BA 2VPOA 4N15A 4AS4A 1NV2A 2Q9TA 1IMBA 1FPJA 2WEFA 2DE2A 4XF5A 4HCYA 2HHMA 4H46A 3PTYA 4MNIA 1YXIA 5IZ3B 4P9KA 2P3VA 1NV5A 2XA5A 1QGXA 2QVVA 2QPQA 2B4LA 3MYUA 1FPKA 3HFUA 2PFZA 2HZKA 2B4MA 1EYKA 2HXRA 4N6KA 2Y5LA 2OWZA 4AS5A 2FBPA 2CEXA 1FSAA 2R8TA 2WBDA 2VT5A 5ET6A 5A5LA 4PETA 4MJOA 1EYJA 1IMEA 4F1UA 5IGAA 4N8GA 4N17A 3RYDA 2JJKA 5EQ9A 1VDWA 1DCUA 2WYKA 2FHYA 5FBPA 1FBDA 2F5XA 4YZZA 4PBQA 3W9WA 1YZ0A 5EQ8A 4YICA 4N6DA 4OANA 4PDDA 1FJ9A 4I40A 4IR8A 2Q74A 4PFIA 4PFBA 3EKIA 4PAFA 3ISPA 2BJIA 4MNCA 3W9VA 1Q9DA 2WX9A 3LUZA 4NG7A 4GWWA 4NQ8A 4NX1A 1G0HA 4P1LA 1KA1A 2CEYA 2P3NA 4MNPA 5I5PA 3RPLA 4QBAA 4F18A 4MCOA 1FPDA 4JVCA 2OX3A 2XWVA 4F1VA 1FBFA 1FBCA 5I7IA 4OVTA 2DE3A 3B50A 4MEVA 5DW8A 4MAGA 4PGNA 2XWIA 1FBPA 2XWOA 4NN3A 4GWZA 4N91A 2DE4A 3NOHA 4X04A 4O7MA 4HE2A 3FXBA 3BIGA 2Q8MA 5LDZA 4UABA 4PE3A 5ET5A 3KC0A 5I3SA 4GWUA 4F19A 1NI9A 2F3DA 5EQAA 2Y5KA 4MX6A 3RPLB 2VPNA 4HE1A 1LEVA 4PFRA 5IM2A 4PBHA 1IMFA 1RDYA 4GWYA 3E79A 3CHGA 1JP4A 1NV4A 2WYPA 3ROJA 5J1DA 1FPLA 2HPGA 4GX3A 4PAKA 4I3YA 4G61A 3FBPA 4PF8A 1FBEA 2KQZA 1LBXA 1FRPA 1NV7A 2ZZVA 1SPIA 1FBGA 1BK4A 1LBYA 4MMPA 4P1EA 3D1RA 1FPIA 1NV1A 1NUWA 3IFAA 5IZ3A 2V4CA 1K9ZA 4O94A 1NUXA 5IZ1A 5LTCA 4N81A 1DK4A 3LV0A 4PCDA 4GWXA 4XEQA 5ET7A 2QVRA 4P3LA 4OVRA 1CNQA 5CM6A 4QXDA 2DVZA 4FBPA 1FJ6A 4NAPA 4GX4A 4GWSA 4HXVA 3KC1A 4JVIA 5F24A 5J16A 1IMCA 2HZLA 1FPBA 2F3BA 3U65A 2CZIA 2XXKA 4OA4A 4P56A 1K9YA 4N8YA 4OVQA 1NV3A 1LBWA 4PAIA 1IMAA 2MKZA 4KXPA 2KR0A 2WBBA 2PCRA 1KA0A 3MSTA 4X8RA 1FBHA 1NV0A 5EYGA 1FPGA 1FTAA 4NGUA 4DI4B 2FVZA 4NHBA 4X9TA 5T3JA 4I3EA 4GX6A 4PGPA 3SZPA 1G0IA 1RDZA 2V3QA 3QMFA 3IFCA 5EQ7A 4HCWA 2CZKA 1EYIA 3GYYA 4OVSA 4M1VA 3T1BA 2GQ1A 4XFEA 5ESYA 1INPA 1NUZA 3T0JA 4O7IA 4GBVA 4PTKA 1LBVA 5ET8A 2DDKA 4NF0A 4PC9A 2ZZXA 4OVPA 1KZ8A 4PF6A 1DBZA 5EYHA 4MIJA 4H45A 1YYZA 2FIXA 4LN5A 4GBWA 5IZZA 3KBZA 1AWBA 4P47A 1FPEA 4N4UA 1NV6A 5JK4A 4MHFA 2XWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZI A;  1IMD A;  1XI6 A;  1D9Q A;  5ET5 A;  2FHY A;  5FBP A;  1FBD A;  1K9Y A;  3KC0 A;  5I3S A;  1YZ0 A;  1NV3 A;  4GWU A;  1LBW A;  5EQ8 A;  2CZH A;  4HE0 A;  1NI9 A;  1IMA A;  2F3D A;  1RDX A;  5EQA A;  1FJ9 A;  2Y5K A;  4KXP A;  2FIE A;  4I40 A;  3RPL B;  4HE1 A;  2Q74 A;  4IR8 A;  1LEV A;  2WBB A;  1IMF A;  2PCR A;  2QFL A;  2BJI A;  1NUY A;  1KA0 A;  1RDY A;  4GWY A;  2QVU A;  1FPF A;  1JP4 A;  1NV4 A;  1LBZ A;  1Q9D A;  3A29 A;  3BIH A;  3ROJ A;  3LUZ A;  1FPL A;  1FBH A;  1NV0 A;  3B8B A;  4GX3 A;  5EYG A;  4GWW A;  4AS4 A;  1NV2 A;  1FPG A;  1FTA A;  1IMB A;  4G61 A;  4I3Y A;  1FPJ A;  2WEF A;  2FVZ A;  3FBP A;  5T3J A;  1G0H A;  4I3E A;  1FBE A;  4GX6 A;  1KA1 A;  2HHM A;  1LBX A;  2P3N A;  4H46 A;  1FRP A;  1NV7 A;  1SPI A;  1FBG A;  1G0I A;  1BK4 A;  3RPL A;  1LBY A;  1FPD A;  1RDZ A;  3D1R A;  3QMF A;  1YXI A;  3IFC A;  5EQ7 A;  2CZK A;  5IZ3 B;  1EYI A;  2OX3 A;  2P3V A;  1NV5 A;  1FBF A;  1FPI A;  1FBC A;  2GQ1 A;  1NV1 A;  1NUW A;  1QGX A;  3IFA A;  5IZ3 A;  2QVV A;  5ESY A;  1K9Z A;  1NUX A;  5IZ1 A;  1INP A;  1NUZ A;  3T0J A;  4O7I A;  4N81 A;  1FPK A;  5DW8 A;  4GBV A;  1DK4 A;  4PTK A;  3LV0 A;  1EYK A;  2Y5L A;  1LBV A;  4GWX A;  2OWZ A;  5ET8 A;  2DDK A;  4AS5 A;  1FBP A;  2FBP A;  4GWZ A;  1KZ8 A;  1FSA A;  5ET7 A;  2QVR A;  2R8T A;  2WBD A;  1DBZ A;  1CNQ A;  2VT5 A;  5ET6 A;  5EYH A;  4H45 A;  5A5L A;  1YYZ A;  2FIX A;  4QXD A;  4MJO A;  4GBW A;  1EYJ A;  1IME A;  4FBP A;  4HE2 A;  3BIG A;  1FJ6 A;  3KBZ A;  2Q8M A;  4GX4 A;  4GWS A;  1AWB A;  4HXV A;  3KC1 A;  5LDZ A;  1FPE A;  1NV6 A;  5F24 A;  5J16 A;  3RYD A;  1IMC A;  2JJK A;  1FPB A;  2F3B A;  5EQ9 A;  1VDW A;  1DCU A; 
#chains in the Genus database with same CATH topology
 3MUQ A;  1BIY A;  1MDQ A;  4ZEF A;  3H6U A;  2F7B A;  1ZTY A;  2UVG A;  3K6U A;  3C32 A;  4ZDM A;  5JTY A;  4N13 A;  5ITO A;  4F29 A;  3A29 A;  3BIH A;  1N84 A;  3M3L A;  2Y7W A;  3B8B A;  2VPO A;  5DT6 A;  3MP1 A;  4JDF A;  3TTM A;  4HTG A;  3ZSF A;  2ONS A;  4RK2 A;  5EHM A;  1B40 A;  3PTY A;  3SER A;  5ITP A;  4H0W A;  2I6E A;  4BDQ A;  3L6H A;  2XA5 A;  4POW A;  1QGX A;  2O68 A;  5KCJ B;  3V83 A;  2QPQ A;  1DSN A;  1I6Q A;  2I3V A;  2B4L A;  3IAZ A;  2X26 A;  4I62 A;  3TTK A;  2HXR A;  3E3K A;  5EHS A;  1NNT A;  4OET A;  4R2B A;  5FTH A;  3MVY A;  4LP2 B;  3FV2 A;  3N6U A;  4C1U A;  4JBZ A;  1UTH A;  2D5W A;  3L6G A;  1A8F A;  1XHY A;  3EN3 A;  4PE5 B;  2XXY A;  4TOZ A;  1EYJ A;  3MP6 A;  5IGA A;  1H45 A;  3PMX A;  2ABH A;  3OXN A;  3RYD A;  2JJK A;  1DCU A;  5CBS A;  1I6B A;  2FHY A;  1FQE A;  2GRV A;  4PBQ A;  2O51 A;  4YKJ A;  2UXA A;  1TWY A;  4BDL A;  1B3E A;  3CSG A;  1PB8 A;  1B3F A;  4XKP A;  4DCY A;  1B1X A;  4JSO A;  1P1Q A;  4FEC A;  1QUL A;  3ISP A;  4MNC A;  4QSE A;  4YU0 A;  2A5T A;  4ONY A;  5DYH A;  1MXX A;  4G68 B;  1B7H A;  5I84 A;  2F6G A;  2CEY A;  2P3N A;  4NF4 A;  1UTB B;  4PFY A;  1Z7M E;  2XXW A;  3TCH A;  4GLI A;  4Q30 B;  4Z0I A;  2OPE A;  4QBA A;  1QUJ A;  2OWS A;  1FQA A;  1H3D A;  1GV8 A;  1Y9U A;  1FBF A;  2R9J A;  2VD2 A;  3UP9 A;  3TEP A;  4UA8 A;  3PV0 E;  2F8D A;  1TXF A;  3B50 A;  4MEV A;  3G3F A;  4PGN A;  5DEX A;  1ZMG A;  5TPA B;  5H8S A;  3K4U A;  2I4C A;  4NF6 B;  2I58 A;  3MVZ A;  3MAM A;  3SES A;  1AMF A;  4X04 A;  5B7D A;  1B7U A;  3FXB A;  3BIG A;  3Q28 A;  5LDZ A;  4RY1 A;  4KD5 A;  4G4P A;  4R9G A;  3RPW A;  1N3W A;  4PE3 A;  2FNC A;  3KJ7 A;  4YB7 A;  1MS7 A;  3JV9 A;  3KC0 A;  5I2N B;  4F19 A;  4RXL A;  3KOT A;  1B52 A;  3QSL A;  2F3D A;  5EQA A;  3O2A A;  5I58 A;  3RPL B;  2XX9 A;  4R6H A;  3VDF A;  3VFJ A;  4PFR A;  2O1M A;  4ISU A;  1XC1 A;  4OZ9 A;  4UAC A;  3E79 A;  2DP8 A;  4EXK A;  1MQH A;  3FJG A;  3BFU A;  4OER A;  4GX3 A;  1EZO A;  4PAK A;  1LBB A;  4G61 A;  1KWH A;  3DP6 A;  3HPI A;  4ZEI A;  2XD2 A;  1Y1Z A;  4O3C A;  1NV7 A;  2ZZV A;  1FBG A;  1B6H A;  4G68 C;  2PBW A;  4GWO A;  3OEN A;  3RTW B;  1Y3P A;  4ELP A;  1DTG A;  4JSD A;  5B70 A;  3LR1 A;  4GVO A;  4F2Q A;  3MVX A;  3IFA A;  4GD5 A;  1VSO A;  1K9Z A;  1PB7 A;  5LTC A;  1MXY A;  1TFD A;  1OVT A;  5L8D A;  3E9X A;  2ANJ A;  4F3S A;  3LV0 A;  1SQY A;  1VR5 A;  1LB9 A;  3KZG A;  1B7Z A;  4I8C A;  3EF7 A;  1NH8 A;  1ZKB A;  4FBP A;  4HXV A;  4GWS A;  3KC1 A;  4JVI A;  2AL4 A;  1FQB A;  2F3B A;  2DQV A;  5A5X A;  2CZI A;  4OFO A;  4OA4 A;  3OD7 A;  4YB6 A;  4N8Y A;  4IB2 A;  5AA2 A;  1LBW A;  2UYE A;  3MPL A;  2MKZ A;  3T96 B;  4KXP A;  2Z22 A;  2P0S A;  3ZKK A;  2XHD A;  1ZU0 A;  4TQU Q;  2PCR A;  4OES A;  3K01 A;  2OJT A;  3TYH A;  2XXP A;  3MST A;  1RKM A;  4M4G A;  4X8R A;  3BFT A;  3BBR A;  4H6D A;  2AL5 A;  2RF1 A;  3PPN A;  4DI4 B;  2FVZ A;  4IY6 A;  4QFN A;  1MPD A;  4RPO A;  3TCG A;  2Z8F A;  2OK2 A;  3TUS A;  4LQ2 A;  2CZK A;  3TOD A;  4M1V A;  2F97 A;  2O7I A;  1MY1 A;  4KYE A;  1BP5 A;  4X1B A;  4QFP A;  1INP A;  1NUZ A;  4O7I A;  3T22 A;  3PUW E;  4GBV A;  1H44 A;  4PTK A;  1MG1 A;  3VLU A;  4MBP A;  1LBV A;  4PC9 A;  1KZ8 A;  2I4B A;  3KN3 A;  4PF6 A;  3RTF B;  3TAJ A;  5EYH A;  2F7A A;  1WDN A;  5IZZ A;  5HPQ A;  3HCQ A;  4OFJ A;  4N4U A;  3QUF A;  4FE8 A;  2YLN A;  1LB8 A;  5KCJ A;  3O66 A;  1D9Q A;  4N07 A;  3SET A;  2OLB A;  2DYX A;  3K0V A;  4MLV A;  1HSE A;  1D3K A;  3RQT A;  1LAG E;  1TFA A;  4BDO A;  3CG1 A;  2E1S A;  2PMS A;  4F3G A;  2ZYK A;  1Q1K A;  2V84 A;  1YTV A;  2L5V A;  4FEB A;  3GBB A;  4NF8 B;  1FTM A;  3SEV A;  2PFY A;  3N5L A;  1AH5 A;  4KCD A;  1LFG A;  4KR5 A;  1NV2 A;  1F9B A;  4HW8 A;  4G8N A;  4R72 A;  4XF5 A;  4HCY A;  4H46 A;  4X1D A;  4H8I A;  3A3U A;  2QS4 A;  4MNI A;  3LC8 A;  1SYI A;  3U93 A;  4F22 A;  3TTR A;  4R6Y A;  3IR1 A;  4OQO A;  1LGB C;  1P99 A;  1FQC A;  4C0R A;  1NKX A;  3M3K A;  3C4M A;  4NED A;  1FPK A;  2PFZ A;  4N6P A;  4G68 A;  2GHB A;  2B4M A;  1ATG A;  1EYK A;  4N6K A;  5LOM A;  2Y7K A;  4AS5 A;  2CEX A;  2IEE A;  1UTB A;  1SW5 A;  5HBC A;  3C9H A;  1ZJL A;  4U23 A;  2W7Y A;  4MJO A;  4QSD A;  5I57 B;  1FTK A;  3IL1 B;  1R9L A;  1ZIU A;  3S4U A;  3H06 B;  1P1W A;  4EUO A;  5AA2 B;  5TU0 A;  2F5X A;  4YZZ A;  4ZEK A;  3CIJ A;  3W9W A;  1YZ0 A;  3C36 A;  3K6W A;  5TPA A;  3O6I A;  3OEM A;  4OAN A;  2DWJ A;  2ESN A;  3H7M A;  4NF6 A;  3E13 X;  1LST A;  3EKI A;  3EQ1 A;  5CBR A;  4OYV A;  3WAF A;  3K1N A;  1LAX A;  2Q8J A;  2BJI A;  3U94 A;  4OTE A;  3THI A;  2WX9 A;  4MLQ A;  3B6T A;  1IXH A;  1UIV A;  1A7L A;  2Y84 A;  1P1O A;  5CC2 A;  5I2N A;  4IO2 A;  4NX1 A;  3KSJ A;  1SW4 A;  4KFQ A;  4P1L A;  3OSQ A;  4U1O A;  1OQG A;  1WVJ A;  3PMW A;  3MC2 A;  5IAI A;  2UVH A;  3LSL A;  3RPL A;  4F31 B;  2OWT A;  5BUU A;  2ZMB A;  4MCO A;  4GXA A;  1FPD A;  3T9V A;  1SD3 A;  4F1V A;  2PT1 A;  3G3G A;  4H5G A;  4H1X A;  1QKA A;  4NTL A;  1A55 A;  4FJP A;  4OVT A;  4GFR A;  2DE3 A;  1POT A;  3FUZ A;  4L17 A;  3IJO B;  1IIT A;  2V3U A;  4MAG A;  3QUJ A;  2RIN A;  3FGS A;  1OLA A;  1IEJ A;  1YPN A;  4WED A;  4XTC Q;  1FBP A;  1PC3 A;  4NN3 A;  3H6V A;  2DWH A;  1YAE A;  2VGQ A;  1DMB A;  5K2Y A;  4OVJ A;  1ELJ A;  4UAB A;  4YMB A;  4OWD A;  1A40 A;  3OSR A;  3FZV A;  2F34 A;  4ESX A;  4Q8R A;  4PQJ A;  4IO7 A;  2GH9 A;  1RYX A;  5I3S A;  1JNF A;  1P1N A;  1B1H A;  4GWU A;  3HO7 A;  5CMK A;  2F36 A;  4ELR A;  3S9E A;  1O63 A;  2THI A;  4MH5 A;  2VPN A;  4HE1 A;  1B4Z A;  2VD3 A;  2ONK E;  4YAH X;  5IM2 A;  2NWJ A;  2QRY A;  3GXA A;  1IMF A;  2ZNT A;  3FVN A;  3K6V A;  4GWY A;  4DXC A;  2WYP A;  3ROJ A;  1RYO A;  1FPL A;  3CRB A;  3UIF A;  4BDR A;  2YJP A;  4OFL A;  2DSF A;  4IO4 A;  1URD A;  5F7V A;  1FBE A;  1VFD A;  1M5B A;  3ONM A;  4LA9 A;  3DEL B;  3PMV A;  3TQL A;  1POY 1;  3CFX A;  3KSX A;  1LBY A;  4RNS A;  1BKA A;  2DXY A;  4MMP A;  1CE2 A;  1JEU A;  4KYD A;  2Q2A A;  1OQH A;  1FPI A;  1B3H A;  3I3V A;  5IKB A;  1DTZ A;  1XS5 A;  4FED A;  3MBP A;  4O94 A;  1NUX A;  5IZ1 A;  4N81 A;  1O64 A;  3VXB A;  2NXO A;  2Z8D A;  2ZYO A;  4PCD A;  4XEQ A;  1US5 A;  2AYS A;  3T66 A;  3V89 B;  4JWX A;  3IOT A;  2QVR A;  4LZ7 A;  2F78 A;  3OEL A;  4QXD A;  5AA2 D;  2D21 A;  4ZE9 A;  3KFM A;  5F24 A;  4JXI A;  2RC8 A;  2I0B A;  3G3K A;  4IY5 A;  3U65 A;  2XXK A;  1MQG A;  1K9Y A;  1B0H A;  1NV3 A;  4PAI A;  4AQ4 A;  3I5O A;  4U4X A;  4GRK A;  1URS A;  4FOR A;  1DOT A;  1S50 A;  1JEV A;  3TTN A;  3IOR A;  1Y3N A;  1T0K A;  3U8Q A;  2CMO A;  3Q26 A;  5EYG A;  1FPG A;  5AA4 A;  3T9H B;  3LSX A;  3H6W A;  1IXC A;  2ALU A;  5T3J A;  4ZS9 A;  3PUZ E;  1JET A;  4GX6 A;  1EZ9 A;  4PGP A;  3IB2 A;  4WEP A;  3UOR A;  1B3G A;  1G0I A;  1NH7 A;  4WXJ A;  2HCA A;  1IXI A;  3CSB A;  1NNP A;  4OXV A;  4EQ7 A;  3U92 A;  2XX8 A;  1ZBM A;  1MXV A;  4XFE A;  2XXT A;  2H98 A;  1DPP A;  3MJN A;  4NF8 A;  3C34 A;  2V25 A;  3QAX A;  3VV5 A;  1HSL A;  1OVB A;  2DOJ A;  3KN8 A;  3VVD A;  2OCU A;  1MY0 A;  3IOW A;  4NF0 A;  2ZZX A;  2B3B A;  5HM4 B;  3PPR A;  4GOT A;  4DLD A;  3FAT A;  1YYZ A;  2FIX A;  1IXG A;  5DVI A;  2Q88 A;  3KBZ A;  1AWB A;  3JYR A;  4P47 A;  1FPE A;  4P0G A;  1WOD A;  4QHQ A;  1NV6 A;  4LZ8 A;  4NE4 A;  2QS1 A;  2I3W A;  3C33 A;  4LON B;  2XWK A;  1MH3 A;  1IMD A;  1XI6 A;  1XVY A;  5CMC A;  1JW1 A;  3AXF A;  2UYF A;  1S7Y A;  4DI3 D;  2HQ0 A;  2ZYN A;  1NNK A;  3RT6 B;  1RDX A;  4R74 A;  3B7D A;  4PDH A;  1MH4 A;  2GHA A;  3I6V A;  5KZT A;  3V5A A;  3LSW A;  4XKR A;  5I57 A;  2B3F A;  4POX A;  2QFL A;  3UN6 A;  4H5F A;  1NUY A;  3PPQ A;  1LBZ A;  3SEY A;  4KHZ E;  1MXU A;  4ELQ A;  5TP9 B;  4N15 A;  4ZE8 A;  1FW0 A;  1N76 A;  4AS4 A;  2Q9T A;  1IMB A;  4OEV A;  4NMY A;  2WEF A;  1CB6 A;  3T93 B;  2PX1 A;  5H8N B;  3S9N C;  2DE2 A;  4GXS B;  5H8F B;  3T9X B;  5ELV A;  2O6A A;  4XXU A;  1B5H A;  2FYI A;  1N7X A;  1S9T A;  3FXR A;  3PPP A;  3CG3 A;  3GBA A;  1LAF E;  4E0W A;  4RJZ A;  3FD3 A;  4K3F A;  2HAV A;  2HFB A;  2DWA A;  4TLL B;  4DE8 A;  3U72 A;  3KBR A;  2Y5L A;  3KGC A;  2GFE A;  2OWZ A;  3TDJ A;  1FSA A;  4R75 A;  2O1L A;  5ET6 A;  5ISU A;  5CMB A;  2H5Y A;  4F1U A;  4U4S A;  4G8M A;  1B58 A;  3K1P A;  1XOC A;  2OPD A;  5EQ9 A;  4DXB A;  1FBD A;  4JWY A;  3FV1 A;  4YKP A;  5ICT A;  4U1Z A;  5EQ8 A;  5K2X A;  4YIC A;  4N6D A;  4NWC A;  3EPE A;  4I40 A;  4ZZE A;  3LUY A;  1R6Z A;  1GVC A;  4IR8 A;  3IK6 B;  4PFI A;  1N7W A;  4KYS A;  3W15 C;  4PFB A;  4Q0C A;  2Q2C A;  4H67 A;  2M8C A;  3W9V A;  3PGF A;  3IJX B;  1H76 A;  1MXW A;  1Q9D A;  2G93 A;  5AA4 B;  3N6T A;  1USY H;  1SI0 A;  4NQ8 A;  1N0T A;  3VE1 B;  1KA1 A;  4AB6 A;  1OLC A;  3HV1 A;  4MNP A;  5I5P A;  3TTL A;  5F1Q A;  2XXU A;  1IZ1 A;  4FAT A;  2OX3 A;  4EXL A;  3VVF A;  3FJM A;  1HSJ A;  1FBC A;  1QUI A;  3CFZ A;  3ZS6 A;  1FCK A;  3KOS A;  4XKQ A;  2V3T A;  5L9M A;  1O7T A;  4MF3 A;  1IUD A;  4QFK A;  5DW8 A;  1TT1 A;  2XWI A;  3RLF E;  2DWI A;  1Z7N E;  4I9D A;  2REJ A;  3FXU A;  3Q27 A;  3QK6 A;  2HEU A;  3NOH A;  5ICQ A;  3HHF A;  3ODB A;  4O7M A;  1SI1 A;  4FAJ A;  4PP0 A;  4OEU A;  2Q8M A;  4DDD A;  2Y7P A;  1PEB A;  1SBP A;  1PDA A;  3TEL A;  2V93 A;  4GF8 A;  4KI0 E;  4HS7 A;  5ET5 A;  1JVX A;  3IO6 A;  3Q25 A;  3A09 A;  3K02 A;  2Z23 A;  1B5I A;  1MM6 A;  3S2V A;  4MX6 A;  4O3B A;  4YKI A;  3TCF A;  4PBH A;  4C1T A;  1MQJ A;  3RY3 A;  1PBP A;  3RNN A;  4EQB A;  1RDY A;  5I56 B;  3D4C A;  1JP4 A;  5J1D A;  1J1N A;  1P1U A;  3OO7 A;  3CFL A;  2KQZ A;  1LBX A;  3MP8 A;  3CR9 A;  4QFL A;  3O29 A;  1SPI A;  1BK4 A;  1EU8 A;  1GR2 A;  1MM7 A;  1FQD A;  1NFT A;  5FHN A;  4P1E A;  3D1R A;  1MPC A;  1AIV A;  3FJ7 A;  5H8H B;  3RUM A;  1A99 A;  4MFI A;  5IZ3 A;  2V4C A;  5I59 B;  3G3H A;  3KG2 A;  5DVF A;  1SYH A;  2BJJ X;  4BLA A;  1N3X A;  4GWX A;  3HN0 A;  3VVE A;  3VXC A;  1Y4T A;  4IO5 A;  4OVR A;  1CNQ A;  2B65 A;  3S9M C;  1B4H A;  2DVZ A;  4GQO A;  4U21 A;  2RKM A;  4GX4 A;  3N26 A;  2XXI A;  3U1O A;  3RN8 A;  1IMC A;  2HZL A;  1FPB A;  3H6T A;  4PFW A;  3MWB A;  1XT8 A;  1NL5 A;  1MDP 1;  5CRY A;  1SW2 A;  2F35 A;  1B9J A;  1XVX A;  2UVI A;  4OVQ A;  1FTL A;  3C31 A;  4H65 A;  2H99 A;  5JEI A;  4DXU A;  2WBB A;  4GL8 A;  1PBQ A;  3RGY A;  5M2V A;  4PFU A;  1USY E;  2Y7R A;  1A8E A;  5AA1 A;  1KA0 A;  1GGG A;  1LBC A;  2LAO A;  1IIW A;  1Y20 A;  4NGU A;  1JQF A;  5CI5 A;  3K2D A;  2NVU B;  2G29 A;  4ND9 A;  2V3Q A;  3MW0 A;  1EYI A;  4OVS A;  3PU5 A;  3PUY E;  3T1B A;  2GQ1 A;  4KPT A;  1R1N A;  4GL0 A;  5ESY A;  5FHO A;  5TP9 A;  3T0J A;  3G7W A;  2X7Q A;  5H8N A;  5ET8 A;  2ZXT A;  5H8F A;  3O97 A;  2P2A A;  3OEK A;  1VFE A;  1DBZ A;  4MIJ A;  1MY2 A;  4RA1 A;  4GBW A;  2VOZ A;  3LBS A;  5BWJ A;  4Z7E A;  2H9B A;  4NF5 B;  5I2K B;  1LFH A;  4MHF A;  1M5D A;  4LZ5 A;  4JVD A;  4DIG A;  4EQ9 A;  3KN7 A;  3SEW A;  3O28 A;  2O69 A;  3VLV A;  1US4 A;  2CZH A;  4HE0 A;  3USD A;  2Y7I A;  5FTI A;  2FIE A;  4ZEB A;  1OMP A;  2R71 A;  1M5C A;  4OMB A;  4KQP A;  3O6G A;  4P8B A;  4F39 A;  4WKM A;  4O8M A;  3K1M A;  1II5 A;  4LUB A;  2XX7 A;  1DPE A;  1LAH E;  2QVU A;  1FPF A;  3RT8 A;  1QJM A;  3M8U A;  1D9Y A;  3FIR A;  4G77 A;  3WAE A;  2XXQ A;  3E78 A;  2ZZW A;  3MZB A;  4R6K A;  3UGW A;  3UK4 A;  1FPJ A;  1B2H A;  2ZNU A;  3IB1 A;  4THI A;  5KDT B;  1B5J A;  2HHM A;  3IB0 A;  3KJT A;  1QW0 A;  3DP8 A;  4LQ5 A;  1LCT A;  4YMA A;  2P1S A;  4BDN A;  1GTK A;  1YXI A;  2OZZ A;  5IZ3 B;  4P9K A;  2P3V A;  1NV5 A;  3VLW A;  4RK9 A;  2QVV A;  3P7I A;  3MPK A;  3MYU A;  2DXR A;  3HFU A;  2HZK A;  2WKY A;  4QFO A;  3OMB A;  2FBP A;  2YPN A;  3CVG A;  2R8T A;  5L9O A;  4F2O A;  2WBD A;  2ONR A;  2VT5 A;  5JTY B;  5A5L A;  4PET A;  4IGT A;  3IOV A;  1IME A;  3H03 A;  1AOV A;  1MQD A;  4N8G A;  1OIB A;  4U2R A;  5FHM A;  3HST A;  1LLS A;  1AL3 A;  4N17 A;  3SEX A;  3TZA A;  1VDW A;  2WYK A;  5CMM A;  5FBP A;  3IX1 A;  2RCA A;  2XXV A;  3SKP A;  4E0X A;  1EZP A;  1H43 A;  4KCC A;  1MY3 A;  2F6P A;  2O84 X;  1ANF A;  2VHA A;  2VP1 A;  4IGR A;  4PDD A;  3KEI A;  1IQ7 A;  2QSX A;  2QJE A;  1FJ9 A;  3DP4 A;  4OEN A;  2Q74 A;  4F3P A;  1R9Q A;  2H25 A;  2Q89 A;  4PAF A;  3FVG A;  4JWO A;  4YKK A;  3H3G A;  1MPB A;  3LUZ A;  3OO8 A;  3OO9 A;  3ILT B;  3SEU A;  4NG7 A;  4GWW A;  1QUK A;  2HXW A;  3GLB A;  3ECR A;  3ILU B;  1G0H A;  3V8X B;  4YB5 A;  3K6X A;  3BKI B;  1UTH B;  3A3C A;  3DLN A;  1FTO A;  4F18 A;  1FTJ A;  2I0C A;  1A54 A;  4JVC A;  2DS9 A;  2XWV A;  5I7I A;  3CI8 A;  5I56 A;  3HHG A;  1SW1 A;  2PYY A;  2QL3 A;  2H4I A;  1ZLQ A;  3FVK A;  3R7X A;  5H8Q A;  2QS3 A;  2XXR A;  1PB9 A;  2XWO A;  4GWZ A;  4N91 A;  3S9L C;  2DE4 A;  3O6H A;  1SDX A;  2RC7 A;  2RCB A;  4H8J A;  4HE2 A;  1B46 A;  4PFT A;  2A5T B;  5H8H A;  3EHS A;  4IO6 A;  5I59 A;  1B3L A;  4ZZA A;  1LFI A;  2NUV A;  2QS2 A;  4P0I A;  4EF2 A;  3MZ9 A;  3K00 A;  1NI9 A;  4NF4 B;  2Y5K A;  4EDP A;  3G3I A;  1LEV A;  5AE4 A;  4DZ1 A;  4ZEC A;  4ESW A;  4F3B A;  2NOO A;  3CHG A;  1NV4 A;  4TLM B;  1B32 A;  1NNF A;  2HPG A;  4I3Y A;  2XXX A;  3R26 A;  5DEX B;  2R6G E;  1B05 A;  4JB7 A;  2F7C A;  1QVS A;  4G8H A;  3FBP A;  3N94 A;  4PF8 A;  1MRP A;  4O3A A;  4XIG Q;  2XXH A;  1FRP A;  4RYA A;  1UIU A;  3GZG A;  4X48 A;  2PVU A;  1LCF A;  2E0S A;  1B51 A;  3MZ1 A;  3C35 A;  3TFL A;  3QYT A;  4U22 A;  1QKB A;  4R2F A;  3EHT A;  1M5F A;  1B0L A;  1M5E A;  1YCJ A;  3PUV E;  1NV1 A;  1NUW A;  4ELO A;  5DVJ A;  4LAT A;  2I49 A;  2AIX A;  2Z8E A;  2ZYM A;  3D4G A;  3G3J A;  2O7U A;  1BTJ A;  1DK4 A;  4R9F A;  1Y1M A;  2A5S A;  5ET7 A;  5I58 B;  4P3L A;  3UA8 A;  2KLF A;  3R6U A;  5CM6 A;  3B6Q A;  3PD8 A;  1I69 A;  4LVQ A;  1FJ6 A;  4NAP A;  1NMU A;  5AA3 A;  1MQI A;  3LSF B;  3SDF A;  2XD3 A;  2QMW A;  5J16 A;  4QF9 A;  3B6W A;  3O9P A;  3OO6 A;  4P56 A;  3TQW A;  3TPA A;  3M3F A;  3EHU A;  1IMA A;  4BDM A;  4R73 A;  1N04 A;  3E4R A;  1Y4C A;  3PUX E;  2KR0 A;  3IO4 A;  1MY4 A;  4F1Y A;  4QRZ A;  4FIM A;  1URG A;  1BLF A;  2PT2 A;  4NF5 A;  4NWD A;  3T9U A;  4IO3 A;  5I2K A;  2RC9 A;  4Q5T A;  3FXQ A;  3ZKL A;  4OHN A;  1FBH A;  1NV0 A;  2IA4 A;  1FTA A;  4QSC A;  4NHB A;  4X9T A;  4I3E A;  5L9S A;  5EYF A;  2CZL A;  2QMX A;  1FQF A;  3Q29 A;  3TKD A;  3SZP A;  2UVJ A;  1D9V A;  3TMG A;  1RDZ A;  2HAU A;  3QMF A;  3IFC A;  5EQ7 A;  4HCW A;  4AB5 A;  3GYY A;  3OOA A;  3MVW A;  1I6A A;  3QXM A;  1MXZ A;  3PD9 A;  4ECF A;  2OBG A;  2FA7 A;  4I1D A;  3DM0 A;  3FAS A;  1JW4 A;  2I48 A;  5H8Q B;  1SVX B;  5A5X B;  3IOU A;  1JVY A;  1Y3Q A;  3H4Z A;  3PPO A;  1Q35 A;  1D4N A;  4GIZ A;  2DDK A;  1L5T A;  1UQW A;  5KDT A;  4G2Z A;  4OVP A;  3FVO A;  1VE4 A;  4H45 A;  4LN5 A;  2REG A;  4EF1 A;  2ZNS A;  4P11 A;  1EH3 A;  4ZED A;  2DVC A;  3JZJ A;  5DTB A;  2X7P A;  1JW5 A;  3MQ9 A;  5JK4 A;  3QIM A;  4RPN A;  4XKN A;  4DCX A;  3F11 A;  2D3I A; 
#chains in the Genus database with same CATH homology
 1IMD A;  1XI6 A;  1D9Q A;  4JVD A;  4DI3 D;  2CZH A;  4HE0 A;  1RDX A;  2FIE A;  4PDH A;  4P8B A;  4O8M A;  2QFL A;  1NUY A;  2QVU A;  1FPF A;  2L5V A;  1LBZ A;  3A29 A;  3BIH A;  3E78 A;  2PFY A;  2ZZW A;  3B8B A;  2VPO A;  4N15 A;  4AS4 A;  1NV2 A;  2Q9T A;  1IMB A;  1FPJ A;  2WEF A;  2DE2 A;  4XF5 A;  4HCY A;  2HHM A;  4H46 A;  3PTY A;  4MNI A;  1YXI A;  5IZ3 B;  4P9K A;  2P3V A;  1NV5 A;  2XA5 A;  1QGX A;  2QVV A;  2QPQ A;  2B4L A;  3MYU A;  1FPK A;  3HFU A;  2PFZ A;  2HZK A;  2B4M A;  1EYK A;  2HXR A;  4N6K A;  2Y5L A;  2OWZ A;  4AS5 A;  2FBP A;  2CEX A;  1FSA A;  2R8T A;  2WBD A;  2VT5 A;  5ET6 A;  5A5L A;  4PET A;  4MJO A;  1EYJ A;  1IME A;  4F1U A;  5IGA A;  4N8G A;  4N17 A;  3RYD A;  2JJK A;  5EQ9 A;  1VDW A;  1DCU A;  2WYK A;  2FHY A;  5FBP A;  1FBD A;  2F5X A;  4YZZ A;  4PBQ A;  3W9W A;  1YZ0 A;  5EQ8 A;  4YIC A;  4N6D A;  4OAN A;  4PDD A;  1FJ9 A;  4I40 A;  4IR8 A;  2Q74 A;  4PFI A;  4PFB A;  3EKI A;  4PAF A;  3ISP A;  2BJI A;  4MNC A;  3W9V A;  1Q9D A;  2WX9 A;  3LUZ A;  4NG7 A;  4GWW A;  4NQ8 A;  4NX1 A;  1G0H A;  4P1L A;  1KA1 A;  2CEY A;  2P3N A;  4MNP A;  5I5P A;  3RPL A;  4QBA A;  4F18 A;  4MCO A;  1FPD A;  4JVC A;  2OX3 A;  2XWV A;  4F1V A;  1FBF A;  1FBC A;  5I7I A;  4OVT A;  2DE3 A;  3B50 A;  4MEV A;  5DW8 A;  4MAG A;  4PGN A;  2XWI A;  1FBP A;  2XWO A;  4NN3 A;  4GWZ A;  4N91 A;  2DE4 A;  3NOH A;  4X04 A;  4O7M A;  4HE2 A;  3FXB A;  3BIG A;  2Q8M A;  5LDZ A;  4UAB A;  4PE3 A;  5ET5 A;  3KC0 A;  5I3S A;  4GWU A;  4F19 A;  1NI9 A;  2F3D A;  5EQA A;  2Y5K A;  4MX6 A;  3RPL B;  2VPN A;  4HE1 A;  1LEV A;  4PFR A;  5IM2 A;  4PBH A;  1IMF A;  1RDY A;  4GWY A;  3E79 A;  3CHG A;  1JP4 A;  1NV4 A;  2WYP A;  3ROJ A;  5J1D A;  1FPL A;  2HPG A;  4GX3 A;  4PAK A;  4I3Y A;  4G61 A;  3FBP A;  4PF8 A;  1FBE A;  2KQZ A;  1LBX A;  1FRP A;  1NV7 A;  2ZZV A;  1SPI A;  1FBG A;  1BK4 A;  1LBY A;  4MMP A;  4P1E A;  3D1R A;  1FPI A;  1NV1 A;  1NUW A;  3IFA A;  5IZ3 A;  2V4C A;  1K9Z A;  4O94 A;  1NUX A;  5IZ1 A;  5LTC A;  4N81 A;  1DK4 A;  3LV0 A;  4PCD A;  4GWX A;  4XEQ A;  5ET7 A;  2QVR A;  4P3L A;  4OVR A;  1CNQ A;  5CM6 A;  4QXD A;  2DVZ A;  4FBP A;  1FJ6 A;  4NAP A;  4GX4 A;  4GWS A;  4HXV A;  3KC1 A;  4JVI A;  5F24 A;  5J16 A;  1IMC A;  2HZL A;  1FPB A;  2F3B A;  3U65 A;  2CZI A;  2XXK A;  4OA4 A;  4P56 A;  1K9Y A;  4N8Y A;  4OVQ A;  1NV3 A;  1LBW A;  4PAI A;  1IMA A;  2MKZ A;  4KXP A;  2KR0 A;  2WBB A;  2PCR A;  1KA0 A;  3MST A;  4X8R A;  1FBH A;  1NV0 A;  5EYG A;  1FPG A;  1FTA A;  4NGU A;  4DI4 B;  2FVZ A;  4NHB A;  4X9T A;  5T3J A;  4I3E A;  4GX6 A;  4PGP A;  3SZP A;  1G0I A;  1RDZ A;  2V3Q A;  3QMF A;  3IFC A;  5EQ7 A;  4HCW A;  2CZK A;  1EYI A;  3GYY A;  4OVS A;  4M1V A;  3T1B A;  2GQ1 A;  4XFE A;  5ESY A;  1INP A;  1NUZ A;  3T0J A;  4O7I A;  4GBV A;  4PTK A;  1LBV A;  5ET8 A;  2DDK A;  4NF0 A;  4PC9 A;  2ZZX A;  4OVP A;  1KZ8 A;  4PF6 A;  1DBZ A;  5EYH A;  4MIJ A;  4H45 A;  1YYZ A;  2FIX A;  4LN5 A;  4GBW A;  5IZZ A;  3KBZ A;  1AWB A;  4P47 A;  1FPE A;  4N4U A;  1NV6 A;  5JK4 A;  4MHF A;  2XWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...