5IZ1A

Physcomitrella patens fbpase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
337
structure length
321
Chain Sequence
ITTFTTWLLKQEQAGVIDGELTIVLSSISLACKQIASLVQRAGISNLTGEDQKKLDVISNEVFSSCLRSSGRTGIIASEEEDTPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYKPNEECLTIDEVAQNCVVNVCQPGSNLLSAGYCMYSSSVILVLSVGHGVYGFTLDPLYGEFVLSHEEIKIPKSGKIYSFNEGNYALWDDKLKKYVDSLKDPGPSGKPYSARYIGSLVGDFHRTMLYGGIYGYPRDSKSKNGKLRLLYECAPMSYLAEQAGGKGSDGHQRILDIQPEQVHQRVPLYVGSTEEVEKLEKFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords fructose-1,6-bisphosphatase
publication title Chloroplast FBPase and SBPase are thioredoxin-linked enzymes with similar architecture but different evolutionary histories.
pubmed doi rcsb
source organism Physcomitrella patens subsp. patens
total genus 89
structure length 321
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5iz1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5iz1A02
5ET8A 4PTKA 4AS5A 1FPBA 1G0HA 4N81A 4GX4A 1SPIA 1JP4A 1YXIA 2F3DA 1NV5A 2CZHA 5ET5A 3LV0A 1FTAA 4AS4A 1FRPA 1NV2A 1QGXA 2CZKA 5A5LA 4I3EA 3D1RA 2WEFA 4GWUA 3QMFA 1FPKA 2FIEA 5IZ1A 1IMDA 5EQAA 1FBGA 1NV6A 2CZIA 5I3SA 1DBZA 4QXDA 3BIHA 1RDYA 4GWZA 1FBDA 5T3JA 2Q74A 2FBPA 3IFCA 1NV1A 4KXPA 1K9YA 4GX3A 1INPA 1EYIA 3BIGA 4GWYA 1FPIA 4GWXA 5EQ8A 4HXVA 3B8BA 1BK4A 4H45A 2P3VA 1KA0A 1FBFA 3RYDA 1FJ9A 1FBCA 3A29A 1KA1A 2FIXA 1IMBA 5F24A 4GWSA 5EQ7A 1IMFA 3KC1A 3KBZA 5EYHA 2WBDA 2QFLA 1NUYA 2QVUA 4FBPA 5DW8A 2P3NA 5J16A 2FHYA 3RPLB 1NV7A 2DDKA 1FJ6A 1LBVA 2JJKA 2WBBA 1IMCA 3LUZA 2BJIA 3KC0A 4O7IA 3T0JA 1IMAA 1NUXA 4GBVA 1FPGA 1KZ8A 1FBHA 5IZ3B 2R8TA 1VDWA 3RPLA 2F3BA 1EYJA 2Q8MA 1D9QA 4IR8A 3ROJA 1Q9DA 2FVZA 4MJOA 5IZ3A 4GBWA 1FBPA 4H46A 1NV3A 4G61A 1LBWA 1LBXA 1XI6A 1NUWA 4I3YA 1AWBA 5EQ9A 1CNQA 2HHMA 1NV0A 1RDXA 1LEVA 1FPDA 1FPEA 4HE0A 5FBPA 1DK4A 2OX3A 5ESYA 2Y5LA 1NUZA 2QVVA 4GX6A 1LBZA 1G0IA 1YYZA 1FSAA 2OWZA 4HE1A 2GQ1A 1FPFA 1FPLA 4HE2A 2Y5KA 1FBEA 2QVRA 1K9ZA 1DCUA 1FPJA 1LBYA 1NV4A 1YZ0A 4GWWA 4I40A 5EYGA 1IMEA 3FBPA 5LDZA 1EYKA 3IFAA 1NI9A 2PCRA 1RDZA 5ET7A 2VT5A 5ET6A
chains in the Genus database with same CATH superfamily
3LUYA 3W9VA 4POWA 3H4ZA 1SPIA 3A3CA 2XWVA 1FQFA 2Q89A 3FD3A 3MPKA 1FRPA 4EF1A 4QSDA 2XX8A 5H8NB 5A5LA 1B4HA 4EXKA 4I62A 5LTCA 4NE4A 3QMFA 1HSJA 3IOWA 1A40A 3W9WA 2ZXTA 4FIMA 2Q74A 3KOSA 3IX1A 2XX9A 1JW1A 4YAHX 3OMBA 5AA4B 1FBFA 4IO6A 5I2KB 1H43A 1FTKA 1IMFA 3KBZA 2P3NA 3HV1A 2B3FA 3OOAA 4OEUA 3T22A 4KYSA 2XD3A 2BJIA 3Q27A 1NUXA 2WYPA 3CHGA 3HPIA 2V4CA 3KEIA 1OMPA 2OBGA 1IUDA 1QUIA 4GBWA 3G3JA 4R73A 2NXOA 3EHUA 3MW0A 1II5A 1UQWA 3F11A 3CFLA 1POTA 4NAPA 4N6PA 1M5CA 3LBSA 1NUZA 4LONB 4N91A 1DTZA 3THIA 2GQ1A 4HE2A 1M5EA 2LAOA 1NNFA 4PP0A 3FGSA 3JYRA 3S4UA 2XXIA 5LDZA 1MRPA 1PDAA 2ONKE 3PPRA 3IFAA 2RINA 4OVTA 1TXFA 1B3EA 1QULA 1OQGA 5ET5A 1O7TA 3TDJA 3RT6B 3MBPA 2VD2A 5J1DA 3GBAA 4O3BA 4R74A 4O3AA 4FEDA 2R9JA 3LSFB 1LBCA 3FXQA 4UA8A 2RCAA 1Z7NE 1IMDA 1B51A 1MXUA 3NOHA 2XXPA 1N84A 2DP8A 2ZZVA 3UP9A 2ZYOA 3IOUA 1K9YA 2V25A 3BIGA 4ELQA 4GWXA 3DLNA 4F1VA 5JEIA 2CMOA 2ANJA 5I5PA 4U4SA 1UTHA 4PF6A 1B0LA 3MZBA 2Z23A 2QFLA 1F9BA 3PPOA 3SETA 4F29A 3OENA 1FCKA 1IXHA 3T0JA 1MQJA 4OVPA 1FPGA 4N13A 5TPAA 1IEJA 2I48A 5KZTA 3S9MC 4PC9A 3H06B 1HSEA 3VLWA 2FVZA 3TQWA 4PAFA 5DVJA 1AWBA 1CNQA 3K6VA 2IA4A 3TFLA 2HQ0A 2ZZXA 2I0CA 4H1XA 4OA4A 2XXRA 1Y1ZA 3L6GA 4F1YA 1LFGA 1DMBA 3CG1A 4QBAA 3HN0A 4LZ5A 1LBYA 1B7ZA 2A5SA 3VLUA 5FHNA 3SEXA 3U93A 3EHSA 3HSTA 3K4UA 4MMPA 4AS5A 5I7IA 1AL3A 1TFDA 3C36A 5BWJA 1NV5A 4P3LA 4GWOA 4AS4A 3O97A 2CZKA 1JEVA 4MHFA 2KR0A 2F6PA 1GV8A 5I56A 4TOZA 1M5FA 3PMXA 2REGA 1LFIA 2GH9A 2ZNSA 5ITOA 5I2NB 3MSTA 3Q25A 1HSLA 3E3KA 4PCDA 4LQ2A 4I1DA 4FEBA 2VHAA 3MZ9A 2DVZA 2XXHA 1KA1A 4PGPA 5I58B 5JTYA 4EDPA 3MC2A 4JVDA 4R6KA 1VFDA 4QFLA 4KQPA 5FTHA 3TKDA 2YLNA 1B5HA 3V83A 2DE4A 3B50A 3TTMA 1LBBA 4H46A 3K1PA 5M2VA 1AMFA 1FPEA 5FBPA 3SEWA 1UIUA 3OO8A 2Y5LA 1JW5A 2XXTA 3MP8A 2FYIA 4N17A 2I3WA 3IOTA 4DE8A 3DP4A 5CMMA 5EYGA 2X26A 4NF5A 2X7QA 2PCRA 4OFOA 1P1NA 4X1BA 2NOOA 3T9XB 5CBRA 1D3KA 2VP1A 4NWDA 1T0KA 3CIJA 4AB6A 2VGQA 3FZVA 1RKMA 5I59B 4HW8A 4XKQA 3FXRA 5ICQA 4ZEIA 2DE2A 3QUJA 2WEFA 4G68B 4POXA 3MVWA 2O6AA 3K00A 2ONSA 5F7VA 4F2QA 4EQ7A 1Y3NA 4R75A 4GWZA 3T93B 1MM6A 1TWYA 3UA8A 4FECA 3QXMA 4KYDA 1Y4CA 2DXYA 1P1UA 2B4MA 1B1HA 3M3FA 1B2HA 3FJGA 4C1TA 1GVCA 2ZYMA 4ELOA 2PX1A 1B6HA 2AIXA 3A09A 3B7DA 1ZTYA 2O68A 2F7AA 4FATA 3KZGA 2QS4A 2I49A 1Q9DA 4YB7A 2P0SA 3U8QA 5DVFA 1FBPA 3HHGA 2OLBA 3KN8A 4PAKA 4P8BA 3FVOA 2QMWA 4RK2A 1SW5A 3B6QA 3SEYA 5ICTA 1VFEA 4OMBA 3I5OA 3N26A 5DEXA 4G8MA 1LBZA 1MXXA 1BP5A 2XXWA 3O2AA 4JBZA 4JB7A 1FBEA 5ISUA 4PFBA 4PFUA 3FBPA 1H45A 1NI9A 3Q29A 4G8HA 5ET7A 2NWJA 5L9MA 4N81A 3CRBA 1JP4A 3KGCA 3RQTA 4LP2B 2XXXA 4BLAA 2VOZA 1BKAA 3LV0A 1WVJA 4G2ZA 3CFXA 3TODA 1I6BA 4PDDA 4ELPA 4GXAA 3FJMA 3MAMA 1FPKA 5H8NA 5HBCA 3CSBA 3B6TA 1R6ZA 1NV1A 3K1MA 3FVGA 1IXGA 1FPIA 4LA9A 3SESA 2G29A 2H98A 1BK4A 2H4IA 4NF4B 1US4A 2THIA 4PAIA 3OXNA 1FJ9A 1FBCA 3A29A 3CVGA 4H6DA 4Q8RA 5AA4A 1P1OA 4NF0A 4LATA 5I2KA 4YKPA 1SDXA 4ZEBA 4N8YA 1Y4TA 5EYFA 1P1QA 2O84X 1FTLA 4X8RA 2WX9A 1M5BA 4MJOA 2AL4A 3RUMA 5H8HB 3TTKA 5I84A 3BFTA 1FQAA 1XI6A 4L17A 3CFZA 1NKXA 4OTEA 2Q2AA 1LEVA 1I6AA 2V3QA 4OQOA 2D5WA 1MH4A 3BBRA 4IY6A 4RY1A 2QRYA 2RC8A 4E0XA 2Q88A 4GLIA 5TP9B 2F6GA 1MQDA 2Z22A 2DWAA 3CR9A 5CMCA 2UVGA 4F1UA 1SW1A 2DSFA 2PBWA 1Y20A 3ISPA 1B5JA 1UTBB 1PC3A 2DE3A 4QF9A 4NEDA 1NMUA 2OJTA 3OSQA 4NF8B 4NG7A 3D1RA 4R6HA 3OELA 2IEEA 3HHFA 4QXDA 2F78A 4PE5B 5T3JA 3TQLA 3MP6A 2O69A 1EYIA 1FQDA 4NF6A 4PFTA 4U23A 2ZNUA 3B8BA 3SERA 1KA0A 2RCBA 2V84A 4AQ4A 4XTCQ 3W15C 4DXUA 2A5TB 3IR1A 5KDTB 1B32A 3RLFE 3PD9A 2F7CA 1CB6A 2WBDA 1ZBMA 4X9TA 1FQCA 2UVHA 5IZ3B 2KLFA 1NNTA 3C35A 3EHTA 4JVIA 4IY5A 2WYKA 4X48A 3USDA 2GHAA 3G3IA 4OFLA 3LSWA 1FTOA 4M1VA 3FUZA 5AA2B 4IO7A 3MWBA 4H5FA 3K1NA 1YYZA 2KQZA 1YAEA 4BDRA 2FA7A 2PVUA 4H5GA 4MLVA 4O94A 4RXLA 4MNPA 2RC7A 3K02A 3SEUA 1SQYA 1YXIA 1MY0A 3GXAA 3TPAA 3FIRA 4H65A 1O64A 3O66A 1QUJA 1QKBA 2XWKA 4ZEDA 4GWUA 2G93A 5EQAA 5I3SA 3R7XA 3MJNA 5TU0A 2RKMA 2QMXA 5K2XA 1FBDA 3O6IA 4WKMA 4GIZA 3IFCA 2D3IA 3C33A 3DELB 3VV5A 5I2NA 3C34A 3FV2A 3QAXA 3TCFA 1B46A 3QSLA 2M8CA 5CMKA 4DIGA 2FHYA 4ESXA 3RPLB 5DYHA 3EN3A 4LZ7A 3KBRA 5I58A 3P7IA 3MVZA 4XXUA 3ZKKA 3FASA 1B0HA 4P1LA 3ZSFA 3MUQA 2O1LA 4G61A 3BKIB 4HCYA 4MBPA 3TTRA 3LC8A 4Q30B 4P47A 1A55A 1ANFA 4JDFA 2HHMA 1ATGA 1S9TA 1FPDA 1MS7A 3G3HA 5L9OA 2PMSA 5ESYA 1MQHA 1TFAA 4R2FA 4KFQA 3JV9A 4AB5A 4P0IA 3UK4A 2B4LA 1OVBA 3R6UA 5L8DA 1GR2A 3CG3A 4GL8A 1FPJA 3HFUA 4BDLA 2ABHA 3MP1A 3T66A 2V93A 2OWTA 2DOJA 3R26A 4PFYA 1JNFA 5B7DA 5FHMA 2HXRA 1USYE 4N8GA 1Y9UA 5A5XB 4F2OA 3EQ1A 4KPTA 4NQ8A 2O7IA 1B5IA 1D9VA 2B3BA 4IO5A 4KYEA 1QKAA 4YKJA 3RNNA 1EU8A 1OIBA 1RDYA 4G68A 1NH8A 4GX3A 3OSRA 4K3FA 4DCYA 4E0WA 2Q8JA 3DP8A 2OWSA 3TTLA 5KCJB 2AYSA 2REJA 5DT6A 1N7XA 2I0BA 4QSEA 5DW8A 3H6WA 1MM7A 3KSXA 4OYVA 3MYUA 4BDQA 2XWIA 1Y3PA 1MXVA 2Z8DA 3CI8A 2ONRA 1VDWA 3K6XA 4FJPA 3T9VA 1ZIUA 4IR8A 3ROJA 4MNCA 3VDFA 2GHBA 4EUOA 4MAGA 4F31B 2I4BA 2DVCA 4ZEFA 1FTJA 2NVUB 4ZE8A 1GGGA 3MVYA 2QVRA 1MXWA 2ZNTA 1FQEA 1KWHA 4F3GA 3PD8A 2P1SA 1RDZA 2F7BA 4YKKA 2F3DA 3OO7A 2CZHA 4P56A 4C1UA 4DDDA 4MIJA 2DQVA 1D4NA 2O51A 1MPCA 3IB0A 5IKBA 4EQBA 3U1OA 2ZZWA 1IQ7A 1NV6A 2NUVA 4N6KA 3VVFA 1A54A 4GWYA 2XXUA 5EQ8A 3IK6B 2PFZA 3DP6A 5HM4B 4GFRA 3U72A 1B1XA 3ONMA 3K0VA 4G8NA 1YTVA 3FXUA 5EQ7A 4NF4A 4FBPA 4NN3A 5J16A 3PMVA 3PU5A 1FJ6A 1IMCA 3LUZA 4N6DA 1URGA 2ALUA 3VLVA 1IXIA 1RYOA 4N4UA 4THIA 3E13X 4GVOA 1Q35A 3H3GA 4GRKA 5ELVA 4UACA 1LCFA 1MQGA 3SZPA 4F3BA 1NUWA 1SYHA 3ECRA 4OVSA 1NV0A 4DI4B 2OX3A 5H8HA 3C31A 1RYXA 4YMAA 2Y7WA 4KCDA 1PB7A 3TELA 4I9DA 1FPFA 4R72A 3LR1A 2Y5KA 5H8FB 3QIMA 2Y7RA 4FAJA 3VVDA 3N6TA 2DXRA 2MKZA 3T9UA 4IO3A 4ZE9A 1G0HA 3IAZA 5IAIA 2Z8FA 2VPOA 5TP9A 3GBBA 3T1BA 2ESNA 1FTAA 1LCTA 1YPNA 3TAJA 5H8QB 4I3EA 2XX7A 1SVXB 3H6VA 1VSOA 1UTBA 3UGWA 4ISUA 2H25A 1URSA 3IJXB 1FBGA 2CZIA 4KI0E 4DI3D 3UORA 4NF8A 1Y3QA 3EPEA 5JK4A 2CZLA 2Y7KA 3OO6A 3L6HA 3U94A 1SD3A 4MNIA 5FTIA 3ZKLA 3IORA 1OLCA 2HCAA 4M4GA 2AL5A 4Q0CA 2XXVA 4RJZA 1IMBA 3QUFA 1FQBA 4QHQA 4N15A 2ZMBA 1JQFA 2V3TA 2DDKA 2A5TA 3BFUA 5KDTA 2QPQA 5DTBA 5AA3A 5AE4A 1KZ8A 1SI1A 1UIVA 2R8TA 2Y7IA 1EYJA 3KJTA 1JEUA 1VR5A 4YICA 5IZ3A 2VD3A 2DYXA 3VVEA 1B05A 1R9LA 2PT1A 1LBXA 2VPNA 5I57B 3O6HA 4ZDMA 2F97A 1RDXA 4EQ9A 4GD5A 3FXBA 3IO4A 2QVVA 2F8DA 3RN8A 2OWZA 5IGAA 5AA2A 3N94A 1FPLA 4O7MA 4OHNA 1SW2A 1OVTA 1K9ZA 4NHBA 1PB8A 3G7WA 4JWXA 1IMEA 2Z8EA 3PMWA 2I6EA 4G68C 4GL0A 4QFKA 3VXCA 4ELRA 1EYKA 4OWDA 4U1ZA 1B4ZA 2VT5A 4P9KA 4PQJA 3PV0E 5AA2D 2F35A 3E4RA 3O29A 4LVQA 1SBPA 2DWIA 3K2DA 1FW0A 1QGXA 1XC1A 2RF1A 2B65A 2Y84A 5DVIA 4XKPA 1BLFA 3GLBA 3C32A 3GZGA 3HO7A 3KN7A 4LQ5A 4IO2A 5CM6A 1DBZA 4R6YA 3PPQA 1EZPA 2FBPA 4OVJA 4KXPA 3WAFA 1QW0A 3HCQA 4U2RA 1N3XA 4KR5A 4R2BA 2UYEA 4PFWA 4RYAA 2HAUA 3ODBA 3RYDA 3M8UA 1JW4A 4GWSA 3PGFA 5EYHA 5IM2A 4UABA 1XVXA 3H6UA 3FJ7A 1LBVA 1MY4A 2XD2A 4XKNA 1FBHA 1N3WA 3H03A 2O7UA 1IXCA 3RPLA 2Q8MA 4ZZEA 1ZKBA 1JETA 4NTLA 3QYTA 1AH5A 1NFTA 1DSNA 1NV3A 1ZJLA 4DCXA 4MEVA 3PPPA 3M3KA 1AIVA 3PTYA 1G0IA 4YU0A 2HXWA 4IO4A 4JVCA 4IB2A 1N04A 3PUWE 1YZ0A 1LB9A 5AA1A 1MXZA 3FVNA 3G3GA 4MH5A 1SYIA 2UVIA 4F3SA 4PTKA 3V5AA 2I3VA 3KN3A 1EH3A 4F3PA 3K6UA 3IJOB 5FHOA 3IB1A 4ESWA 2QJEA 1SW4A 1BIYA 1MY3A 2XA5A 5A5XA 4ECFA 2OZZA 1B7HA 4OANA 3UN6A 1LGBC 3IB2A 4PDHA 1IIWA 4YKIA 3S9LC 3AXFA 4OVQA 3E78A 4ZEKA 4TLLB 5KCJA 1VE4A 1XS5A 4LZ8A 1NV7A 4WEPA 2JJKA 2WBBA 3KSJA 1PBPA 1BTJA 3OEKA 4XKRA 2F3BA 1NNKA 5BUUA 2CEYA 4KD5A 2OCUA 4RK9A 4I3YA 5EQ9A 4JSOA 1DK4A 1US5A 4NX1A 4F19A 3SDFA 3ZS6A 4GX6A 3O28A 3RT8A 2H99A 2E0SA 4Q5TA 1QVSA 1R1NA 4DLDA 4IGRA 5CC2A 4OFJA 2R6GE 4NF6B 1MH3A 1A7LA 3TEPA 2HZLA 2L5VA 1P99A 4RPNA 4GX4A 3SEVA 4MCOA 2GFEA 1S50A 4O3CA 4Z7EA 3LSXA 1B9JA 4HTGA 4R9GA 3RY3A 2R71A 1ZLQA 4MFIA 1MG1A 4YB5A 1LSTA 4O8MA 3TZAA 3I3VA 4OENA 3E9XA 4R9FA 3OEMA 3PUYE 3BIHA 1ELJA 2ZYKA 3G3FA 4IGTA 1JVXA 1H44A 4U21A 4HXVA 4OETA 2P3VA 1YCJA 1MDQA 3O9PA 1POY1 1A8FA 3VFJA 2F36A 1LAFE 5I59A 5F24A 2H5YA 3CSGA 5L9SA 4U1OA 4H8IA 1EZOA 4F39A 5ITPA 3ILUB 3RPWA 1AOVA 3UIFA 3OO9A 1MY1A 5HPQA 3OD7A 4WEDA 1PBQA 3H6TA 4JWOA 1N76A 4EXLA 4MF3A 4F22A 1XT8A 1I69A 5B70A 3IL1B 4HE0A 4PF8A 1B40A 3S2VA 1P1WA 4WXJA 4PBHA 2QS2A 1A99A 3U92A 4GOTA 1NV4A 3MVXA 2XXKA 5H8FA 4RA1A 1QUKA 4KCCA 1N7WA 2E1SA 5CRYA 1MY2A 4FORA 1DTGA 5EHSA 4PETA 2H9BA 4H67A 2F34A 3IOVA 4QFOA 1QJMA 2FNCA 1L5TA 3PUZE 1LFHA 4H8JA 4OESA 1J1NA 4EF2A 2I4CA 4MX6A 4TQUQ 3IO6A 3K6WA 5IZ1A 5H8QA 1S7YA 3EKIA 3MPLA 5CMBA 5H8SA 3Q28A 3H7MA 3TTNA 4P1EA 2WKYA 2YJPA 1UTHB 4ZZAA 3D4GA 4I8CA 1M5DA 4N07A 2X7PA 3D4CA 2UXAA 1B3GA 4Z0IA 5EHMA 2HEUA 1D9YA 4QSCA 4NGUA 4X04A 5TPAB 4QFPA 3KC1A 1MPDA 2OPEA 2QVUA 3T9HB 2GRVA 2HAVA 3Q26A 4F18A 3KG2A 4ONYA 4G77A 3KC0A 3DM0A 4U4XA 4GBVA 3TUSA 2W7YA 1H3DA 3E79A 4RNSA 4BDMA 4LN5A 4KHZE 3T96B 1Z7ME 4NWCA 1B52A 4ZECA 4U22A 4P11A 4JSDA 2O1MA 4JWYA 2DWHA 5LOMA 4G4PA 2D21A 3JZJA 2HZKA 4RPOA 4HCWA 3S9EA 4HS7A 4C0RA 5I57A 2I58A 2XHDA 1LAXA 3TCHA 3B6WA 1DCUA 1XVYA 1CE2A 2YPNA 2XXYA 3RTFB 1TT1A 3KFMA 3PPNA 3VE1B 3KJ7A 4OXVA 4LUBA 2HFBA 5I56B 4GQOA 1NV2A 3K01A 1ZMGA 5CI5A 4P0GA 1URDA 3C9HA 3MQ9A 1PB9A 1B58A 1B7UA 4JXIA 2BJJX 3WAEA 2QS3A 1XHYA 5JTYB 4H0WA 3V89B 1A8EA 3SKPA 2XWOA 4YZZA 1NL5A 2XXQA 4ZS9A 4XIGQ 4O7IA 4NMYA 2P2AA 3TCGA 1JVYA 1USYH 3U65A 1D9QA 1EZ9A 1B3HA 2QSXA 4XF5A 1DPPA 1I6QA 5CBSA 1LBWA 1MXYA 4OERA 4PE3A 2PYYA 1PEBA 2CEXA 4OEVA 2ZYNA 3KOTA 4PGNA 2PFYA 4NF5B 1MDP1 4OZ9A 4HE1A 1LLSA 2QL3A 3RGYA 4BDNA 4DXBA 4DZ1A 3N6UA 1LB8A 3G3KA 4GF8A 2OPDA 5ET8A 2F5XA 1FPBA 1OLAA 5IZZA 3TYHA 3N5LA 1IITA 3I6VA 3QK6A 1Q1KA 1LAGE 2Q9TA 3A3UA 2FIEA 4QFNA 4BDOA 4TLMB 4DXCA 4GXSB 1INPA 3V8XB 1H76A 4H45A 4YMBA 2QS1A 2Q2CA 3GYYA 1MQIA 1NNPA 3RTWB 2PT2A 4YB6A 3FV1A 4OVRA 2FIXA 1N0TA 2V3UA 2Y7PA 3O6GA 1NUYA 3EF7A 4MLQA 4PFRA 1IMAA 1DOTA 4XFEA 4FE8A 4PBQA 3PUVE 1Y1MA 1WDNA 3VXBA 3S9NC 3TMGA 1R9QA 3MZ1A 4PFIA 5DEXB 1IZ1A 5K2YA 1O63A 2DS9A 1B3LA 1DPEA 3PUXE 1GTKA 1FTMA 3C4MA 3LSLA 3M3LA 3FATA 1FSAA 1MPBA 1OQHA 4X1DA 1SI0A 1NH7A 2HPGA 4XEQA 1WODA 4QRZA 4I40A 4GWWA 4ND9A 2DWJA 2UYFA 2OK2A 2UVJA 3ILTB 3FVKA 1XOCA 1B3FA 1ZU0A 1LAHE 5F1QA 5ET6A 2RC9A
chains in the Genus database with same CATH topology
2HZLA 3W9VA 2L5VA 4N81A 4GX4A 1SPIA 4MCOA 1JP4A 2F3DA 2XWVA 2CZHA 3LV0A 4P56A 1FRPA 4MIJA 5A5LA 4PDDA 5LTCA 3QMFA 1FPKA 4O8MA 2ZZWA 1NV6A 3BIHA 3W9WA 2Q74A 4N6KA 1NV1A 4GWYA 1FPIA 5EQ8A 4HXVA 2PFZA 1BK4A 2P3VA 4PAIA 1FBFA 1FJ9A 1FBCA 3A29A 5F24A 5EQ7A 1IMFA 3KBZA 4FBPA 2P3NA 5J16A 4NF0A 4NN3A 1FJ6A 4N8YA 1IMCA 3LUZA 2BJIA 1NUXA 4N6DA 2WYPA 3CHGA 2V4CA 4N4UA 4X8RA 2WX9A 4MJOA 4GBWA 3SZPA 1XI6A 1NUWA 4OVSA 1NV0A 1LEVA 4HE0A 4PF8A 2V3QA 4DI4B 2OX3A 4NAPA 1NUZA 4N91A 2GQ1A 1FPFA 4HE2A 4PBHA 2Y5KA 1NV4A 5LDZA 2MKZA 2XXKA 3IFAA 4OVTA 1G0HA 4F1UA 2VPOA 4PETA 3T1BA 5ET5A 1FTAA 3ISPA 2DE3A 5J1DA 4I3EA 4NG7A 4MX6A 3D1RA 5IZ1A 1IMDA 1FBGA 2CZIA 4QXDA 3NOHA 3EKIA 4DI3D 2ZZVA 5T3JA 5JK4A 1K9YA 4P1EA 1EYIA 3BIGA 4GWXA 4F1VA 3B8BA 4MNIA 1KA0A 5I5PA 4NGUA 1IMBA 4X04A 4PF6A 3KC1A 2WBDA 2QFLA 2QVUA 4N15A 2DDKA 2QPQA 4F18A 4X9TA 3KC0A 3T0JA 4OVPA 4GBVA 1FPGA 1KZ8A 3E79A 5IZ3B 2R8TA 4LN5A 1EYJA 4PC9A 4JVIA 2WYKA 2FVZA 4YICA 5IZ3A 4PAFA 1LBXA 2VPNA 4M1VA 1AWBA 1CNQA 2HZKA 1RDXA 4HCWA 2ZZXA 3FXBA 4OA4A 2QVVA 1YYZA 2KQZA 2OWZA 5IGAA 1FPLA 4O7MA 4QBAA 1K9ZA 1DCUA 1LBYA 4NHBA 4O94A 1IMEA 1EYKA 4MNPA 4MMPA 2VT5A 4AS5A 4P9KA 5I7IA 1YXIA 1NV5A 4P3LA 4AS4A 1NV2A 1QGXA 2CZKA 4MHFA 2KR0A 2XWKA 4GWUA 5CM6A 5EQAA 5I3SA 1DBZA 1FBDA 3MSTA 2FBPA 3IFCA 4KXPA 4PCDA 2DVZA 3RYDA 1KA1A 4PGPA 4GWSA 5EYHA 5IM2A 4UABA 2XWOA 4YZZA 2FHYA 3RPLB 1LBVA 4O7IA 4JVDA 1FBHA 3RPLA 3U65A 2Q8MA 1D9QA 4P1LA 2DE4A 3B50A 4H46A 4XF5A 1NV3A 4G61A 4HCYA 1LBWA 4PE3A 4P47A 4MEVA 2CEXA 2HHMA 1FPDA 1FPEA 4PGNA 5FBPA 2PFYA 5ESYA 3PTYA 2Y5LA 4N17A 1G0IA 4HE1A 4JVCA 2B4LA 1YZ0A 1FPJA 3HFUA 5EYGA 2PCRA 5ET8A 4PTKA 2F5XA 1FPBA 5IZZA 2HXRA 4N8GA 4NQ8A 2Q9TA 2DE2A 2WEFA 2XA5A 2FIEA 1RDYA 4GWZA 4OANA 4GX3A 1INPA 4H45A 2B4MA 3GYYA 4PDHA 4OVRA 2FIXA 4OVQA 3E78A 5DW8A 1NUYA 1NV7A 2JJKA 2WBBA 3MYUA 2XWIA 4PFRA 1IMAA 4XFEA 4PBQA 1VDWA 2F3BA 4IR8A 3ROJA 1Q9DA 4MNCA 1FBPA 2CEYA 4PFIA 4MAGA 4PAKA 4P8BA 4I3YA 5EQ9A 1DK4A 4NX1A 4F19A 4GX6A 1LBZA 1FSAA 1FBEA 2QVRA 4PFBA 2HPGA 4XEQA 4I40A 4GWWA 3FBPA 1NI9A 1RDZA 5ET7A 5ET6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ET8 A;  4PTK A;  4AS5 A;  1FPB A;  1G0H A;  4N81 A;  4GX4 A;  1SPI A;  1JP4 A;  1YXI A;  2F3D A;  1NV5 A;  2CZH A;  5ET5 A;  3LV0 A;  1FTA A;  4AS4 A;  1FRP A;  1NV2 A;  1QGX A;  2CZK A;  5A5L A;  4I3E A;  3D1R A;  2WEF A;  4GWU A;  3QMF A;  1FPK A;  2FIE A;  5IZ1 A;  1IMD A;  5EQA A;  1FBG A;  1NV6 A;  2CZI A;  5I3S A;  1DBZ A;  4QXD A;  3BIH A;  1RDY A;  4GWZ A;  1FBD A;  5T3J A;  2Q74 A;  2FBP A;  3IFC A;  1NV1 A;  4KXP A;  1K9Y A;  4GX3 A;  1INP A;  1EYI A;  3BIG A;  4GWY A;  1FPI A;  4GWX A;  5EQ8 A;  4HXV A;  3B8B A;  1BK4 A;  4H45 A;  2P3V A;  1KA0 A;  1FBF A;  3RYD A;  1FJ9 A;  1FBC A;  3A29 A;  1KA1 A;  2FIX A;  1IMB A;  5F24 A;  4GWS A;  5EQ7 A;  1IMF A;  3KC1 A;  3KBZ A;  5EYH A;  2WBD A;  2QFL A;  1NUY A;  2QVU A;  4FBP A;  5DW8 A;  2P3N A;  5J16 A;  2FHY A;  3RPL B;  1NV7 A;  2DDK A;  1FJ6 A;  1LBV A;  2JJK A;  2WBB A;  1IMC A;  3LUZ A;  2BJI A;  3KC0 A;  4O7I A;  3T0J A;  1IMA A;  1NUX A;  4GBV A;  1FPG A;  1KZ8 A;  1FBH A;  5IZ3 B;  2R8T A;  1VDW A;  3RPL A;  2F3B A;  1EYJ A;  2Q8M A;  1D9Q A;  4IR8 A;  3ROJ A;  1Q9D A;  2FVZ A;  4MJO A;  5IZ3 A;  4GBW A;  1FBP A;  4H46 A;  1NV3 A;  4G61 A;  1LBW A;  1LBX A;  1XI6 A;  1NUW A;  4I3Y A;  1AWB A;  5EQ9 A;  1CNQ A;  2HHM A;  1NV0 A;  1RDX A;  1LEV A;  1FPD A;  1FPE A;  4HE0 A;  5FBP A;  1DK4 A;  2OX3 A;  5ESY A;  2Y5L A;  1NUZ A;  2QVV A;  4GX6 A;  1LBZ A;  1G0I A;  1YYZ A;  1FSA A;  2OWZ A;  4HE1 A;  2GQ1 A;  1FPF A;  1FPL A;  4HE2 A;  2Y5K A;  1FBE A;  2QVR A;  1K9Z A;  1DCU A;  1FPJ A;  1LBY A;  1NV4 A;  1YZ0 A;  4GWW A;  4I40 A;  5EYG A;  1IME A;  3FBP A;  5LDZ A;  1EYK A;  3IFA A;  1NI9 A;  2PCR A;  1RDZ A;  5ET7 A;  2VT5 A;  5ET6 A; 
#chains in the Genus database with same CATH topology
 3LUY A;  3W9V A;  4POW A;  3H4Z A;  1SPI A;  3A3C A;  2XWV A;  1FQF A;  2Q89 A;  3FD3 A;  3MPK A;  1FRP A;  4EF1 A;  4QSD A;  2XX8 A;  5H8N B;  5A5L A;  1B4H A;  4EXK A;  4I62 A;  5LTC A;  4NE4 A;  3QMF A;  1HSJ A;  3IOW A;  1A40 A;  3W9W A;  2ZXT A;  4FIM A;  2Q74 A;  3KOS A;  3IX1 A;  2XX9 A;  1JW1 A;  4YAH X;  3OMB A;  5AA4 B;  1FBF A;  4IO6 A;  5I2K B;  1H43 A;  1FTK A;  1IMF A;  3KBZ A;  2P3N A;  3HV1 A;  2B3F A;  3OOA A;  4OEU A;  3T22 A;  4KYS A;  2XD3 A;  2BJI A;  3Q27 A;  1NUX A;  2WYP A;  3CHG A;  3HPI A;  2V4C A;  3KEI A;  1OMP A;  2OBG A;  1IUD A;  1QUI A;  4GBW A;  3G3J A;  4R73 A;  2NXO A;  3EHU A;  3MW0 A;  1II5 A;  1UQW A;  3F11 A;  3CFL A;  1POT A;  4NAP A;  4N6P A;  1M5C A;  3LBS A;  1NUZ A;  4LON B;  4N91 A;  1DTZ A;  3THI A;  2GQ1 A;  4HE2 A;  1M5E A;  2LAO A;  1NNF A;  4PP0 A;  3FGS A;  3JYR A;  3S4U A;  2XXI A;  5LDZ A;  1MRP A;  1PDA A;  2ONK E;  3PPR A;  3IFA A;  2RIN A;  4OVT A;  1TXF A;  1B3E A;  1QUL A;  1OQG A;  5ET5 A;  1O7T A;  3TDJ A;  3RT6 B;  3MBP A;  2VD2 A;  5J1D A;  3GBA A;  4O3B A;  4R74 A;  4O3A A;  4FED A;  2R9J A;  3LSF B;  1LBC A;  3FXQ A;  4UA8 A;  2RCA A;  1Z7N E;  1IMD A;  1B51 A;  1MXU A;  3NOH A;  2XXP A;  1N84 A;  2DP8 A;  2ZZV A;  3UP9 A;  2ZYO A;  3IOU A;  1K9Y A;  2V25 A;  3BIG A;  4ELQ A;  4GWX A;  3DLN A;  4F1V A;  5JEI A;  2CMO A;  2ANJ A;  5I5P A;  4U4S A;  1UTH A;  4PF6 A;  1B0L A;  3MZB A;  2Z23 A;  2QFL A;  1F9B A;  3PPO A;  3SET A;  4F29 A;  3OEN A;  1FCK A;  1IXH A;  3T0J A;  1MQJ A;  4OVP A;  1FPG A;  4N13 A;  5TPA A;  1IEJ A;  2I48 A;  5KZT A;  3S9M C;  4PC9 A;  3H06 B;  1HSE A;  3VLW A;  2FVZ A;  3TQW A;  4PAF A;  5DVJ A;  1AWB A;  1CNQ A;  3K6V A;  2IA4 A;  3TFL A;  2HQ0 A;  2ZZX A;  2I0C A;  4H1X A;  4OA4 A;  2XXR A;  1Y1Z A;  3L6G A;  4F1Y A;  1LFG A;  1DMB A;  3CG1 A;  4QBA A;  3HN0 A;  4LZ5 A;  1LBY A;  1B7Z A;  2A5S A;  3VLU A;  5FHN A;  3SEX A;  3U93 A;  3EHS A;  3HST A;  3K4U A;  4MMP A;  4AS5 A;  5I7I A;  1AL3 A;  1TFD A;  3C36 A;  5BWJ A;  1NV5 A;  4P3L A;  4GWO A;  4AS4 A;  3O97 A;  2CZK A;  1JEV A;  4MHF A;  2KR0 A;  2F6P A;  1GV8 A;  5I56 A;  4TOZ A;  1M5F A;  3PMX A;  2REG A;  1LFI A;  2GH9 A;  2ZNS A;  5ITO A;  5I2N B;  3MST A;  3Q25 A;  1HSL A;  3E3K A;  4PCD A;  4LQ2 A;  4I1D A;  4FEB A;  2VHA A;  3MZ9 A;  2DVZ A;  2XXH A;  1KA1 A;  4PGP A;  5I58 B;  5JTY A;  4EDP A;  3MC2 A;  4JVD A;  4R6K A;  1VFD A;  4QFL A;  4KQP A;  5FTH A;  3TKD A;  2YLN A;  1B5H A;  3V83 A;  2DE4 A;  3B50 A;  3TTM A;  1LBB A;  4H46 A;  3K1P A;  5M2V A;  1AMF A;  1FPE A;  5FBP A;  3SEW A;  1UIU A;  3OO8 A;  2Y5L A;  1JW5 A;  2XXT A;  3MP8 A;  2FYI A;  4N17 A;  2I3W A;  3IOT A;  4DE8 A;  3DP4 A;  5CMM A;  5EYG A;  2X26 A;  4NF5 A;  2X7Q A;  2PCR A;  4OFO A;  1P1N A;  4X1B A;  2NOO A;  3T9X B;  5CBR A;  1D3K A;  2VP1 A;  4NWD A;  1T0K A;  3CIJ A;  4AB6 A;  2VGQ A;  3FZV A;  1RKM A;  5I59 B;  4HW8 A;  4XKQ A;  3FXR A;  5ICQ A;  4ZEI A;  2DE2 A;  3QUJ A;  2WEF A;  4G68 B;  4POX A;  3MVW A;  2O6A A;  3K00 A;  2ONS A;  5F7V A;  4F2Q A;  4EQ7 A;  1Y3N A;  4R75 A;  4GWZ A;  3T93 B;  1MM6 A;  1TWY A;  3UA8 A;  4FEC A;  3QXM A;  4KYD A;  1Y4C A;  2DXY A;  1P1U A;  2B4M A;  1B1H A;  3M3F A;  1B2H A;  3FJG A;  4C1T A;  1GVC A;  2ZYM A;  4ELO A;  2PX1 A;  1B6H A;  2AIX A;  3A09 A;  3B7D A;  1ZTY A;  2O68 A;  2F7A A;  4FAT A;  3KZG A;  2QS4 A;  2I49 A;  1Q9D A;  4YB7 A;  2P0S A;  3U8Q A;  5DVF A;  1FBP A;  3HHG A;  2OLB A;  3KN8 A;  4PAK A;  4P8B A;  3FVO A;  2QMW A;  4RK2 A;  1SW5 A;  3B6Q A;  3SEY A;  5ICT A;  1VFE A;  4OMB A;  3I5O A;  3N26 A;  5DEX A;  4G8M A;  1LBZ A;  1MXX A;  1BP5 A;  2XXW A;  3O2A A;  4JBZ A;  4JB7 A;  1FBE A;  5ISU A;  4PFB A;  4PFU A;  3FBP A;  1H45 A;  1NI9 A;  3Q29 A;  4G8H A;  5ET7 A;  2NWJ A;  5L9M A;  4N81 A;  3CRB A;  1JP4 A;  3KGC A;  3RQT A;  4LP2 B;  2XXX A;  4BLA A;  2VOZ A;  1BKA A;  3LV0 A;  1WVJ A;  4G2Z A;  3CFX A;  3TOD A;  1I6B A;  4PDD A;  4ELP A;  4GXA A;  3FJM A;  3MAM A;  1FPK A;  5H8N A;  5HBC A;  3CSB A;  3B6T A;  1R6Z A;  1NV1 A;  3K1M A;  3FVG A;  1IXG A;  1FPI A;  4LA9 A;  3SES A;  2G29 A;  2H98 A;  1BK4 A;  2H4I A;  4NF4 B;  1US4 A;  2THI A;  4PAI A;  3OXN A;  1FJ9 A;  1FBC A;  3A29 A;  3CVG A;  4H6D A;  4Q8R A;  5AA4 A;  1P1O A;  4NF0 A;  4LAT A;  5I2K A;  4YKP A;  1SDX A;  4ZEB A;  4N8Y A;  1Y4T A;  5EYF A;  1P1Q A;  2O84 X;  1FTL A;  4X8R A;  2WX9 A;  1M5B A;  4MJO A;  2AL4 A;  3RUM A;  5H8H B;  3TTK A;  5I84 A;  3BFT A;  1FQA A;  1XI6 A;  4L17 A;  3CFZ A;  1NKX A;  4OTE A;  2Q2A A;  1LEV A;  1I6A A;  2V3Q A;  4OQO A;  2D5W A;  1MH4 A;  3BBR A;  4IY6 A;  4RY1 A;  2QRY A;  2RC8 A;  4E0X A;  2Q88 A;  4GLI A;  5TP9 B;  2F6G A;  1MQD A;  2Z22 A;  2DWA A;  3CR9 A;  5CMC A;  2UVG A;  4F1U A;  1SW1 A;  2DSF A;  2PBW A;  1Y20 A;  3ISP A;  1B5J A;  1UTB B;  1PC3 A;  2DE3 A;  4QF9 A;  4NED A;  1NMU A;  2OJT A;  3OSQ A;  4NF8 B;  4NG7 A;  3D1R A;  4R6H A;  3OEL A;  2IEE A;  3HHF A;  4QXD A;  2F78 A;  4PE5 B;  5T3J A;  3TQL A;  3MP6 A;  2O69 A;  1EYI A;  1FQD A;  4NF6 A;  4PFT A;  4U23 A;  2ZNU A;  3B8B A;  3SER A;  1KA0 A;  2RCB A;  2V84 A;  4AQ4 A;  4XTC Q;  3W15 C;  4DXU A;  2A5T B;  3IR1 A;  5KDT B;  1B32 A;  3RLF E;  3PD9 A;  2F7C A;  1CB6 A;  2WBD A;  1ZBM A;  4X9T A;  1FQC A;  2UVH A;  5IZ3 B;  2KLF A;  1NNT A;  3C35 A;  3EHT A;  4JVI A;  4IY5 A;  2WYK A;  4X48 A;  3USD A;  2GHA A;  3G3I A;  4OFL A;  3LSW A;  1FTO A;  4M1V A;  3FUZ A;  5AA2 B;  4IO7 A;  3MWB A;  4H5F A;  3K1N A;  1YYZ A;  2KQZ A;  1YAE A;  4BDR A;  2FA7 A;  2PVU A;  4H5G A;  4MLV A;  4O94 A;  4RXL A;  4MNP A;  2RC7 A;  3K02 A;  3SEU A;  1SQY A;  1YXI A;  1MY0 A;  3GXA A;  3TPA A;  3FIR A;  4H65 A;  1O64 A;  3O66 A;  1QUJ A;  1QKB A;  2XWK A;  4ZED A;  4GWU A;  2G93 A;  5EQA A;  5I3S A;  3R7X A;  3MJN A;  5TU0 A;  2RKM A;  2QMX A;  5K2X A;  1FBD A;  3O6I A;  4WKM A;  4GIZ A;  3IFC A;  2D3I A;  3C33 A;  3DEL B;  3VV5 A;  5I2N A;  3C34 A;  3FV2 A;  3QAX A;  3TCF A;  1B46 A;  3QSL A;  2M8C A;  5CMK A;  4DIG A;  2FHY A;  4ESX A;  3RPL B;  5DYH A;  3EN3 A;  4LZ7 A;  3KBR A;  5I58 A;  3P7I A;  3MVZ A;  4XXU A;  3ZKK A;  3FAS A;  1B0H A;  4P1L A;  3ZSF A;  3MUQ A;  2O1L A;  4G61 A;  3BKI B;  4HCY A;  4MBP A;  3TTR A;  3LC8 A;  4Q30 B;  4P47 A;  1A55 A;  1ANF A;  4JDF A;  2HHM A;  1ATG A;  1S9T A;  1FPD A;  1MS7 A;  3G3H A;  5L9O A;  2PMS A;  5ESY A;  1MQH A;  1TFA A;  4R2F A;  4KFQ A;  3JV9 A;  4AB5 A;  4P0I A;  3UK4 A;  2B4L A;  1OVB A;  3R6U A;  5L8D A;  1GR2 A;  3CG3 A;  4GL8 A;  1FPJ A;  3HFU A;  4BDL A;  2ABH A;  3MP1 A;  3T66 A;  2V93 A;  2OWT A;  2DOJ A;  3R26 A;  4PFY A;  1JNF A;  5B7D A;  5FHM A;  2HXR A;  1USY E;  4N8G A;  1Y9U A;  5A5X B;  4F2O A;  3EQ1 A;  4KPT A;  4NQ8 A;  2O7I A;  1B5I A;  1D9V A;  2B3B A;  4IO5 A;  4KYE A;  1QKA A;  4YKJ A;  3RNN A;  1EU8 A;  1OIB A;  1RDY A;  4G68 A;  1NH8 A;  4GX3 A;  3OSR A;  4K3F A;  4DCY A;  4E0W A;  2Q8J A;  3DP8 A;  2OWS A;  3TTL A;  5KCJ B;  2AYS A;  2REJ A;  5DT6 A;  1N7X A;  2I0B A;  4QSE A;  5DW8 A;  3H6W A;  1MM7 A;  3KSX A;  4OYV A;  3MYU A;  4BDQ A;  2XWI A;  1Y3P A;  1MXV A;  2Z8D A;  3CI8 A;  2ONR A;  1VDW A;  3K6X A;  4FJP A;  3T9V A;  1ZIU A;  4IR8 A;  3ROJ A;  4MNC A;  3VDF A;  2GHB A;  4EUO A;  4MAG A;  4F31 B;  2I4B A;  2DVC A;  4ZEF A;  1FTJ A;  2NVU B;  4ZE8 A;  1GGG A;  3MVY A;  2QVR A;  1MXW A;  2ZNT A;  1FQE A;  1KWH A;  4F3G A;  3PD8 A;  2P1S A;  1RDZ A;  2F7B A;  4YKK A;  2F3D A;  3OO7 A;  2CZH A;  4P56 A;  4C1U A;  4DDD A;  4MIJ A;  2DQV A;  1D4N A;  2O51 A;  1MPC A;  3IB0 A;  5IKB A;  4EQB A;  3U1O A;  2ZZW A;  1IQ7 A;  1NV6 A;  2NUV A;  4N6K A;  3VVF A;  1A54 A;  4GWY A;  2XXU A;  5EQ8 A;  3IK6 B;  2PFZ A;  3DP6 A;  5HM4 B;  4GFR A;  3U72 A;  1B1X A;  3ONM A;  3K0V A;  4G8N A;  1YTV A;  3FXU A;  5EQ7 A;  4NF4 A;  4FBP A;  4NN3 A;  5J16 A;  3PMV A;  3PU5 A;  1FJ6 A;  1IMC A;  3LUZ A;  4N6D A;  1URG A;  2ALU A;  3VLV A;  1IXI A;  1RYO A;  4N4U A;  4THI A;  3E13 X;  4GVO A;  1Q35 A;  3H3G A;  4GRK A;  5ELV A;  4UAC A;  1LCF A;  1MQG A;  3SZP A;  4F3B A;  1NUW A;  1SYH A;  3ECR A;  4OVS A;  1NV0 A;  4DI4 B;  2OX3 A;  5H8H A;  3C31 A;  1RYX A;  4YMA A;  2Y7W A;  4KCD A;  1PB7 A;  3TEL A;  4I9D A;  1FPF A;  4R72 A;  3LR1 A;  2Y5K A;  5H8F B;  3QIM A;  2Y7R A;  4FAJ A;  3VVD A;  3N6T A;  2DXR A;  2MKZ A;  3T9U A;  4IO3 A;  4ZE9 A;  1G0H A;  3IAZ A;  5IAI A;  2Z8F A;  2VPO A;  5TP9 A;  3GBB A;  3T1B A;  2ESN A;  1FTA A;  1LCT A;  1YPN A;  3TAJ A;  5H8Q B;  4I3E A;  2XX7 A;  1SVX B;  3H6V A;  1VSO A;  1UTB A;  3UGW A;  4ISU A;  2H25 A;  1URS A;  3IJX B;  1FBG A;  2CZI A;  4KI0 E;  4DI3 D;  3UOR A;  4NF8 A;  1Y3Q A;  3EPE A;  5JK4 A;  2CZL A;  2Y7K A;  3OO6 A;  3L6H A;  3U94 A;  1SD3 A;  4MNI A;  5FTI A;  3ZKL A;  3IOR A;  1OLC A;  2HCA A;  4M4G A;  2AL5 A;  4Q0C A;  2XXV A;  4RJZ A;  1IMB A;  3QUF A;  1FQB A;  4QHQ A;  4N15 A;  2ZMB A;  1JQF A;  2V3T A;  2DDK A;  2A5T A;  3BFU A;  5KDT A;  2QPQ A;  5DTB A;  5AA3 A;  5AE4 A;  1KZ8 A;  1SI1 A;  1UIV A;  2R8T A;  2Y7I A;  1EYJ A;  3KJT A;  1JEU A;  1VR5 A;  4YIC A;  5IZ3 A;  2VD3 A;  2DYX A;  3VVE A;  1B05 A;  1R9L A;  2PT1 A;  1LBX A;  2VPN A;  5I57 B;  3O6H A;  4ZDM A;  2F97 A;  1RDX A;  4EQ9 A;  4GD5 A;  3FXB A;  3IO4 A;  2QVV A;  2F8D A;  3RN8 A;  2OWZ A;  5IGA A;  5AA2 A;  3N94 A;  1FPL A;  4O7M A;  4OHN A;  1SW2 A;  1OVT A;  1K9Z A;  4NHB A;  1PB8 A;  3G7W A;  4JWX A;  1IME A;  2Z8E A;  3PMW A;  2I6E A;  4G68 C;  4GL0 A;  4QFK A;  3VXC A;  4ELR A;  1EYK A;  4OWD A;  4U1Z A;  1B4Z A;  2VT5 A;  4P9K A;  4PQJ A;  3PV0 E;  5AA2 D;  2F35 A;  3E4R A;  3O29 A;  4LVQ A;  1SBP A;  2DWI A;  3K2D A;  1FW0 A;  1QGX A;  1XC1 A;  2RF1 A;  2B65 A;  2Y84 A;  5DVI A;  4XKP A;  1BLF A;  3GLB A;  3C32 A;  3GZG A;  3HO7 A;  3KN7 A;  4LQ5 A;  4IO2 A;  5CM6 A;  1DBZ A;  4R6Y A;  3PPQ A;  1EZP A;  2FBP A;  4OVJ A;  4KXP A;  3WAF A;  1QW0 A;  3HCQ A;  4U2R A;  1N3X A;  4KR5 A;  4R2B A;  2UYE A;  4PFW A;  4RYA A;  2HAU A;  3ODB A;  3RYD A;  3M8U A;  1JW4 A;  4GWS A;  3PGF A;  5EYH A;  5IM2 A;  4UAB A;  1XVX A;  3H6U A;  3FJ7 A;  1LBV A;  1MY4 A;  2XD2 A;  4XKN A;  1FBH A;  1N3W A;  3H03 A;  2O7U A;  1IXC A;  3RPL A;  2Q8M A;  4ZZE A;  1ZKB A;  1JET A;  4NTL A;  3QYT A;  1AH5 A;  1NFT A;  1DSN A;  1NV3 A;  1ZJL A;  4DCX A;  4MEV A;  3PPP A;  3M3K A;  1AIV A;  3PTY A;  1G0I A;  4YU0 A;  2HXW A;  4IO4 A;  4JVC A;  4IB2 A;  1N04 A;  3PUW E;  1YZ0 A;  1LB9 A;  5AA1 A;  1MXZ A;  3FVN A;  3G3G A;  4MH5 A;  1SYI A;  2UVI A;  4F3S A;  4PTK A;  3V5A A;  2I3V A;  3KN3 A;  1EH3 A;  4F3P A;  3K6U A;  3IJO B;  5FHO A;  3IB1 A;  4ESW A;  2QJE A;  1SW4 A;  1BIY A;  1MY3 A;  2XA5 A;  5A5X A;  4ECF A;  2OZZ A;  1B7H A;  4OAN A;  3UN6 A;  1LGB C;  3IB2 A;  4PDH A;  1IIW A;  4YKI A;  3S9L C;  3AXF A;  4OVQ A;  3E78 A;  4ZEK A;  4TLL B;  5KCJ A;  1VE4 A;  1XS5 A;  4LZ8 A;  1NV7 A;  4WEP A;  2JJK A;  2WBB A;  3KSJ A;  1PBP A;  1BTJ A;  3OEK A;  4XKR A;  2F3B A;  1NNK A;  5BUU A;  2CEY A;  4KD5 A;  2OCU A;  4RK9 A;  4I3Y A;  5EQ9 A;  4JSO A;  1DK4 A;  1US5 A;  4NX1 A;  4F19 A;  3SDF A;  3ZS6 A;  4GX6 A;  3O28 A;  3RT8 A;  2H99 A;  2E0S A;  4Q5T A;  1QVS A;  1R1N A;  4DLD A;  4IGR A;  5CC2 A;  4OFJ A;  2R6G E;  4NF6 B;  1MH3 A;  1A7L A;  3TEP A;  2HZL A;  2L5V A;  1P99 A;  4RPN A;  4GX4 A;  3SEV A;  4MCO A;  2GFE A;  1S50 A;  4O3C A;  4Z7E A;  3LSX A;  1B9J A;  4HTG A;  4R9G A;  3RY3 A;  2R71 A;  1ZLQ A;  4MFI A;  1MG1 A;  4YB5 A;  1LST A;  4O8M A;  3TZA A;  3I3V A;  4OEN A;  3E9X A;  4R9F A;  3OEM A;  3PUY E;  3BIH A;  1ELJ A;  2ZYK A;  3G3F A;  4IGT A;  1JVX A;  1H44 A;  4U21 A;  4HXV A;  4OET A;  2P3V A;  1YCJ A;  1MDQ A;  3O9P A;  1POY 1;  1A8F A;  3VFJ A;  2F36 A;  1LAF E;  5I59 A;  5F24 A;  2H5Y A;  3CSG A;  5L9S A;  4U1O A;  4H8I A;  1EZO A;  4F39 A;  5ITP A;  3ILU B;  3RPW A;  1AOV A;  3UIF A;  3OO9 A;  1MY1 A;  5HPQ A;  3OD7 A;  4WED A;  1PBQ A;  3H6T A;  4JWO A;  1N76 A;  4EXL A;  4MF3 A;  4F22 A;  1XT8 A;  1I69 A;  5B70 A;  3IL1 B;  4HE0 A;  4PF8 A;  1B40 A;  3S2V A;  1P1W A;  4WXJ A;  4PBH A;  2QS2 A;  1A99 A;  3U92 A;  4GOT A;  1NV4 A;  3MVX A;  2XXK A;  5H8F A;  4RA1 A;  1QUK A;  4KCC A;  1N7W A;  2E1S A;  5CRY A;  1MY2 A;  4FOR A;  1DTG A;  5EHS A;  4PET A;  2H9B A;  4H67 A;  2F34 A;  3IOV A;  4QFO A;  1QJM A;  2FNC A;  1L5T A;  3PUZ E;  1LFH A;  4H8J A;  4OES A;  1J1N A;  4EF2 A;  2I4C A;  4MX6 A;  4TQU Q;  3IO6 A;  3K6W A;  5IZ1 A;  5H8Q A;  1S7Y A;  3EKI A;  3MPL A;  5CMB A;  5H8S A;  3Q28 A;  3H7M A;  3TTN A;  4P1E A;  2WKY A;  2YJP A;  1UTH B;  4ZZA A;  3D4G A;  4I8C A;  1M5D A;  4N07 A;  2X7P A;  3D4C A;  2UXA A;  1B3G A;  4Z0I A;  5EHM A;  2HEU A;  1D9Y A;  4QSC A;  4NGU A;  4X04 A;  5TPA B;  4QFP A;  3KC1 A;  1MPD A;  2OPE A;  2QVU A;  3T9H B;  2GRV A;  2HAV A;  3Q26 A;  4F18 A;  3KG2 A;  4ONY A;  4G77 A;  3KC0 A;  3DM0 A;  4U4X A;  4GBV A;  3TUS A;  2W7Y A;  1H3D A;  3E79 A;  4RNS A;  4BDM A;  4LN5 A;  4KHZ E;  3T96 B;  1Z7M E;  4NWC A;  1B52 A;  4ZEC A;  4U22 A;  4P11 A;  4JSD A;  2O1M A;  4JWY A;  2DWH A;  5LOM A;  4G4P A;  2D21 A;  3JZJ A;  2HZK A;  4RPO A;  4HCW A;  3S9E A;  4HS7 A;  4C0R A;  5I57 A;  2I58 A;  2XHD A;  1LAX A;  3TCH A;  3B6W A;  1DCU A;  1XVY A;  1CE2 A;  2YPN A;  2XXY A;  3RTF B;  1TT1 A;  3KFM A;  3PPN A;  3VE1 B;  3KJ7 A;  4OXV A;  4LUB A;  2HFB A;  5I56 B;  4GQO A;  1NV2 A;  3K01 A;  1ZMG A;  5CI5 A;  4P0G A;  1URD A;  3C9H A;  3MQ9 A;  1PB9 A;  1B58 A;  1B7U A;  4JXI A;  2BJJ X;  3WAE A;  2QS3 A;  1XHY A;  5JTY B;  4H0W A;  3V89 B;  1A8E A;  3SKP A;  2XWO A;  4YZZ A;  1NL5 A;  2XXQ A;  4ZS9 A;  4XIG Q;  4O7I A;  4NMY A;  2P2A A;  3TCG A;  1JVY A;  1USY H;  3U65 A;  1D9Q A;  1EZ9 A;  1B3H A;  2QSX A;  4XF5 A;  1DPP A;  1I6Q A;  5CBS A;  1LBW A;  1MXY A;  4OER A;  4PE3 A;  2PYY A;  1PEB A;  2CEX A;  4OEV A;  2ZYN A;  3KOT A;  4PGN A;  2PFY A;  4NF5 B;  1MDP 1;  4OZ9 A;  4HE1 A;  1LLS A;  2QL3 A;  3RGY A;  4BDN A;  4DXB A;  4DZ1 A;  3N6U A;  1LB8 A;  3G3K A;  4GF8 A;  2OPD A;  5ET8 A;  2F5X A;  1FPB A;  1OLA A;  5IZZ A;  3TYH A;  3N5L A;  1IIT A;  3I6V A;  3QK6 A;  1Q1K A;  1LAG E;  2Q9T A;  3A3U A;  2FIE A;  4QFN A;  4BDO A;  4TLM B;  4DXC A;  4GXS B;  1INP A;  3V8X B;  1H76 A;  4H45 A;  4YMB A;  2QS1 A;  2Q2C A;  3GYY A;  1MQI A;  1NNP A;  3RTW B;  2PT2 A;  4YB6 A;  3FV1 A;  4OVR A;  2FIX A;  1N0T A;  2V3U A;  2Y7P A;  3O6G A;  1NUY A;  3EF7 A;  4MLQ A;  4PFR A;  1IMA A;  1DOT A;  4XFE A;  4FE8 A;  4PBQ A;  3PUV E;  1Y1M A;  1WDN A;  3VXB A;  3S9N C;  3TMG A;  1R9Q A;  3MZ1 A;  4PFI A;  5DEX B;  1IZ1 A;  5K2Y A;  1O63 A;  2DS9 A;  1B3L A;  1DPE A;  3PUX E;  1GTK A;  1FTM A;  3C4M A;  3LSL A;  3M3L A;  3FAT A;  1FSA A;  1MPB A;  1OQH A;  4X1D A;  1SI0 A;  1NH7 A;  2HPG A;  4XEQ A;  1WOD A;  4QRZ A;  4I40 A;  4GWW A;  4ND9 A;  2DWJ A;  2UYF A;  2OK2 A;  2UVJ A;  3ILT B;  3FVK A;  1XOC A;  1B3F A;  1ZU0 A;  1LAH E;  5F1Q A;  5ET6 A;  2RC9 A; 
#chains in the Genus database with same CATH homology
 2HZL A;  3W9V A;  2L5V A;  4N81 A;  4GX4 A;  1SPI A;  4MCO A;  1JP4 A;  2F3D A;  2XWV A;  2CZH A;  3LV0 A;  4P56 A;  1FRP A;  4MIJ A;  5A5L A;  4PDD A;  5LTC A;  3QMF A;  1FPK A;  4O8M A;  2ZZW A;  1NV6 A;  3BIH A;  3W9W A;  2Q74 A;  4N6K A;  1NV1 A;  4GWY A;  1FPI A;  5EQ8 A;  4HXV A;  2PFZ A;  1BK4 A;  2P3V A;  4PAI A;  1FBF A;  1FJ9 A;  1FBC A;  3A29 A;  5F24 A;  5EQ7 A;  1IMF A;  3KBZ A;  4FBP A;  2P3N A;  5J16 A;  4NF0 A;  4NN3 A;  1FJ6 A;  4N8Y A;  1IMC A;  3LUZ A;  2BJI A;  1NUX A;  4N6D A;  2WYP A;  3CHG A;  2V4C A;  4N4U A;  4X8R A;  2WX9 A;  4MJO A;  4GBW A;  3SZP A;  1XI6 A;  1NUW A;  4OVS A;  1NV0 A;  1LEV A;  4HE0 A;  4PF8 A;  2V3Q A;  4DI4 B;  2OX3 A;  4NAP A;  1NUZ A;  4N91 A;  2GQ1 A;  1FPF A;  4HE2 A;  4PBH A;  2Y5K A;  1NV4 A;  5LDZ A;  2MKZ A;  2XXK A;  3IFA A;  4OVT A;  1G0H A;  4F1U A;  2VPO A;  4PET A;  3T1B A;  5ET5 A;  1FTA A;  3ISP A;  2DE3 A;  5J1D A;  4I3E A;  4NG7 A;  4MX6 A;  3D1R A;  5IZ1 A;  1IMD A;  1FBG A;  2CZI A;  4QXD A;  3NOH A;  3EKI A;  4DI3 D;  2ZZV A;  5T3J A;  5JK4 A;  1K9Y A;  4P1E A;  1EYI A;  3BIG A;  4GWX A;  4F1V A;  3B8B A;  4MNI A;  1KA0 A;  5I5P A;  4NGU A;  1IMB A;  4X04 A;  4PF6 A;  3KC1 A;  2WBD A;  2QFL A;  2QVU A;  4N15 A;  2DDK A;  2QPQ A;  4F18 A;  4X9T A;  3KC0 A;  3T0J A;  4OVP A;  4GBV A;  1FPG A;  1KZ8 A;  3E79 A;  5IZ3 B;  2R8T A;  4LN5 A;  1EYJ A;  4PC9 A;  4JVI A;  2WYK A;  2FVZ A;  4YIC A;  5IZ3 A;  4PAF A;  1LBX A;  2VPN A;  4M1V A;  1AWB A;  1CNQ A;  2HZK A;  1RDX A;  4HCW A;  2ZZX A;  3FXB A;  4OA4 A;  2QVV A;  1YYZ A;  2KQZ A;  2OWZ A;  5IGA A;  1FPL A;  4O7M A;  4QBA A;  1K9Z A;  1DCU A;  1LBY A;  4NHB A;  4O94 A;  1IME A;  1EYK A;  4MNP A;  4MMP A;  2VT5 A;  4AS5 A;  4P9K A;  5I7I A;  1YXI A;  1NV5 A;  4P3L A;  4AS4 A;  1NV2 A;  1QGX A;  2CZK A;  4MHF A;  2KR0 A;  2XWK A;  4GWU A;  5CM6 A;  5EQA A;  5I3S A;  1DBZ A;  1FBD A;  3MST A;  2FBP A;  3IFC A;  4KXP A;  4PCD A;  2DVZ A;  3RYD A;  1KA1 A;  4PGP A;  4GWS A;  5EYH A;  5IM2 A;  4UAB A;  2XWO A;  4YZZ A;  2FHY A;  3RPL B;  1LBV A;  4O7I A;  4JVD A;  1FBH A;  3RPL A;  3U65 A;  2Q8M A;  1D9Q A;  4P1L A;  2DE4 A;  3B50 A;  4H46 A;  4XF5 A;  1NV3 A;  4G61 A;  4HCY A;  1LBW A;  4PE3 A;  4P47 A;  4MEV A;  2CEX A;  2HHM A;  1FPD A;  1FPE A;  4PGN A;  5FBP A;  2PFY A;  5ESY A;  3PTY A;  2Y5L A;  4N17 A;  1G0I A;  4HE1 A;  4JVC A;  2B4L A;  1YZ0 A;  1FPJ A;  3HFU A;  5EYG A;  2PCR A;  5ET8 A;  4PTK A;  2F5X A;  1FPB A;  5IZZ A;  2HXR A;  4N8G A;  4NQ8 A;  2Q9T A;  2DE2 A;  2WEF A;  2XA5 A;  2FIE A;  1RDY A;  4GWZ A;  4OAN A;  4GX3 A;  1INP A;  4H45 A;  2B4M A;  3GYY A;  4PDH A;  4OVR A;  2FIX A;  4OVQ A;  3E78 A;  5DW8 A;  1NUY A;  1NV7 A;  2JJK A;  2WBB A;  3MYU A;  2XWI A;  4PFR A;  1IMA A;  4XFE A;  4PBQ A;  1VDW A;  2F3B A;  4IR8 A;  3ROJ A;  1Q9D A;  4MNC A;  1FBP A;  2CEY A;  4PFI A;  4MAG A;  4PAK A;  4P8B A;  4I3Y A;  5EQ9 A;  1DK4 A;  4NX1 A;  4F19 A;  4GX6 A;  1LBZ A;  1FSA A;  1FBE A;  2QVR A;  4PFB A;  2HPG A;  4XEQ A;  4I40 A;  4GWW A;  3FBP A;  1NI9 A;  1RDZ A;  5ET7 A;  5ET6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...