5IZ1A

Physcomitrella patens fbpase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
337
structure length
321
Chain Sequence
ITTFTTWLLKQEQAGVIDGELTIVLSSISLACKQIASLVQRAGISNLTGEDQKKLDVISNEVFSSCLRSSGRTGIIASEEEDTPVAVEESYSGNYIVVFDPLDGSSNIDAAVSTGSIFGIYKPNEECLTIDEVAQNCVVNVCQPGSNLLSAGYCMYSSSVILVLSVGHGVYGFTLDPLYGEFVLSHEEIKIPKSGKIYSFNEGNYALWDDKLKKYVDSLKDPGPSGKPYSARYIGSLVGDFHRTMLYGGIYGYPRDSKSKNGKLRLLYECAPMSYLAEQAGGKGSDGHQRILDIQPEQVHQRVPLYVGSTEEVEKLEKFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chloroplast FBPase and SBPase are thioredoxin-linked enzymes with similar architecture but different evolutionary histories.
pubmed doi rcsb
source organism Physcomitrella patens subsp. patens
molecule tags Hydrolase
molecule keywords fructose-1,6-bisphosphatase
total genus 89
structure length 321
sequence length 337
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5iz1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5iz1A02
2FIEA 1FTAA 1VDWA 1XI6A 4KXPA 5IZ3A 1AWBA 1FBCA 1KZ8A 2OX3A 2R8TA 4AS5A 1FPGA 1RDZA 4I40A 4N81A 1BK4A 5EQ7A 3RPLB 2BJIA 1FPEA 1K9ZA 4I3YA 1NUZA 2FBPA 3RPLA 5FBPA 1FJ9A 3LV0A 4HE2A 1FPDA 4PTKA 1LBYA 4GWWA 5IZ3B 4H46A 1FPFA 1JP4A 2FIXA 1NI9A 4GWSA 4GX3A 5ET7A 4GWXA 3BIGA 4I3EA 1DK4A 1RDXA 3ROJA 1FBFA 5EYGA 1NUXA 1DBZA 1EYJA 2CZHA 1NV7A 5ET6A 1IMEA 1LBZA 1KA0A 2F3BA 3RYDA 1SPIA 5EQ9A 3QMFA 2Y5LA 3LUZA 1LBWA 4GWUA 3KBZA 4IR8A 1K9YA 1YXIA 2F3DA 4G61A 2QVRA 1YZ0A 1FSAA 1EYKA 5T3JA 5F24A 1Q9DA 1FBHA 1LBVA 4GBWA 1NV0A 1NV2A 1FPKA 5DW8A 3FBPA 4GWZA 4H45A 2WEFA 2VT5A 5ET8A 4GBVA 5A5LA 3IFCA 2WBBA 1NV6A 1FBGA 1FBDA 1FPIA 2QVUA 4FBPA 1DCUA 1CNQA 5LDZA 3A29A 1FPLA 1IMFA 1LBXA 3KC1A 1NUYA 1NV3A 5EQ8A 4HXVA 2Q74A 3B8BA 4GX4A 5ESYA 2P3VA 1EYIA 3KC0A 1G0HA 1IMCA 2FVZA 2P3NA 2Q8MA 3T0JA 1RDYA 2HHMA 4HE1A 2GQ1A 1NUWA 4QXDA 2FHYA 1IMDA 1NV4A 5IZ1A 5EYHA 1FJ6A 5J16A 2WBDA 2QVVA 2QFLA 1YYZA 1KA1A 2PCRA 1FBEA 4HE0A 2DDKA 1IMBA 4GWYA 5I3SA 3BIHA 1NV1A 4MJOA 1G0IA 1D9QA 4GX6A 3IFAA 1FBPA 2CZIA 3D1RA 1INPA 1QGXA 1LEVA 5EQAA 1NV5A 2Y5KA 1FPBA 2CZKA 2JJKA 1FRPA 4AS4A 5ET5A 2OWZA 4O7IA 1FPJA 1IMAA
chains in the Genus database with same CATH superfamily
3PPNA 2OPEA 4BDMA 2UVHA 3TQWA 4X9TA 5B7DA 4MAGA 2BJIA 3O66A 2Q9TA 3CFLA 3TFLA 3UIFA 5FBPA 1IZ1A 3BFTA 5I2KB 3RNNA 4HE2A 4KYEA 5HBCA 2Z23A 4BDQA 1P99A 3FJMA 2B4MA 1R9QA 2F35A 2XXVA 3UK4A 4QFKA 3M3FA 2PBWA 3TODA 2AYSA 4IR8A 2F3DA 1XVYA 1FSAA 3IOVA 4F31B 1UTBA 2O1LA 1MQDA 3IB1A 4YAHX 2X26A 4GQOA 3IOWA 4N6DA 1FPLA 3PUZE 4ONYA 3KSJA 1MS7A 3A09A 2P3VA 3SEUA 1H76A 2IA4A 5H8QB 4LZ5A 3USDA 2Q8MA 3HO7A 2GQ1A 4WXJA 2XXWA 3S9MC 4UACA 4NTLA 3K6VA 3C33A 4OESA 3ISPA 3HSTA 4OFOA 3U93A 3CG3A 5AE4A 1B1XA 4ECFA 3GXAA 2DYXA 3BFUA 3UORA 1FTAA 4RK2A 4HW8A 4LN5A 1AWBA 2OBGA 1BK4A 5EQ7A 1OLAA 4N07A 3PD8A 2WKYA 3MVZA 4OVPA 4U2RA 4G8NA 4RXLA 3U94A 4RY1A 5A5XB 4NG7A 4GWSA 2XWKA 2THIA 2ZYOA 5ELVA 2IEEA 3O9PA 4G8HA 4EUOA 5JK4A 2V84A 4LVQA 1ANFA 4H5GA 5CMKA 3PTYA 3R7XA 5AA2A 2F7BA 1JW1A 4ELOA 4F1VA 3TEPA 3S2VA 1ELJA 3U8QA 1BLFA 3CG1A 1NV2A 1FPKA 5DW8A 3V83A 2VD2A 2WYPA 2WEFA 1QUKA 5A5LA 4OFLA 2XX7A 1MM6A 4Q30B 1SQYA 4OVTA 2MKZA 4PETA 3ZKKA 4GRKA 2F78A 2V3TA 4GX4A 3O6GA 4FAJA 2VHAA 2AL5A 1M5EA 2QVVA 2O51A 4C1TA 2Q89A 2HZKA 3N6TA 2O69A 4MMPA 4N91A 4K3FA 3SESA 4BDOA 3PGFA 2CEYA 1B46A 2OJTA 2I0CA 4GIZA 3IK6B 4NF8B 3OOAA 3R26A 1IMAA 2Z8DA 1BIYA 1I6BA 3CFZA 5TPAB 4ZEFA 2R8TA 1FQCA 1FQDA 3MBPA 5I2KA 4O94A 1OQHA 2UVGA 4DDDA 4OYVA 4YMAA 1NUZA 3O28A 3RLFE 2E0SA 1SW5A 3VLWA 1HSJA 1AL3A 3DELB 5J1DA 1POY1 4U21A 5AA2D 2H9BA 2DVCA 2ZYNA 2VP1A 4P1EA 2ZNUA 1FBFA 3IB0A 1NUXA 3CI8A 1B0HA 2QSXA 4MX6A 3B7DA 3MZ9A 1AH5A 1SYIA 5EHMA 1IITA 3LSWA 2X7QA 4PCDA 5M2VA 2AIXA 3CHGA 4EF1A 1B6HA 4XIGQ 4IY6A 2CEXA 1J1NA 3PMXA 1B9JA 3CRBA 3O29A 4JB7A 1NV6A 3VDFA 1FPIA 2NXOA 4ZZAA 4L17A 4GFRA 3KC1A 4TQUQ 1NUYA 2QS1A 3KEIA 3UN6A 5DT6A 4FATA 2DWIA 3B6WA 1SW1A 3OO7A 4GL8A 1G0HA 1LFGA 2XXUA 2PVUA 3SETA 3FXRA 5J16A 3IORA 3C36A 3FD3A 4F19A 4RNSA 3MSTA 5EHSA 3PPRA 4RJZA 4QBAA 4U22A 3T93B 5TP9B 1WODA 2DE4A 3H06B 4GX6A 1URDA 5I57A 3TCHA 2VOZA 2JJKA 1FRPA 4LQ2A 4F2OA 2XXIA 1FPGA 1MXUA 4LONB 2PT2A 2QMXA 3B50A 4X1DA 5EYFA 4ELQA 1MPBA 4ELPA 1LAHE 2V3UA 4DXUA 3LV0A 4PGNA 5TU0A 2O84X 4DZ1A 3KBRA 2F97A 1FTJA 2P0SA 4ND9A 1FPFA 1B32A 5I56B 3H7MA 4I3EA 4M1VA 3K0VA 3UA8A 1LBCA 4FE8A 3L6GA 4JSDA 3S4UA 5IZZA 1JW4A 3K02A 4N8YA 4NQ8A 2XXPA 2NOOA 1A54A 5DEXB 2R6GE 3N26A 3FBPA 2F6GA 3LSFB 2VT5A 2RC8A 3W15C 4OA4A 3IJOB 4PBQA 1USYE 3F11A 3GZGA 3E78A 2PX1A 4DXBA 4MLQA 1R6ZA 1Y1MA 4OEVA 2HAVA 1KWHA 1JVXA 2OWTA 2P3NA 3T0JA 4P1LA 5AA4A 4EDPA 4MEVA 1SD3A 2XXXA 1B7HA 1MDP1 5JTYB 1B4ZA 4KPTA 4Q5TA 4P0IA 1VE4A 4YKPA 5FHMA 3Q29A 4MJOA 3TCFA 4PE3A 1GGGA 5CC2A 3S9EA 5DVIA 3C9HA 3EN3A 4O7IA 1VDWA 3EQ1A 4NAPA 1JNFA 4YB6A 3K2DA 5FTHA 3FV1A 1S7YA 4IO3A 3V8XB 4N6KA 1XVXA 3RGYA 1LLSA 4NF8A 1TWYA 1RKMA 3TKDA 3OO6A 3QXMA 3IO6A 1N84A 2O1MA 1O7TA 2PT1A 1B5IA 1NI9A 4GX3A 2QPQA 3MC2A 3FUZA 5KCJA 1RDXA 3EKIA 3HHFA 1I69A 4XKRA 4ZEDA 1PDAA 4OEUA 4XKQA 3RYDA 3VFJA 4H0WA 1YXIA 1P1UA 2UVJA 1MH4A 1P1QA 4MH5A 1TT1A 3M3LA 3KN8A 1ZLQA 1LCFA 4GWZA 2VD3A 1S50A 4X04A 2XX9A 2RCBA 4F3SA 2RC7A 1LFHA 4GWOA 4YZZA 1FBGA 2Y7IA 4OXVA 1FTMA 4ZE8A 1Q1KA 3VXCA 4R6KA 4N15A 1SI1A 5IKBA 3SEYA 2M8CA 1JEUA 4IGTA 3IR1A 1B2HA 2R9JA 3ILTB 3D4CA 1MQIA 3V89B 2ZYMA 2CZLA 4PAKA 3Q26A 3ZS6A 3GLBA 1LSTA 2OZZA 3OSRA 1NMUA 4P3LA 3N5LA 4KXPA 1KZ8A 4OZ9A 1N3XA 3IL1B 4Q0CA 3VVDA 4R9FA 2HQ0A 1IIWA 3QYTA 1NNPA 3K6WA 4PGPA 4QSDA 5H8NA 4P8BA 1Y4CA 1B05A 1EU8A 1N3WA 2XWVA 3FXUA 5H8FB 2P2AA 3SEVA 5EQ9A 5ICQA 5HM4B 1LBWA 2V93A 2ONRA 3VLVA 1N7XA 4DXCA 1M5BA 5IAIA 2HXRA 1OQGA 3PUXE 3OELA 4O7MA 3RQTA 1LAFE 2XA5A 4YMBA 3VVFA 3A29A 4XFEA 1IMFA 1UIUA 3QK6A 1I6AA 3LUYA 2Y7RA 2OCUA 1USYH 1QJMA 4P9KA 1B51A 2OLBA 3DP4A 3PUVE 3E4RA 3WAFA 3T1BA 2F7CA 4ZECA 1MY3A 2A5TA 3T9HB 5I59B 2I0BA 4AB5A 5KDTA 5I3SA 5I58B 1NV1A 4I8CA 2DWAA 5CI5A 4FECA 4IY5A 1IXCA 1B1HA 5K2YA 1II5A 4AS4A 5CRYA 2OWZA 4BLAA 4P47A 1QUJA 5ITPA 2XX8A 4QRZA 5H8FA 5BWJA 4AB6A 4ESWA 2H5YA 2H99A 1MXXA 2AL4A 4JDFA 2A5SA 3PUYE 1JETA 4PTKA 1LBYA 1H3DA 3N94A 5IZ3B 3KG2A 4Z7EA 2FYIA 3QUJA 4MF3A 1PBPA 1LAGE 4IO6A 3G3GA 3EHUA 4OENA 2NVUB 4QSEA 3TZAA 1FCKA 3TMGA 4PFBA 2B4LA 2DS9A 1K9YA 2GHAA 2UYFA 1NFTA 3T9UA 2QVRA 1OVBA 4LUBA 4QFOA 1VFDA 3MAMA 2REGA 2WX9A 3G7WA 1Y1ZA 3CSGA 2GHBA 4PF8A 4JWXA 2O6AA 1ZIUA 1A40A 4NF5B 3TTRA 4OVRA 4EF2A 1DCUA 1HSEA 3JV9A 2Z8EA 1NV3A 5EQ8A 4KQPA 2DWJA 3CFXA 3HPIA 4H65A 3EF7A 2ONSA 4NEDA 3L6HA 3U65A 4PFYA 4ZDMA 2KQZA 1N76A 4G8MA 1Y3PA 3ODBA 3OMBA 1B5HA 3UGWA 4U4XA 4EXLA 3T66A 5TP9A 2GH9A 4IO7A 2Q8JA 2ZNTA 4H67A 4AS5A 1XC1A 4I40A 2CMOA 4U4SA 4N4UA 4NHBA 5I5PA 3C4MA 2DXYA 1ZU0A 1Y3NA 1SI0A 1B40A 2I58A 4GL0A 4GWXA 4OQOA 4HCWA 4R2FA 5I59A 2QJEA 3KZGA 3IJXB 1SYHA 4GXSB 1MXWA 4FEDA 1A99A 4G2ZA 3QIMA 4G61A 4ZEBA 4OVSA 1LBVA 4NF6B 4KHZE 3H6UA 4R2BA 3T9VA 4PC9A 1EZ9A 3LSXA 4H5FA 5IM2A 1B5JA 2YLNA 1GVCA 2DOJA 3D4GA 3MPLA 1R1NA 4F1YA 4YKKA 4F3GA 3C32A 2DXRA 2FVZA 5H8QA 3HV1A 1WVJA 4POXA 4ZEKA 2QFLA 1F9BA 2X7PA 4ESXA 1TFDA 5TPAA 4YKIA 3FATA 3ECRA 1IMBA 4THIA 1Z7ME 4Z0IA 2HFBA 1MH3A 2XXHA 1G0IA 4PAIA 1MPDA 1MXYA 4R6YA 2CZKA 3JYRA 5DEXA 2G29A 2FIEA 2XWOA 1MQHA 3E13X 1N04A 3OO9A 3RY3A 1ATGA 1LCTA 5CMMA 1Z7NE 5B70A 2ANJA 4GLIA 1UQWA 1JP4A 4JWYA 4POWA 1IEJA 4NF0A 3LC8A 1DPPA 2O68A 2UVIA 3MUQA 4ZEIA 2F5XA 1CB6A 4JVIA 4F39A 3QMFA 2XD3A 4GWUA 1DOTA 3T9XB 3ZSFA 4DI4B 1YZ0A 4UA8A 1EYKA 1D9YA 1FQFA 3H4ZA 2DVZA 4JVDA 1GR2A 2V3QA 3IFCA 1JW5A 1O63A 4H8JA 4N13A 4OMBA 2QVUA 1MG1A 4IO5A 1A8FA 2KR0A 2E1SA 4NF5A 4KCCA 1ZJLA 2ZNSA 3GBBA 3FV2A 3K4UA 4WEDA 4BDRA 2PFZA 3K00A 3TTLA 4MNPA 4U1OA 2GFEA 2QS4A 5HPQA 1IXGA 2KLFA 1FBEA 4KFQA 1FTOA 4OVJA 4PFIA 2I6EA 4F18A 2VGQA 2NUVA 3TELA 3IFAA 4NWCA 1SW4A 1NL5A 4G68A 1B0LA 4OVQA 5I7IA 1D4NA 3R6UA 1R9LA 5DVJA 2QRYA 5KZTA 2OX3A 1LAXA 2DE3A 1YTVA 1MRPA 2OPDA 1FPEA 3LSLA 4YB7A 4O8MA 3OEMA 1Y3QA 3RPLA 1PB7A 3Q28A 1D9VA 3TAJA 2RF1A 1MXVA 4I62A 3QAXA 2Q2AA 3PUWE 4NN3A 5CBSA 4XTCQ 3RT8A 1MPCA 4IO2A 5DTBA 2D21A 3MQ9A 5DVFA 5EYGA 4XKPA 1KA0A 4DE8A 1MQJA 1NNTA 5I2NB 3PV0E 3OENA 4F3PA 3RN8A 1NV0A 2F6PA 2Y84A 3DP6A 1IQ7A 4EQBA 4GBVA 4MFIA 4FBPA 4DLDA 2HCAA 1TFAA 1DPEA 4F3BA 2FNCA 1LB9A 1XOCA 4GF8A 1S9TA 3PPPA 4PF6A 1IMDA 1B3EA 5L9MA 3BKIB 1QUIA 4H6DA 1O64A 5L9SA 3FIRA 4HE0A 1PC3A 3BBRA 1FQEA 2QS3A 4LZ8A 1LFIA 3KSXA 3AXFA 3WAEA 1QKAA 1A7LA 3A3CA 1QGXA 2Y5KA 1EH3A 2P1SA 4O3BA 4RPNA 3RTFB 1B4HA 3LBSA 3ILUB 1BTJA 2Y7PA 3EPEA 2LAOA 4PP0A 2F8DA 4WEPA 2O7IA 2PMSA 3OXNA 2F36A 3VXBA 5L9OA 1FPDA 2ABHA 3EHTA 1B7ZA 3GBAA 4YB5A 4H46A 2FIXA 4X8RA 2V25A 2B3FA 1P1WA 4N8GA 1EYJA 4I1DA 1MY0A 1SPIA 5LOMA 2FA7A 3E9XA 3HFUA 3THIA 3IO4A 4OANA 4QFLA 3KJTA 4TLLB 3KGCA 5LTCA 2ZXTA 4WKMA 3QSLA 3EHSA 2ALUA 3VVEA 3FVOA 3TQLA 2Q88A 1CNQA 3FXBA 3H3GA 1JQFA 3PD9A 1B3LA 1XT8A 4PFTA 1B7UA 3RUMA 4YU0A 4BDLA 4N6PA 2QMWA 3SDFA 4Q8RA 1VSOA 4QXDA 5IZ1A 5EYHA 1FJ6A 2HEUA 4QFNA 2WBDA 3O97A 3KFMA 4G77A 4GXAA 4PDDA 4JBZA 3UP9A 4KD5A 4FEBA 4P11A 4YICA 3D1RA 4MIJA 2B65A 4G68C 2XXRA 4LZ7A 5ET5A 4HS7A 1DTZA 1EZOA 2B3BA 3U1OA 2ZMBA 3TUSA 1VR5A 3G3FA 4KYSA 1K9ZA 4KR5A 3TTNA 2FBPA 5CBRA 3H6VA 3DLNA 1NH8A 1A55A 3C35A 4GWWA 4P56A 3OD7A 3BIGA 4U1ZA 3GYYA 3ROJA 3OO8A 1PBQA 1RYOA 2H98A 4C0RA 1H44A 1AMFA 2F3BA 2HAUA 1OVTA 3KJ7A 2PYYA 1PEBA 2XWIA 3Q25A 1ZBMA 4PBHA 4OFJA 2H4IA 5AA4B 3PMVA 2UXAA 3Q27A 4M4GA 5DYHA 4OTEA 2GRVA 5H8SA 2WBBA 4NF6A 3E79A 4QF9A 4U23A 3TYHA 2ZZVA 4JVCA 4RK9A 3SKPA 5A5XA 3SZPA 4HXVA 3O6IA 5H8HA 2DWHA 5AA2B 2XXQA 2FHYA 4O3CA 1TXFA 4RPOA 2VPOA 3CSBA 2PCRA 1URSA 3VV5A 1UIVA 3G3JA 3BIHA 1D9QA 3TPAA 3FJ7A 2VPNA 1AIVA 1INPA 3IB2A 1UTHB 1MY1A 3HHGA 3IOTA 1IXIA 1B3HA 4LP2B 1IUDA 5CMCA 5FHOA 4ELRA 1B3FA 2BJJX 2YJPA 1FBCA 2RC9A 3JZJA 1P1OA 1XHYA 1YAEA 4NX1A 4IB2A 1FJ9A 1M5FA 3HCQA 3S9NC 1YCJA 4LQ5A 4FORA 3ONMA 3I3VA 3MYUA 2HZLA 4MBPA 5ET7A 1MDQA 4RYAA 3U92A 3MPKA 1FQBA 1YPNA 2CZHA 3A3UA 1NV7A 1IMEA 2RCAA 4DIGA 3LUZA 1MQGA 4OERA 5T3JA 2XXKA 3PPQA 5F24A 4NGUA 1Q9DA 1FBHA 4I9DA 4GBWA 1EZPA 1UTHA 1OLCA 3MVXA 3NOHA 3H6TA 2DP8A 4XF5A 1B3GA 1ZKBA 3K01A 3M3KA 1T0KA 4OETA 4AQ4A 2ESNA 3B8BA 2I49A 3T96B 1FQAA 1M5CA 1POTA 5F7VA 3C34A 4O3AA 1IMCA 3KN3A 2I4BA 2G93A 4XEQA 2ZZWA 4R73A 3MP8A 5AA3A 3B6QA 1NNFA 3MWBA 2W7YA 1LB8A 2OWSA 4MNCA 2PFYA 4N17A 3E3KA 4QSCA 2CZIA 2XHDA 5BUUA 4NE4A 2F34A 4TLMB 2L5VA 1XI6A 2ZYKA 3SEXA 1A8EA 3O2AA 3FJGA 3MP6A 4N81A 1CE2A 3MVYA 4G68B 1QW0A 3LR1A 4F1UA 4BDNA 2UYEA 3B6TA 1N7WA 2DE2A 4TOZA 4JSOA 3K6UA 3N6UA 5FHNA 1VFEA 4NWDA 2F7AA 5KDTB 1QVSA 4ZS9A 1ZMGA 1NH7A 4H1XA 4HCYA 1DK4A 3T22A 5L8DA 1AOVA 1DBZA 3SEWA 4PAFA 4ZE9A 3M8UA 4F29A 3KBZA 4HTGA 2HPGA 4X48A 2Z8FA 4MNIA 4PFWA 3FGSA 2Q2CA 4GD5A 5ET8A 3MW0A 4R74A 1QULA 3HN0A 3TDJA 2ONKE 1H45A 5K2XA 3FXQA 3MZ1A 1JVYA 5ESYA 1Y20A 3KC0A 2QS2A 3FVGA 3IX1A 1BKAA 4ISUA 1DSNA 2RINA 1RDYA 1QKBA 1L5TA 3OSQA 1LGBC 4KI0E 3P7IA 3KOSA 4PFUA 4GVOA 2I48A 4R9GA 1KA1A 5F1QA 2DDKA 3U72A 4RA1A 2DQVA 4G4PA 2HXWA 1LEVA 4QHQA 5EQAA 1NV5A 1FPBA 3CVGA 3PPOA 4PE5B 3K1MA 2XXYA 4XKNA 1FPJA 2Y7KA 4OHNA 5FTIA 2A5TB 1FTLA 1RDZA 1B52A 4R6HA 3C31A 5I84A 3RT6B 2ZZXA 4JWOA 1SVXB 4UABA 1MM7A 4EQ9A 3H03A 4NF4B 4KCDA 3VE1B 3CIJA 4DCXA 5AA1A 4PQJA 1IXHA 3G3HA 1RYXA 4DCYA 3MP1A 4DI3D 2Y5LA 1N0TA 1D3KA 5JTYA 1URGA 4GOTA 4XXUA 4E0XA 4PDHA 3SERA 4MLVA 2I4CA 2OK2A 2R71A 3KOTA 4EXKA 4FIMA 1M5DA 3PMWA 1PB9A 2XXTA 2Y7WA 5I57B 4R72A 1FBDA 4YKJA 1BP5A 2NWJA 1Y4TA 3I6VA 4F22A 3TTKA 1LBXA 3K1PA 4E0WA 3MJNA 2Q74A 1B58A 3S9LC 4LATA 2D3IA 3H6WA 2REJA 1NUWA 1P1NA 2DSFA 2YPNA 4MHFA 4C1UA 4MCOA 1LBBA 1UTBB 3DP8A 4KYDA 1OIBA 5JEIA 3RTWB 3TCGA 5KCJB 1GV8A 1YYZA 3FVNA 5I2NA 1MXZA 3MZBA 4IO4A 1GTKA 1HSLA 4R75A 4GWYA 1FW0A 1WDNA 3W9WA 2RKMA 3OEKA 4NF4A 5ISUA 2WYKA 5I56A 4LA9A 3VLUA 4X1BA 5IZ3A 1H43A 1SW2A 2QL3A 2XD2A 4EQ7A 3RPLB 4I3YA 1OMPA 3G3KA 2I3WA 1I6QA 4FJPA 4OWDA 5CM6A 1FTKA 4H8IA 1NNKA 3QUFA 3IAZA 5ET6A 5I58A 5IGAA 1LBZA 3TTMA 3W9VA 2H25A 2V4CA 5ICTA 3DM0A 4F2QA 1XS5A 1Y9UA 3K6XA 4IGRA 3RPWA 3CR9A 3FASA 3V5AA 4H45A 3KN7A 3I5OA 3O6HA 2O7UA 1NKXA 3PU5A 1DMBA 2D5WA 1US4A 1DTGA 5LDZA 1US5A 4ZZEA 1PB8A 1MY2A 3MVWA 3IOUA 1EYIA 5CMBA 1MY4A 4NMYA 1JEVA 2HHMA 4HE1A 4QFPA 1NV4A 3FVKA 5H8HB 4JXIA 5ITOA 3G3IA 1Q35A 2I3VA 3FZVA 1SDXA 3ZKLA 4PFRA 4P0GA 1FBPA 1ZTYA 2Z22A 1SBPA 3K1NA 5H8NB
chains in the Genus database with same CATH topology
2FIEA 1FTAA 1VDWA 2L5VA 1XI6A 2XWOA 4NAPA 4OVQA 4P47A 5I7IA 4LN5A 4KXPA 5IZ3A 1AWBA 1FBCA 1KZ8A 2OX3A 2R8TA 2DE3A 4AS5A 4X9TA 1FPGA 1RDZA 4I40A 4O94A 4N81A 1BK4A 5EQ7A 4MAGA 3RPLB 2BJIA 3B50A 1FPEA 1K9ZA 2Q9TA 4I3YA 4N4UA 4F1UA 1NUZA 4NHBA 5I5PA 4N6KA 4O8MA 2FBPA 2ZZXA 4NX1A 4UABA 3RPLA 5FBPA 4OVPA 2DE2A 1FJ9A 3LV0A 4HE2A 5J1DA 4PGNA 1FPDA 4PTKA 4PGPA 1LBYA 4GWWA 4P56A 5IZ3B 4H46A 1FPFA 1JP4A 3MYUA 2FIXA 4NG7A 2HZLA 4NN3A 4X8RA 1NI9A 4GWSA 4GX3A 5ET7A 4GWXA 4P8BA 3BIGA 2QPQA 4I3EA 5CM6A 2XWKA 4HCWA 3GYYA 4NF0A 4P1EA 4HCYA 4M1VA 1DK4A 1RDXA 3ROJA 2B4MA 3EKIA 1FBFA 5EYGA 5JK4A 1NUXA 2XWVA 1DBZA 4MX6A 2F5XA 1EYJA 4N8GA 2CZHA 3PTYA 1NV7A 4JVIA 5ET6A 5IGAA 1IMEA 1LBZA 1KA0A 2F3BA 3RYDA 4PAFA 3W9VA 4DI3D 1SPIA 5EQ9A 4PCDA 2V4CA 3HFUA 3QMFA 2Y5LA 3LUZA 4PFBA 4F1VA 1LBWA 4GWUA 3KBZA 4IR8A 4OANA 2B4LA 2XWIA 1K9YA 1YXIA 3CHGA 5IZZA 2F3DA 4G61A 2HPGA 4DI4B 2QVRA 1YZ0A 1FSAA 4MNIA 4N8YA 4NQ8A 1EYKA 4PDHA 4PBHA 5T3JA 2XXKA 2WX9A 2CEXA 5F24A 4NGUA 1Q9DA 1FBHA 4OVSA 2HXRA 1LBVA 4GBWA 1NV0A 1NV2A 1FPKA 5DW8A 3FBPA 4PF8A 4GWZA 2DVZA 2WYPA 3NOHA 4H45A 2WEFA 2VT5A 4JVDA 5ET8A 4GBVA 4X04A 5A5LA 5LTCA 2V3QA 4XF5A 3IFCA 4OA4A 2WBBA 4PBQA 1NV6A 4PC9A 4YZZA 1FBGA 4O7MA 3E78A 1FBDA 1FPIA 3E79A 2QVUA 4OVRA 5IM2A 4FBPA 4OVTA 1DCUA 1CNQA 2KR0A 2XA5A 2MKZA 5LDZA 2ZZVA 3A29A 4JVCA 4N6DA 1FPLA 4PETA 4XFEA 3FXBA 1IMFA 1LBXA 3KC1A 1NUYA 1NV3A 4N15A 3SZPA 5EQ8A 4HXVA 2Q74A 3B8BA 4GX4A 5ESYA 2P3VA 1EYIA 3KC0A 4P9KA 1G0HA 1IMCA 2FVZA 2P3NA 2Q8MA 3T0JA 2PFZA 1RDYA 2HHMA 4P1LA 4HE1A 4PF6A 2GQ1A 1NUWA 4QXDA 4MNPA 2FHYA 4XEQA 3T1BA 1IMDA 1NV4A 5IZ1A 5EYHA 1FJ6A 4MHFA 5J16A 4MCOA 3U65A 2WBDA 2ZZWA 2QVVA 4MEVA 2QFLA 2HZKA 4F19A 3MSTA 2VPOA 4PDDA 1YYZA 1KA1A 2PCRA 4MMPA 1FBEA 4HE0A 2KQZA 4PAKA 4N91A 2DDKA 1IMBA 4PFIA 2CEYA 4MNCA 4GWYA 4QBAA 4F18A 2PFYA 4N17A 5I3SA 3ISPA 3BIHA 1NV1A 4MJOA 2DE4A 4PFRA 1G0IA 1D9QA 4GX6A 3IFAA 1FBPA 2CZIA 4PE3A 3W9WA 4PAIA 4YICA 2VPNA 3D1RA 4MIJA 1INPA 1QGXA 1LEVA 4P3LA 2WYKA 5EQAA 1NV5A 2Y5KA 1FPBA 2CZKA 2JJKA 1FRPA 4AS4A 5ET5A 2OWZA 4O7IA 1FPJA 1IMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIE A;  1FTA A;  1VDW A;  1XI6 A;  4KXP A;  5IZ3 A;  1AWB A;  1FBC A;  1KZ8 A;  2OX3 A;  2R8T A;  4AS5 A;  1FPG A;  1RDZ A;  4I40 A;  4N81 A;  1BK4 A;  5EQ7 A;  3RPL B;  2BJI A;  1FPE A;  1K9Z A;  4I3Y A;  1NUZ A;  2FBP A;  3RPL A;  5FBP A;  1FJ9 A;  3LV0 A;  4HE2 A;  1FPD A;  4PTK A;  1LBY A;  4GWW A;  5IZ3 B;  4H46 A;  1FPF A;  1JP4 A;  2FIX A;  1NI9 A;  4GWS A;  4GX3 A;  5ET7 A;  4GWX A;  3BIG A;  4I3E A;  1DK4 A;  1RDX A;  3ROJ A;  1FBF A;  5EYG A;  1NUX A;  1DBZ A;  1EYJ A;  2CZH A;  1NV7 A;  5ET6 A;  1IME A;  1LBZ A;  1KA0 A;  2F3B A;  3RYD A;  1SPI A;  5EQ9 A;  3QMF A;  2Y5L A;  3LUZ A;  1LBW A;  4GWU A;  3KBZ A;  4IR8 A;  1K9Y A;  1YXI A;  2F3D A;  4G61 A;  2QVR A;  1YZ0 A;  1FSA A;  1EYK A;  5T3J A;  5F24 A;  1Q9D A;  1FBH A;  1LBV A;  4GBW A;  1NV0 A;  1NV2 A;  1FPK A;  5DW8 A;  3FBP A;  4GWZ A;  4H45 A;  2WEF A;  2VT5 A;  5ET8 A;  4GBV A;  5A5L A;  3IFC A;  2WBB A;  1NV6 A;  1FBG A;  1FBD A;  1FPI A;  2QVU A;  4FBP A;  1DCU A;  1CNQ A;  5LDZ A;  3A29 A;  1FPL A;  1IMF A;  1LBX A;  3KC1 A;  1NUY A;  1NV3 A;  5EQ8 A;  4HXV A;  2Q74 A;  3B8B A;  4GX4 A;  5ESY A;  2P3V A;  1EYI A;  3KC0 A;  1G0H A;  1IMC A;  2FVZ A;  2P3N A;  2Q8M A;  3T0J A;  1RDY A;  2HHM A;  4HE1 A;  2GQ1 A;  1NUW A;  4QXD A;  2FHY A;  1IMD A;  1NV4 A;  5IZ1 A;  5EYH A;  1FJ6 A;  5J16 A;  2WBD A;  2QVV A;  2QFL A;  1YYZ A;  1KA1 A;  2PCR A;  1FBE A;  4HE0 A;  2DDK A;  1IMB A;  4GWY A;  5I3S A;  3BIH A;  1NV1 A;  4MJO A;  1G0I A;  1D9Q A;  4GX6 A;  3IFA A;  1FBP A;  2CZI A;  3D1R A;  1INP A;  1QGX A;  1LEV A;  5EQA A;  1NV5 A;  2Y5K A;  1FPB A;  2CZK A;  2JJK A;  1FRP A;  4AS4 A;  5ET5 A;  2OWZ A;  4O7I A;  1FPJ A;  1IMA A; 
#chains in the Genus database with same CATH topology
 3PPN A;  2OPE A;  4BDM A;  2UVH A;  3TQW A;  4X9T A;  5B7D A;  4MAG A;  2BJI A;  3O66 A;  2Q9T A;  3CFL A;  3TFL A;  3UIF A;  5FBP A;  1IZ1 A;  3BFT A;  5I2K B;  3RNN A;  4HE2 A;  4KYE A;  5HBC A;  2Z23 A;  4BDQ A;  1P99 A;  3FJM A;  2B4M A;  1R9Q A;  2F35 A;  2XXV A;  3UK4 A;  4QFK A;  3M3F A;  2PBW A;  3TOD A;  2AYS A;  4IR8 A;  2F3D A;  1XVY A;  1FSA A;  3IOV A;  4F31 B;  1UTB A;  2O1L A;  1MQD A;  3IB1 A;  4YAH X;  2X26 A;  4GQO A;  3IOW A;  4N6D A;  1FPL A;  3PUZ E;  4ONY A;  3KSJ A;  1MS7 A;  3A09 A;  2P3V A;  3SEU A;  1H76 A;  2IA4 A;  5H8Q B;  4LZ5 A;  3USD A;  2Q8M A;  3HO7 A;  2GQ1 A;  4WXJ A;  2XXW A;  3S9M C;  4UAC A;  4NTL A;  3K6V A;  3C33 A;  4OES A;  3ISP A;  3HST A;  4OFO A;  3U93 A;  3CG3 A;  5AE4 A;  1B1X A;  4ECF A;  3GXA A;  2DYX A;  3BFU A;  3UOR A;  1FTA A;  4RK2 A;  4HW8 A;  4LN5 A;  1AWB A;  2OBG A;  1BK4 A;  5EQ7 A;  1OLA A;  4N07 A;  3PD8 A;  2WKY A;  3MVZ A;  4OVP A;  4U2R A;  4G8N A;  4RXL A;  3U94 A;  4RY1 A;  5A5X B;  4NG7 A;  4GWS A;  2XWK A;  2THI A;  2ZYO A;  5ELV A;  2IEE A;  3O9P A;  4G8H A;  4EUO A;  5JK4 A;  2V84 A;  4LVQ A;  1ANF A;  4H5G A;  5CMK A;  3PTY A;  3R7X A;  5AA2 A;  2F7B A;  1JW1 A;  4ELO A;  4F1V A;  3TEP A;  3S2V A;  1ELJ A;  3U8Q A;  1BLF A;  3CG1 A;  1NV2 A;  1FPK A;  5DW8 A;  3V83 A;  2VD2 A;  2WYP A;  2WEF A;  1QUK A;  5A5L A;  4OFL A;  2XX7 A;  1MM6 A;  4Q30 B;  1SQY A;  4OVT A;  2MKZ A;  4PET A;  3ZKK A;  4GRK A;  2F78 A;  2V3T A;  4GX4 A;  3O6G A;  4FAJ A;  2VHA A;  2AL5 A;  1M5E A;  2QVV A;  2O51 A;  4C1T A;  2Q89 A;  2HZK A;  3N6T A;  2O69 A;  4MMP A;  4N91 A;  4K3F A;  3SES A;  4BDO A;  3PGF A;  2CEY A;  1B46 A;  2OJT A;  2I0C A;  4GIZ A;  3IK6 B;  4NF8 B;  3OOA A;  3R26 A;  1IMA A;  2Z8D A;  1BIY A;  1I6B A;  3CFZ A;  5TPA B;  4ZEF A;  2R8T A;  1FQC A;  1FQD A;  3MBP A;  5I2K A;  4O94 A;  1OQH A;  2UVG A;  4DDD A;  4OYV A;  4YMA A;  1NUZ A;  3O28 A;  3RLF E;  2E0S A;  1SW5 A;  3VLW A;  1HSJ A;  1AL3 A;  3DEL B;  5J1D A;  1POY 1;  4U21 A;  5AA2 D;  2H9B A;  2DVC A;  2ZYN A;  2VP1 A;  4P1E A;  2ZNU A;  1FBF A;  3IB0 A;  1NUX A;  3CI8 A;  1B0H A;  2QSX A;  4MX6 A;  3B7D A;  3MZ9 A;  1AH5 A;  1SYI A;  5EHM A;  1IIT A;  3LSW A;  2X7Q A;  4PCD A;  5M2V A;  2AIX A;  3CHG A;  4EF1 A;  1B6H A;  4XIG Q;  4IY6 A;  2CEX A;  1J1N A;  3PMX A;  1B9J A;  3CRB A;  3O29 A;  4JB7 A;  1NV6 A;  3VDF A;  1FPI A;  2NXO A;  4ZZA A;  4L17 A;  4GFR A;  3KC1 A;  4TQU Q;  1NUY A;  2QS1 A;  3KEI A;  3UN6 A;  5DT6 A;  4FAT A;  2DWI A;  3B6W A;  1SW1 A;  3OO7 A;  4GL8 A;  1G0H A;  1LFG A;  2XXU A;  2PVU A;  3SET A;  3FXR A;  5J16 A;  3IOR A;  3C36 A;  3FD3 A;  4F19 A;  4RNS A;  3MST A;  5EHS A;  3PPR A;  4RJZ A;  4QBA A;  4U22 A;  3T93 B;  5TP9 B;  1WOD A;  2DE4 A;  3H06 B;  4GX6 A;  1URD A;  5I57 A;  3TCH A;  2VOZ A;  2JJK A;  1FRP A;  4LQ2 A;  4F2O A;  2XXI A;  1FPG A;  1MXU A;  4LON B;  2PT2 A;  2QMX A;  3B50 A;  4X1D A;  5EYF A;  4ELQ A;  1MPB A;  4ELP A;  1LAH E;  2V3U A;  4DXU A;  3LV0 A;  4PGN A;  5TU0 A;  2O84 X;  4DZ1 A;  3KBR A;  2F97 A;  1FTJ A;  2P0S A;  4ND9 A;  1FPF A;  1B32 A;  5I56 B;  3H7M A;  4I3E A;  4M1V A;  3K0V A;  3UA8 A;  1LBC A;  4FE8 A;  3L6G A;  4JSD A;  3S4U A;  5IZZ A;  1JW4 A;  3K02 A;  4N8Y A;  4NQ8 A;  2XXP A;  2NOO A;  1A54 A;  5DEX B;  2R6G E;  3N26 A;  3FBP A;  2F6G A;  3LSF B;  2VT5 A;  2RC8 A;  3W15 C;  4OA4 A;  3IJO B;  4PBQ A;  1USY E;  3F11 A;  3GZG A;  3E78 A;  2PX1 A;  4DXB A;  4MLQ A;  1R6Z A;  1Y1M A;  4OEV A;  2HAV A;  1KWH A;  1JVX A;  2OWT A;  2P3N A;  3T0J A;  4P1L A;  5AA4 A;  4EDP A;  4MEV A;  1SD3 A;  2XXX A;  1B7H A;  1MDP 1;  5JTY B;  1B4Z A;  4KPT A;  4Q5T A;  4P0I A;  1VE4 A;  4YKP A;  5FHM A;  3Q29 A;  4MJO A;  3TCF A;  4PE3 A;  1GGG A;  5CC2 A;  3S9E A;  5DVI A;  3C9H A;  3EN3 A;  4O7I A;  1VDW A;  3EQ1 A;  4NAP A;  1JNF A;  4YB6 A;  3K2D A;  5FTH A;  3FV1 A;  1S7Y A;  4IO3 A;  3V8X B;  4N6K A;  1XVX A;  3RGY A;  1LLS A;  4NF8 A;  1TWY A;  1RKM A;  3TKD A;  3OO6 A;  3QXM A;  3IO6 A;  1N84 A;  2O1M A;  1O7T A;  2PT1 A;  1B5I A;  1NI9 A;  4GX3 A;  2QPQ A;  3MC2 A;  3FUZ A;  5KCJ A;  1RDX A;  3EKI A;  3HHF A;  1I69 A;  4XKR A;  4ZED A;  1PDA A;  4OEU A;  4XKQ A;  3RYD A;  3VFJ A;  4H0W A;  1YXI A;  1P1U A;  2UVJ A;  1MH4 A;  1P1Q A;  4MH5 A;  1TT1 A;  3M3L A;  3KN8 A;  1ZLQ A;  1LCF A;  4GWZ A;  2VD3 A;  1S50 A;  4X04 A;  2XX9 A;  2RCB A;  4F3S A;  2RC7 A;  1LFH A;  4GWO A;  4YZZ A;  1FBG A;  2Y7I A;  4OXV A;  1FTM A;  4ZE8 A;  1Q1K A;  3VXC A;  4R6K A;  4N15 A;  1SI1 A;  5IKB A;  3SEY A;  2M8C A;  1JEU A;  4IGT A;  3IR1 A;  1B2H A;  2R9J A;  3ILT B;  3D4C A;  1MQI A;  3V89 B;  2ZYM A;  2CZL A;  4PAK A;  3Q26 A;  3ZS6 A;  3GLB A;  1LST A;  2OZZ A;  3OSR A;  1NMU A;  4P3L A;  3N5L A;  4KXP A;  1KZ8 A;  4OZ9 A;  1N3X A;  3IL1 B;  4Q0C A;  3VVD A;  4R9F A;  2HQ0 A;  1IIW A;  3QYT A;  1NNP A;  3K6W A;  4PGP A;  4QSD A;  5H8N A;  4P8B A;  1Y4C A;  1B05 A;  1EU8 A;  1N3W A;  2XWV A;  3FXU A;  5H8F B;  2P2A A;  3SEV A;  5EQ9 A;  5ICQ A;  5HM4 B;  1LBW A;  2V93 A;  2ONR A;  3VLV A;  1N7X A;  4DXC A;  1M5B A;  5IAI A;  2HXR A;  1OQG A;  3PUX E;  3OEL A;  4O7M A;  3RQT A;  1LAF E;  2XA5 A;  4YMB A;  3VVF A;  3A29 A;  4XFE A;  1IMF A;  1UIU A;  3QK6 A;  1I6A A;  3LUY A;  2Y7R A;  2OCU A;  1USY H;  1QJM A;  4P9K A;  1B51 A;  2OLB A;  3DP4 A;  3PUV E;  3E4R A;  3WAF A;  3T1B A;  2F7C A;  4ZEC A;  1MY3 A;  2A5T A;  3T9H B;  5I59 B;  2I0B A;  4AB5 A;  5KDT A;  5I3S A;  5I58 B;  1NV1 A;  4I8C A;  2DWA A;  5CI5 A;  4FEC A;  4IY5 A;  1IXC A;  1B1H A;  5K2Y A;  1II5 A;  4AS4 A;  5CRY A;  2OWZ A;  4BLA A;  4P47 A;  1QUJ A;  5ITP A;  2XX8 A;  4QRZ A;  5H8F A;  5BWJ A;  4AB6 A;  4ESW A;  2H5Y A;  2H99 A;  1MXX A;  2AL4 A;  4JDF A;  2A5S A;  3PUY E;  1JET A;  4PTK A;  1LBY A;  1H3D A;  3N94 A;  5IZ3 B;  3KG2 A;  4Z7E A;  2FYI A;  3QUJ A;  4MF3 A;  1PBP A;  1LAG E;  4IO6 A;  3G3G A;  3EHU A;  4OEN A;  2NVU B;  4QSE A;  3TZA A;  1FCK A;  3TMG A;  4PFB A;  2B4L A;  2DS9 A;  1K9Y A;  2GHA A;  2UYF A;  1NFT A;  3T9U A;  2QVR A;  1OVB A;  4LUB A;  4QFO A;  1VFD A;  3MAM A;  2REG A;  2WX9 A;  3G7W A;  1Y1Z A;  3CSG A;  2GHB A;  4PF8 A;  4JWX A;  2O6A A;  1ZIU A;  1A40 A;  4NF5 B;  3TTR A;  4OVR A;  4EF2 A;  1DCU A;  1HSE A;  3JV9 A;  2Z8E A;  1NV3 A;  5EQ8 A;  4KQP A;  2DWJ A;  3CFX A;  3HPI A;  4H65 A;  3EF7 A;  2ONS A;  4NED A;  3L6H A;  3U65 A;  4PFY A;  4ZDM A;  2KQZ A;  1N76 A;  4G8M A;  1Y3P A;  3ODB A;  3OMB A;  1B5H A;  3UGW A;  4U4X A;  4EXL A;  3T66 A;  5TP9 A;  2GH9 A;  4IO7 A;  2Q8J A;  2ZNT A;  4H67 A;  4AS5 A;  1XC1 A;  4I40 A;  2CMO A;  4U4S A;  4N4U A;  4NHB A;  5I5P A;  3C4M A;  2DXY A;  1ZU0 A;  1Y3N A;  1SI0 A;  1B40 A;  2I58 A;  4GL0 A;  4GWX A;  4OQO A;  4HCW A;  4R2F A;  5I59 A;  2QJE A;  3KZG A;  3IJX B;  1SYH A;  4GXS B;  1MXW A;  4FED A;  1A99 A;  4G2Z A;  3QIM A;  4G61 A;  4ZEB A;  4OVS A;  1LBV A;  4NF6 B;  4KHZ E;  3H6U A;  4R2B A;  3T9V A;  4PC9 A;  1EZ9 A;  3LSX A;  4H5F A;  5IM2 A;  1B5J A;  2YLN A;  1GVC A;  2DOJ A;  3D4G A;  3MPL A;  1R1N A;  4F1Y A;  4YKK A;  4F3G A;  3C32 A;  2DXR A;  2FVZ A;  5H8Q A;  3HV1 A;  1WVJ A;  4POX A;  4ZEK A;  2QFL A;  1F9B A;  2X7P A;  4ESX A;  1TFD A;  5TPA A;  4YKI A;  3FAT A;  3ECR A;  1IMB A;  4THI A;  1Z7M E;  4Z0I A;  2HFB A;  1MH3 A;  2XXH A;  1G0I A;  4PAI A;  1MPD A;  1MXY A;  4R6Y A;  2CZK A;  3JYR A;  5DEX A;  2G29 A;  2FIE A;  2XWO A;  1MQH A;  3E13 X;  1N04 A;  3OO9 A;  3RY3 A;  1ATG A;  1LCT A;  5CMM A;  1Z7N E;  5B70 A;  2ANJ A;  4GLI A;  1UQW A;  1JP4 A;  4JWY A;  4POW A;  1IEJ A;  4NF0 A;  3LC8 A;  1DPP A;  2O68 A;  2UVI A;  3MUQ A;  4ZEI A;  2F5X A;  1CB6 A;  4JVI A;  4F39 A;  3QMF A;  2XD3 A;  4GWU A;  1DOT A;  3T9X B;  3ZSF A;  4DI4 B;  1YZ0 A;  4UA8 A;  1EYK A;  1D9Y A;  1FQF A;  3H4Z A;  2DVZ A;  4JVD A;  1GR2 A;  2V3Q A;  3IFC A;  1JW5 A;  1O63 A;  4H8J A;  4N13 A;  4OMB A;  2QVU A;  1MG1 A;  4IO5 A;  1A8F A;  2KR0 A;  2E1S A;  4NF5 A;  4KCC A;  1ZJL A;  2ZNS A;  3GBB A;  3FV2 A;  3K4U A;  4WED A;  4BDR A;  2PFZ A;  3K00 A;  3TTL A;  4MNP A;  4U1O A;  2GFE A;  2QS4 A;  5HPQ A;  1IXG A;  2KLF A;  1FBE A;  4KFQ A;  1FTO A;  4OVJ A;  4PFI A;  2I6E A;  4F18 A;  2VGQ A;  2NUV A;  3TEL A;  3IFA A;  4NWC A;  1SW4 A;  1NL5 A;  4G68 A;  1B0L A;  4OVQ A;  5I7I A;  1D4N A;  3R6U A;  1R9L A;  5DVJ A;  2QRY A;  5KZT A;  2OX3 A;  1LAX A;  2DE3 A;  1YTV A;  1MRP A;  2OPD A;  1FPE A;  3LSL A;  4YB7 A;  4O8M A;  3OEM A;  1Y3Q A;  3RPL A;  1PB7 A;  3Q28 A;  1D9V A;  3TAJ A;  2RF1 A;  1MXV A;  4I62 A;  3QAX A;  2Q2A A;  3PUW E;  4NN3 A;  5CBS A;  4XTC Q;  3RT8 A;  1MPC A;  4IO2 A;  5DTB A;  2D21 A;  3MQ9 A;  5DVF A;  5EYG A;  4XKP A;  1KA0 A;  4DE8 A;  1MQJ A;  1NNT A;  5I2N B;  3PV0 E;  3OEN A;  4F3P A;  3RN8 A;  1NV0 A;  2F6P A;  2Y84 A;  3DP6 A;  1IQ7 A;  4EQB A;  4GBV A;  4MFI A;  4FBP A;  4DLD A;  2HCA A;  1TFA A;  1DPE A;  4F3B A;  2FNC A;  1LB9 A;  1XOC A;  4GF8 A;  1S9T A;  3PPP A;  4PF6 A;  1IMD A;  1B3E A;  5L9M A;  3BKI B;  1QUI A;  4H6D A;  1O64 A;  5L9S A;  3FIR A;  4HE0 A;  1PC3 A;  3BBR A;  1FQE A;  2QS3 A;  4LZ8 A;  1LFI A;  3KSX A;  3AXF A;  3WAE A;  1QKA A;  1A7L A;  3A3C A;  1QGX A;  2Y5K A;  1EH3 A;  2P1S A;  4O3B A;  4RPN A;  3RTF B;  1B4H A;  3LBS A;  3ILU B;  1BTJ A;  2Y7P A;  3EPE A;  2LAO A;  4PP0 A;  2F8D A;  4WEP A;  2O7I A;  2PMS A;  3OXN A;  2F36 A;  3VXB A;  5L9O A;  1FPD A;  2ABH A;  3EHT A;  1B7Z A;  3GBA A;  4YB5 A;  4H46 A;  2FIX A;  4X8R A;  2V25 A;  2B3F A;  1P1W A;  4N8G A;  1EYJ A;  4I1D A;  1MY0 A;  1SPI A;  5LOM A;  2FA7 A;  3E9X A;  3HFU A;  3THI A;  3IO4 A;  4OAN A;  4QFL A;  3KJT A;  4TLL B;  3KGC A;  5LTC A;  2ZXT A;  4WKM A;  3QSL A;  3EHS A;  2ALU A;  3VVE A;  3FVO A;  3TQL A;  2Q88 A;  1CNQ A;  3FXB A;  3H3G A;  1JQF A;  3PD9 A;  1B3L A;  1XT8 A;  4PFT A;  1B7U A;  3RUM A;  4YU0 A;  4BDL A;  4N6P A;  2QMW A;  3SDF A;  4Q8R A;  1VSO A;  4QXD A;  5IZ1 A;  5EYH A;  1FJ6 A;  2HEU A;  4QFN A;  2WBD A;  3O97 A;  3KFM A;  4G77 A;  4GXA A;  4PDD A;  4JBZ A;  3UP9 A;  4KD5 A;  4FEB A;  4P11 A;  4YIC A;  3D1R A;  4MIJ A;  2B65 A;  4G68 C;  2XXR A;  4LZ7 A;  5ET5 A;  4HS7 A;  1DTZ A;  1EZO A;  2B3B A;  3U1O A;  2ZMB A;  3TUS A;  1VR5 A;  3G3F A;  4KYS A;  1K9Z A;  4KR5 A;  3TTN A;  2FBP A;  5CBR A;  3H6V A;  3DLN A;  1NH8 A;  1A55 A;  3C35 A;  4GWW A;  4P56 A;  3OD7 A;  3BIG A;  4U1Z A;  3GYY A;  3ROJ A;  3OO8 A;  1PBQ A;  1RYO A;  2H98 A;  4C0R A;  1H44 A;  1AMF A;  2F3B A;  2HAU A;  1OVT A;  3KJ7 A;  2PYY A;  1PEB A;  2XWI A;  3Q25 A;  1ZBM A;  4PBH A;  4OFJ A;  2H4I A;  5AA4 B;  3PMV A;  2UXA A;  3Q27 A;  4M4G A;  5DYH A;  4OTE A;  2GRV A;  5H8S A;  2WBB A;  4NF6 A;  3E79 A;  4QF9 A;  4U23 A;  3TYH A;  2ZZV A;  4JVC A;  4RK9 A;  3SKP A;  5A5X A;  3SZP A;  4HXV A;  3O6I A;  5H8H A;  2DWH A;  5AA2 B;  2XXQ A;  2FHY A;  4O3C A;  1TXF A;  4RPO A;  2VPO A;  3CSB A;  2PCR A;  1URS A;  3VV5 A;  1UIV A;  3G3J A;  3BIH A;  1D9Q A;  3TPA A;  3FJ7 A;  2VPN A;  1AIV A;  1INP A;  3IB2 A;  1UTH B;  1MY1 A;  3HHG A;  3IOT A;  1IXI A;  1B3H A;  4LP2 B;  1IUD A;  5CMC A;  5FHO A;  4ELR A;  1B3F A;  2BJJ X;  2YJP A;  1FBC A;  2RC9 A;  3JZJ A;  1P1O A;  1XHY A;  1YAE A;  4NX1 A;  4IB2 A;  1FJ9 A;  1M5F A;  3HCQ A;  3S9N C;  1YCJ A;  4LQ5 A;  4FOR A;  3ONM A;  3I3V A;  3MYU A;  2HZL A;  4MBP A;  5ET7 A;  1MDQ A;  4RYA A;  3U92 A;  3MPK A;  1FQB A;  1YPN A;  2CZH A;  3A3U A;  1NV7 A;  1IME A;  2RCA A;  4DIG A;  3LUZ A;  1MQG A;  4OER A;  5T3J A;  2XXK A;  3PPQ A;  5F24 A;  4NGU A;  1Q9D A;  1FBH A;  4I9D A;  4GBW A;  1EZP A;  1UTH A;  1OLC A;  3MVX A;  3NOH A;  3H6T A;  2DP8 A;  4XF5 A;  1B3G A;  1ZKB A;  3K01 A;  3M3K A;  1T0K A;  4OET A;  4AQ4 A;  2ESN A;  3B8B A;  2I49 A;  3T96 B;  1FQA A;  1M5C A;  1POT A;  5F7V A;  3C34 A;  4O3A A;  1IMC A;  3KN3 A;  2I4B A;  2G93 A;  4XEQ A;  2ZZW A;  4R73 A;  3MP8 A;  5AA3 A;  3B6Q A;  1NNF A;  3MWB A;  2W7Y A;  1LB8 A;  2OWS A;  4MNC A;  2PFY A;  4N17 A;  3E3K A;  4QSC A;  2CZI A;  2XHD A;  5BUU A;  4NE4 A;  2F34 A;  4TLM B;  2L5V A;  1XI6 A;  2ZYK A;  3SEX A;  1A8E A;  3O2A A;  3FJG A;  3MP6 A;  4N81 A;  1CE2 A;  3MVY A;  4G68 B;  1QW0 A;  3LR1 A;  4F1U A;  4BDN A;  2UYE A;  3B6T A;  1N7W A;  2DE2 A;  4TOZ A;  4JSO A;  3K6U A;  3N6U A;  5FHN A;  1VFE A;  4NWD A;  2F7A A;  5KDT B;  1QVS A;  4ZS9 A;  1ZMG A;  1NH7 A;  4H1X A;  4HCY A;  1DK4 A;  3T22 A;  5L8D A;  1AOV A;  1DBZ A;  3SEW A;  4PAF A;  4ZE9 A;  3M8U A;  4F29 A;  3KBZ A;  4HTG A;  2HPG A;  4X48 A;  2Z8F A;  4MNI A;  4PFW A;  3FGS A;  2Q2C A;  4GD5 A;  5ET8 A;  3MW0 A;  4R74 A;  1QUL A;  3HN0 A;  3TDJ A;  2ONK E;  1H45 A;  5K2X A;  3FXQ A;  3MZ1 A;  1JVY A;  5ESY A;  1Y20 A;  3KC0 A;  2QS2 A;  3FVG A;  3IX1 A;  1BKA A;  4ISU A;  1DSN A;  2RIN A;  1RDY A;  1QKB A;  1L5T A;  3OSQ A;  1LGB C;  4KI0 E;  3P7I A;  3KOS A;  4PFU A;  4GVO A;  2I48 A;  4R9G A;  1KA1 A;  5F1Q A;  2DDK A;  3U72 A;  4RA1 A;  2DQV A;  4G4P A;  2HXW A;  1LEV A;  4QHQ A;  5EQA A;  1NV5 A;  1FPB A;  3CVG A;  3PPO A;  4PE5 B;  3K1M A;  2XXY A;  4XKN A;  1FPJ A;  2Y7K A;  4OHN A;  5FTI A;  2A5T B;  1FTL A;  1RDZ A;  1B52 A;  4R6H A;  3C31 A;  5I84 A;  3RT6 B;  2ZZX A;  4JWO A;  1SVX B;  4UAB A;  1MM7 A;  4EQ9 A;  3H03 A;  4NF4 B;  4KCD A;  3VE1 B;  3CIJ A;  4DCX A;  5AA1 A;  4PQJ A;  1IXH A;  3G3H A;  1RYX A;  4DCY A;  3MP1 A;  4DI3 D;  2Y5L A;  1N0T A;  1D3K A;  5JTY A;  1URG A;  4GOT A;  4XXU A;  4E0X A;  4PDH A;  3SER A;  4MLV A;  2I4C A;  2OK2 A;  2R71 A;  3KOT A;  4EXK A;  4FIM A;  1M5D A;  3PMW A;  1PB9 A;  2XXT A;  2Y7W A;  5I57 B;  4R72 A;  1FBD A;  4YKJ A;  1BP5 A;  2NWJ A;  1Y4T A;  3I6V A;  4F22 A;  3TTK A;  1LBX A;  3K1P A;  4E0W A;  3MJN A;  2Q74 A;  1B58 A;  3S9L C;  4LAT A;  2D3I A;  3H6W A;  2REJ A;  1NUW A;  1P1N A;  2DSF A;  2YPN A;  4MHF A;  4C1U A;  4MCO A;  1LBB A;  1UTB B;  3DP8 A;  4KYD A;  1OIB A;  5JEI A;  3RTW B;  3TCG A;  5KCJ B;  1GV8 A;  1YYZ A;  3FVN A;  5I2N A;  1MXZ A;  3MZB A;  4IO4 A;  1GTK A;  1HSL A;  4R75 A;  4GWY A;  1FW0 A;  1WDN A;  3W9W A;  2RKM A;  3OEK A;  4NF4 A;  5ISU A;  2WYK A;  5I56 A;  4LA9 A;  3VLU A;  4X1B A;  5IZ3 A;  1H43 A;  1SW2 A;  2QL3 A;  2XD2 A;  4EQ7 A;  3RPL B;  4I3Y A;  1OMP A;  3G3K A;  2I3W A;  1I6Q A;  4FJP A;  4OWD A;  5CM6 A;  1FTK A;  4H8I A;  1NNK A;  3QUF A;  3IAZ A;  5ET6 A;  5I58 A;  5IGA A;  1LBZ A;  3TTM A;  3W9V A;  2H25 A;  2V4C A;  5ICT A;  3DM0 A;  4F2Q A;  1XS5 A;  1Y9U A;  3K6X A;  4IGR A;  3RPW A;  3CR9 A;  3FAS A;  3V5A A;  4H45 A;  3KN7 A;  3I5O A;  3O6H A;  2O7U A;  1NKX A;  3PU5 A;  1DMB A;  2D5W A;  1US4 A;  1DTG A;  5LDZ A;  1US5 A;  4ZZE A;  1PB8 A;  1MY2 A;  3MVW A;  3IOU A;  1EYI A;  5CMB A;  1MY4 A;  4NMY A;  1JEV A;  2HHM A;  4HE1 A;  4QFP A;  1NV4 A;  3FVK A;  5H8H B;  4JXI A;  5ITO A;  3G3I A;  1Q35 A;  2I3V A;  3FZV A;  1SDX A;  3ZKL A;  4PFR A;  4P0G A;  1FBP A;  1ZTY A;  2Z22 A;  1SBP A;  3K1N A;  5H8N B; 
#chains in the Genus database with same CATH homology
 2FIE A;  1FTA A;  1VDW A;  2L5V A;  1XI6 A;  2XWO A;  4NAP A;  4OVQ A;  4P47 A;  5I7I A;  4LN5 A;  4KXP A;  5IZ3 A;  1AWB A;  1FBC A;  1KZ8 A;  2OX3 A;  2R8T A;  2DE3 A;  4AS5 A;  4X9T A;  1FPG A;  1RDZ A;  4I40 A;  4O94 A;  4N81 A;  1BK4 A;  5EQ7 A;  4MAG A;  3RPL B;  2BJI A;  3B50 A;  1FPE A;  1K9Z A;  2Q9T A;  4I3Y A;  4N4U A;  4F1U A;  1NUZ A;  4NHB A;  5I5P A;  4N6K A;  4O8M A;  2FBP A;  2ZZX A;  4NX1 A;  4UAB A;  3RPL A;  5FBP A;  4OVP A;  2DE2 A;  1FJ9 A;  3LV0 A;  4HE2 A;  5J1D A;  4PGN A;  1FPD A;  4PTK A;  4PGP A;  1LBY A;  4GWW A;  4P56 A;  5IZ3 B;  4H46 A;  1FPF A;  1JP4 A;  3MYU A;  2FIX A;  4NG7 A;  2HZL A;  4NN3 A;  4X8R A;  1NI9 A;  4GWS A;  4GX3 A;  5ET7 A;  4GWX A;  4P8B A;  3BIG A;  2QPQ A;  4I3E A;  5CM6 A;  2XWK A;  4HCW A;  3GYY A;  4NF0 A;  4P1E A;  4HCY A;  4M1V A;  1DK4 A;  1RDX A;  3ROJ A;  2B4M A;  3EKI A;  1FBF A;  5EYG A;  5JK4 A;  1NUX A;  2XWV A;  1DBZ A;  4MX6 A;  2F5X A;  1EYJ A;  4N8G A;  2CZH A;  3PTY A;  1NV7 A;  4JVI A;  5ET6 A;  5IGA A;  1IME A;  1LBZ A;  1KA0 A;  2F3B A;  3RYD A;  4PAF A;  3W9V A;  4DI3 D;  1SPI A;  5EQ9 A;  4PCD A;  2V4C A;  3HFU A;  3QMF A;  2Y5L A;  3LUZ A;  4PFB A;  4F1V A;  1LBW A;  4GWU A;  3KBZ A;  4IR8 A;  4OAN A;  2B4L A;  2XWI A;  1K9Y A;  1YXI A;  3CHG A;  5IZZ A;  2F3D A;  4G61 A;  2HPG A;  4DI4 B;  2QVR A;  1YZ0 A;  1FSA A;  4MNI A;  4N8Y A;  4NQ8 A;  1EYK A;  4PDH A;  4PBH A;  5T3J A;  2XXK A;  2WX9 A;  2CEX A;  5F24 A;  4NGU A;  1Q9D A;  1FBH A;  4OVS A;  2HXR A;  1LBV A;  4GBW A;  1NV0 A;  1NV2 A;  1FPK A;  5DW8 A;  3FBP A;  4PF8 A;  4GWZ A;  2DVZ A;  2WYP A;  3NOH A;  4H45 A;  2WEF A;  2VT5 A;  4JVD A;  5ET8 A;  4GBV A;  4X04 A;  5A5L A;  5LTC A;  2V3Q A;  4XF5 A;  3IFC A;  4OA4 A;  2WBB A;  4PBQ A;  1NV6 A;  4PC9 A;  4YZZ A;  1FBG A;  4O7M A;  3E78 A;  1FBD A;  1FPI A;  3E79 A;  2QVU A;  4OVR A;  5IM2 A;  4FBP A;  4OVT A;  1DCU A;  1CNQ A;  2KR0 A;  2XA5 A;  2MKZ A;  5LDZ A;  2ZZV A;  3A29 A;  4JVC A;  4N6D A;  1FPL A;  4PET A;  4XFE A;  3FXB A;  1IMF A;  1LBX A;  3KC1 A;  1NUY A;  1NV3 A;  4N15 A;  3SZP A;  5EQ8 A;  4HXV A;  2Q74 A;  3B8B A;  4GX4 A;  5ESY A;  2P3V A;  1EYI A;  3KC0 A;  4P9K A;  1G0H A;  1IMC A;  2FVZ A;  2P3N A;  2Q8M A;  3T0J A;  2PFZ A;  1RDY A;  2HHM A;  4P1L A;  4HE1 A;  4PF6 A;  2GQ1 A;  1NUW A;  4QXD A;  4MNP A;  2FHY A;  4XEQ A;  3T1B A;  1IMD A;  1NV4 A;  5IZ1 A;  5EYH A;  1FJ6 A;  4MHF A;  5J16 A;  4MCO A;  3U65 A;  2WBD A;  2ZZW A;  2QVV A;  4MEV A;  2QFL A;  2HZK A;  4F19 A;  3MST A;  2VPO A;  4PDD A;  1YYZ A;  1KA1 A;  2PCR A;  4MMP A;  1FBE A;  4HE0 A;  2KQZ A;  4PAK A;  4N91 A;  2DDK A;  1IMB A;  4PFI A;  2CEY A;  4MNC A;  4GWY A;  4QBA A;  4F18 A;  2PFY A;  4N17 A;  5I3S A;  3ISP A;  3BIH A;  1NV1 A;  4MJO A;  2DE4 A;  4PFR A;  1G0I A;  1D9Q A;  4GX6 A;  3IFA A;  1FBP A;  2CZI A;  4PE3 A;  3W9W A;  4PAI A;  4YIC A;  2VPN A;  3D1R A;  4MIJ A;  1INP A;  1QGX A;  1LEV A;  4P3L A;  2WYK A;  5EQA A;  1NV5 A;  2Y5K A;  1FPB A;  2CZK A;  2JJK A;  1FRP A;  4AS4 A;  5ET5 A;  2OWZ A;  4O7I A;  1FPJ A;  1IMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...