4HE1A

Crystal structure of human muscle fructose-1,6-bisphosphatase q32r mutant complex with fructose-6-phosphate and phosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
326
structure length
309
Chain Sequence
MLTLTRYVMEKGRQAKGTGELTRLLNSMLTAIKAISSAVRKAGLAKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 309
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he1A02
2JJKA 4GWSA 3RYDA 4O7IA 1FPJA 1FRPA 1NV5A 4GBVA 1K9ZA 1INPA 4GWWA 1FPIA 2GQ1A 2QFLA 2QVRA 1FBDA 1KA0A 2F3BA 1NV2A 4I3YA 5DW8A 1NI9A 3BIHA 4PTKA 1FBFA 2P3NA 1CNQA 1DCUA 3IFAA 4GWUA 3LV0A 5IZ1A 2QVUA 1NV0A 2CZHA 1LBXA 3KC1A 1YXIA 1IMDA 1IMBA 2PCRA 3FBPA 3LUZA 4H46A 5IZ3B 1FBGA 1FPDA 4I3EA 2Q8MA 1LBYA 1RDZA 3A29A 1NV4A 5I3SA 2F3DA 1FPKA 5ESYA 2FVZA 4AS4A 1NV6A 1KZ8A 1YZ0A 2WEFA 1FPEA 4I40A 3T0JA 4KXPA 1EYIA 1FTAA 2P3VA 5FBPA 2WBBA 1EYKA 5EQ7A 5EYGA 1LEVA 4GWYA 4GWZA 1XI6A 4GWXA 1FBEA 2FIEA 1FJ6A 4MJOA 5EQAA 1IMCA 1QGXA 2BJIA 1SPIA 1D9QA 3ROJA 1IMFA 2HHMA 1VDWA 1K9YA 1NV7A 2Q74A 2VT5A 5J16A 2FBPA 3B8BA 5ET8A 1DBZA 2FIXA 5EQ9A 5EQ8A 1FBPA 3QMFA 4G61A 1FSAA 1IMEA 2Y5LA 1FPBA 4GX6A 1YYZA 1LBVA 4HE2A 3D1RA 1NV3A 1NUXA 1EYJA 2DDKA 1RDYA 3RPLA 1LBWA 1LBZA 3RPLB 1NUZA 4HXVA 5A5LA 2WBDA 1FPLA 4GBWA 1RDXA 5ET5A 2Y5KA 2FHYA 1AWBA 3IFCA 4GX3A 5T3JA 1FPGA 4GX4A 1KA1A 5F24A 1BK4A 4HE1A 4HE0A 2OX3A 1FJ9A 5ET6A 1Q9DA 3KC0A 1NUYA 2R8TA 5EYHA 1DK4A 4N81A 5ET7A 4QXDA 1G0HA 3KBZA 1NUWA 3BIGA 1FBCA 1G0IA 2CZKA 1JP4A 2QVVA 4FBPA 4IR8A 4AS5A 1FPFA 1IMAA 1NV1A 4H45A 2CZIA 1FBHA 5IZ3A 5LDZA 2OWZA
chains in the Genus database with same CATH superfamily
2JJKA 1ZJLA 1K9ZA 1INPA 4GFRA 4ESWA 4IO4A 3SEXA 5DW8A 2XWIA 2RC8A 4XXUA 4OVQA 3OSRA 3OMBA 5ICTA 2V3QA 1IMDA 1BP5A 3FVKA 3FBPA 3VLUA 1H3DA 4H46A 3W15C 1B0HA 4JVDA 2Y7KA 1RDZA 4G68A 2XXIA 5DVFA 1PBPA 4XIGQ 4GL8A 1MQJA 3FD3A 3TEPA 5TPAA 4GWZA 4UACA 1LLSA 5KDTA 1N84A 1Y4TA 1AOVA 4NF5B 1SI1A 3D4GA 4NE4A 3T1BA 2FIXA 3U94A 2Q9TA 1MM6A 4BDQA 4KQPA 2R9JA 3LSWA 4WEPA 4JSDA 1FQDA 3Q28A 3M3LA 2F97A 2I58A 2OZZA 4LZ7A 4N13A 4HXVA 1FTLA 3MP1A 4ELOA 2WBDA 3BFTA 1B5IA 1FQCA 1DOTA 4G8NA 2RF1A 3UK4A 1NKXA 3S2VA 3H6VA 3H06B 4YU0A 5I58A 4L17A 1BKAA 5EYHA 4GL0A 4PETA 4F19A 4PE5B 4DLDA 4OHNA 1A8EA 1Y4CA 4P8BA 3IORA 5DT6A 3QUFA 4HS7A 1FBHA 1B05A 5I2KB 1MQDA 1B0LA 2VPNA 3QAXA 4ZZAA 4YKPA 3RN8A 1O63A 4GWWA 1FPIA 1B3GA 1FQFA 1UTBA 1US5A 5CM6A 4YB6A 2LAOA 4FATA 3SEYA 4OFJA 2WX9A 3A3UA 1M5CA 2DE4A 4U4SA 1ZTYA 1B46A 3M3KA 1CNQA 1DCUA 2ZNUA 1R9LA 2UXAA 1B1HA 1XHYA 2PCRA 1MY0A 1R9QA 2PT1A 4I3EA 2Q2CA 3G3FA 4R2FA 2XWVA 2OBGA 5TP9B 3U93A 1MDQA 4JVIA 3KSXA 2KQZA 3MW0A 1B51A 4R6HA 2F34A 5EQAA 1DPPA 1ZU0A 2F7AA 1K9YA 3PMWA 3JYRA 1P99A 4P0GA 2GH9A 3HV1A 3KEIA 4TLMB 2XXUA 4H1XA 3H6WA 3RLFE 4PFUA 3EN3A 1UIUA 2A5SA 3H03A 4JWXA 1MXZA 2HEUA 2X7PA 3T66A 4Z0IA 3IR1A 4GX4A 5IZZA 1UQWA 5ET6A 2ESNA 4GOTA 2OLBA 4F3SA 3TTMA 1CB6A 4PCDA 2B4MA 2PFZA 4AB5A 3BIGA 1Y1MA 4MH5A 3IB2A 4GLIA 4M4GA 5I56A 1MPDA 2DE2A 1WVJA 1SYHA 1N7XA 4F2QA 3Q26A 4I3YA 3ONMA 3MPKA 4P3LA 3I6VA 3OO6A 5AA3A 3FIRA 4OXVA 3SERA 3OEKA 3IOWA 2DVZA 1NV6A 3PTYA 3G3HA 3MZ9A 5HM4B 3TFLA 1LFHA 1EYKA 1PEBA 4HCWA 3H7MA 4ELRA 3IX1A 1QGXA 1PB7A 4O94A 3VFJA 2HCAA 1DBZA 1UTHB 2QS4A 3OOAA 1SW5A 3UN6A 1YPNA 1M5EA 2OWTA 2Q88A 2HFBA 4GIZA 1B5HA 2MKZA 4U21A 3SESA 5L9SA 1A54A 1NH8A 3LSXA 4N6DA 4F18A 1RDXA 4NF4A 3GBBA 1FCKA 1FJ9A 3CI8A 3O97A 2ONSA 4QXDA 1G0HA 2DXYA 4Q5TA 4FBPA 4GVOA 4NTLA 2CZIA 4OTEA 4OMBA 1NMUA 3CRBA 3CR9A 3I5OA 1N76A 4QSEA 5FHMA 4MBPA 3K02A 1II5A 3KG2A 4NEDA 3PPRA 1FTKA 1IQ7A 4EXLA 3ODBA 3V5AA 4FIMA 3CIJA 2ZZXA 1I6AA 2UYEA 2XD2A 4LVQA 4HW8A 2H4IA 4RXLA 3K6WA 3R6UA 1NFTA 1YXIA 1JQFA 3N6UA 5CBRA 5IZ3B 3F11A 4E0XA 5L8DA 3O29A 1URGA 1UIVA 2HZKA 2F7CA 3T0JA 1YZ0A 4I40A 4KXPA 4LA9A 5CMKA 2UVHA 4O8MA 1FTAA 1JW5A 1P1UA 3TCGA 4GWYA 3KOSA 3O6GA 1Z7NE 4NG7A 1TWYA 2AYSA 4F3PA 1IMCA 1ANFA 2XXRA 3ROJA 2QMWA 4M1VA 2UVJA 5H8QB 3VLWA 1GVCA 2DWJA 3SKPA 3IOUA 2O7UA 3MC2A 3FATA 1FQEA 1NV3A 1OLAA 4NWDA 4NF6A 1LBZA 4Z7EA 2WKYA 1OVBA 1IZ1A 3IJOB 2X7QA 1LCFA 5DEXB 3CG1A 3KSJA 4KD5A 4JWYA 2RC7A 3A09A 4TQUQ 3FXRA 1FTJA 4P11A 1CE2A 2DOJA 4NHBA 2VHAA 4NF8A 2F6PA 3CSGA 2VP1A 1JW4A 1J1NA 1P1NA 2NXOA 3ZKKA 2P1SA 3HCQA 4OEUA 3C33A 1SBPA 4OVSA 3QIMA 2UVIA 3EKIA 1B52A 3G3JA 5I5PA 4OANA 4KYSA 3KOTA 5KCJA 1NV0A 1M5FA 3TAJA 3KC1A 4ELPA 2QS1A 2Z8EA 4PFYA 4YKJA 2PVUA 1OLCA 1GR2A 4XFEA 1MH4A 4G8HA 4AS4A 3N26A 4KR5A 4X1BA 2G93A 4F1UA 1BLFA 5ISUA 4G4PA 1T0KA 3BBRA 4WXJA 1MPBA 3TCHA 5A5XA 4QFLA 5H8HB 1SPIA 2IEEA 3S9MC 4YKIA 1D3KA 2VD2A 1B9JA 3TODA 4G61A 4X1DA 2V93A 3USDA 2B3BA 4QSDA 3B7DA 4U2RA 4DCXA 4I8CA 3SDFA 3ECRA 1LBBA 4OENA 3RPLB 4YB5A 3MUQA 4MNPA 4GQOA 4H0WA 3S9EA 3HN0A 4U23A 1XC1A 4FE8A 3MVYA 4X8RA 1MY3A 1QUIA 2O1MA 3PPQA 4WEDA 5DVJA 1MXWA 2B3FA 2GHBA 4F31B 2PFYA 3PD9A 3LR1A 4XF5A 4DE8A 1GGGA 4P9KA 3KN3A 4R74A 1MRPA 2HXWA 2B65A 4QRZA 4G2ZA 3RYDA 1RYOA 1FRPA 2PX1A 3KFMA 5CRYA 2QFLA 3PD8A 4YICA 5F7VA 2V84A 3JZJA 4OVRA 3CHGA 4DXUA 4DIGA 4JBZA 4N8YA 1MQIA 1O7TA 4UA8A 3BKIB 2VPOA 3EQ1A 3T22A 3OXNA 1JNFA 1BTJA 4MAGA 4X9TA 4F29A 1A8FA 1NV4A 2F3DA 1O64A 3V89B 4NGUA 2R6GE 2E0SA 1MXUA 3A3CA 3V8XB 3HSTA 4MEVA 4QF9A 4MJOA 5TPAB 1NNKA 1EZ9A 5KDTB 2BJIA 4BDLA 1D9QA 3QUJA 4JDFA 4U22A 2Q74A 4FORA 1MY1A 3QMFA 3N6TA 3SEUA 1IMEA 1B7ZA 2Y7WA 4F2OA 5FTHA 1MS7A 3IOVA 4MMPA 4NF0A 1GTKA 1B1XA 2B4LA 3K4UA 4GRKA 2OPDA 1IIWA 3HO7A 3QSLA 4I9DA 3MBPA 5LOMA 1H45A 1PBQA 1FPLA 4O7MA 3MAMA 3VVFA 3IFCA 5H8FB 1KA1A 1BK4A 1NUYA 5I57B 4HCYA 4YAHX 3U92A 4PF6A 1DPEA 1JP4A 4POXA 4IR8A 3TELA 4N6PA 1A55A 1OQHA 4U1OA 5JTYB 3RGYA 4DZ1A 4QBAA 3O28A 1FPJA 5KZTA 3U8QA 4OA4A 1A7LA 1FW0A 2QVRA 4NWCA 2I4CA 4POWA 5DVIA 4QFPA 1FBDA 1R1NA 1SW2A 1UTBB 2A5TA 4KCCA 3BIHA 4FJPA 2DQVA 3GYYA 2XX9A 3MVXA 2WYPA 1SW4A 5AA2A 2FNCA 4I62A 4PQJA 3VV5A 4GF8A 2Z23A 1B7UA 2H99A 3HHFA 5EYGA 2XXYA 2DWIA 4PF8A 3PGFA 2CMOA 2Q89A 3E3KA 3FJMA 1VDWA 4F39A 1NV7A 2XWOA 3EPEA 5EQ9A 5EQ8A 3MZ1A 3LC8A 3DLNA 4GX6A 1N3XA 1Y1ZA 1LFIA 1Y3NA 3ISPA 1NUXA 3TTLA 3KN8A 4IGRA 3MP8A 5I2KA 2ABHA 2CZLA 2G29A 2F36A 1LAGE 1LSTA 2CEXA 1PB9A 4JWOA 3OENA 3IO4A 1AWBA 5I59A 1DMBA 4BDRA 5ET7A 1NUWA 3IO6A 1H44A 3R26A 1B7HA 4XEQA 1QUJA 3C36A 3NOHA 5LDZA 1FTOA 2XXXA 3RT6B 4EF2A 2I6EA 3S9NC 4P1EA 4LP2B 3E13X 4FAJA 5K2XA 4GBVA 1NL5A 4BDOA 4RYAA 4EUOA 2R71A 4LONB 3RUMA 2O7IA 1FBFA 1XOCA 2XD3A 4P0IA 1B4HA 1FBGA 3SEVA 2OPEA 3GXAA 1SDXA 2XXWA 3C34A 1KZ8A 1JVYA 3FVNA 2ZZVA 2PT2A 1QW0A 3B50A 3U1OA 4LATA 3PUWE 5I2NB 5JEIA 5CMMA 3TZAA 1IUDA 4AQ4A 3VVEA 4RJZA 1Y3QA 2AIXA 2NWJA 2Y5LA 2OJTA 1D9YA 2GHAA 1LBVA 4HE2A 3MYUA 2D21A 4N6KA 4ZDMA 2RKMA 1D9VA 5FHOA 4THIA 3PU5A 2V25A 2DVCA 2E1SA 1WODA 3RNNA 4NF4B 5L9OA 2H98A 1EZPA 2PMSA 1B58A 3O6HA 1BIYA 1NV1A 2D5WA 3O2AA 3TUSA 4O7IA 4LQ5A 3U65A 1MH3A 3FXUA 5I7IA 1KA0A 4BDNA 2ZNTA 1H76A 1QJMA 2XXHA 3RY3A 3HFUA 1TFDA 3EHTA 4O3AA 1MY2A 1B5JA 1IMBA 3CSBA 1MM7A 4NQ8A 3CFZA 4C0RA 2OWSA 1AMFA 5HPQA 1FPKA 2V4CA 2WEFA 5H8NA 3FJ7A 1EYIA 4KYDA 2L5VA 2O51A 3TQLA 2GRVA 1YCJA 2REGA 1LFGA 2I0BA 1OVTA 1Z7ME 3KZGA 4F22A 1JETA 4OFLA 4N4UA 1FJ6A 4H8IA 1FTMA 4XKNA 1JW1A 3VXCA 1R6ZA 4LQ2A 4QHQA 2XX8A 1YAEA 1YYZA 1OQGA 3FXQA 1PDAA 2O68A 1FQBA 3T9XB 3L6HA 3UIFA 5L9MA 4UABA 2O69A 4NF6B 4IO7A 5A5LA 1VR5A 5ET5A 3UA8A 1MXXA 2CEYA 4N81A 2F5XA 4ZE8A 3KBZA 1HSLA 1ZMGA 3K6XA 3PUXE 2RCBA 1IITA 3PPOA 3WAEA 1VFDA 3LSLA 1LBCA 4QFNA 4YZZA 4AS5A 5F1QA 4H45A 5IZ3A 2ZXTA 5AE4A 4H5FA 3TTKA 4NF8B 4BLAA 1MDP1 4FEBA 1EZOA 4NAPA 2YLNA 1WDNA 2REJA 3E78A 4OZ9A 3L6GA 3MPLA 3K0VA 3OEMA 3TCFA 4OVTA 2V3TA 2BJJX 4F3BA 3FV2A 2QVUA 4RK9A 1N0TA 5KCJB 3K1MA 3JV9A 4RPNA 3UORA 3ILUB 4IY6A 2XXTA 4OVPA 5ESYA 2FVZA 2RINA 3RQTA 3OSQA 4R73A 3FZVA 1JVXA 4H5GA 2VD3A 5FBPA 1B2HA 2UYFA 4KYEA 4GWXA 4YMBA 2ONKE 4GD5A 2NVUB 2PYYA 1I6BA 2Q2AA 4GWOA 3K6UA 1SYIA 5A5XB 1IMFA 2Z8FA 5DEXA 2I48A 3B8BA 3HHGA 1TFAA 1SD3A 3IOTA 3LSFB 3MQ9A 2I49A 3B6QA 5DYHA 4MCOA 5EYFA 1DTGA 3CFLA 2H5YA 3H3GA 1S50A 4DI3D 1Y9UA 1MXVA 2XXVA 3BFUA 2QPQA 1OMPA 3MWBA 4TOZA 2DXRA 1FPGA 2VGQA 3D4CA 5AA2D 5F24A 4HE1A 3KC0A 4C1TA 2ALUA 1F9BA 2I4BA 2QVVA 1B3LA 4QFKA 4PAIA 1P1QA 3PPNA 1XS5A 4GWSA 5AA4A 2RCAA 5BWJA 3T9HB 1NV2A 1M5BA 1A99A 1NI9A 3GLBA 2F6GA 2M8CA 5H8HA 4NN3A 4QSCA 5ITOA 2XX7A 1RKMA 1QUKA 4DXCA 3FGSA 4LN5A 2XA5A 4H65A 2WBBA 3H4ZA 2FIEA 2AL4A 3W9VA 4TLLB 1MPCA 4EXKA 3VVDA 1QULA 2Y84A 1EH3A 3Q27A 3FVGA 4X48A 1MQHA 1FBPA 3RTWB 1I6QA 4G68B 3K1NA 2ZYMA 2H25A 1I69A 4MIJA 5JK4A 5ITPA 3C4MA 1IXGA 1B4ZA 3KN7A 4ZEIA 2F8DA 3FVOA 4X04A 4GBWA 2F7BA 4F1VA 2NOOA 1AH5A 1A40A 4YB7A 1Q9DA 3MZBA 2QMXA 3ILTB 1ZKBA 3CVGA 3TYHA 4FEDA 2HXRA 2CZKA 5DTBA 4PFIA 4PFWA 2QL3A 1Y3PA 3VDFA 2OWZA 4PAFA 3GBAA 1QVSA 3TMGA 5BUUA 3HPIA 1VE4A 4H6DA 3M8UA 2UVGA 3IK6B 3W9WA 3FUZA 5I58B 3SEWA 1USYH 2A5TB 2F35A 1B3FA 1N3WA 1USYE 4I1DA 3R7XA 5H8SA 5EHSA 2ZZWA 3PUYE 1LBXA 5ELVA 1NH7A 2P2AA 3C32A 4OFOA 2DWAA 5AA2B 3A29A 2QJEA 1FPEA 3MJNA 4DXBA 4MHFA 3C9HA 1LAHE 5EQ7A 3FV1A 4U4XA 4MFIA 3E4RA 4NF5A 4XKRA 5H8FA 4ZECA 2DE3A 5I57A 4IO3A 2YJPA 1NNFA 4PP0A 1VFEA 4IO5A 5M2VA 4RA1A 1XVXA 4EDPA 3SZPA 3IAZA 4EQBA 4PDHA 4ZS9A 2X26A 1LAXA 3D1RA 3K1PA 1EYJA 1Q1KA 5JTYA 3DP4A 4EQ9A 3B6WA 3T9UA 1N04A 4FECA 2O1LA 4QFOA 2HPGA 3TDJA 4RNSA 3CG3A 4OETA 1QKBA 5I59B 4PDDA 4KPTA 3LBSA 4ECFA 1MXYA 5I84A 4PGPA 3G3KA 5J1DA 3V83A 4ELQA 3LUYA 4MF3A 2ZYKA 3SETA 2ANJA 3GZGA 4R6YA 2QRYA 4PC9A 3K00A 3DM0A 3KGCA 2F78A 3G3GA 1MY4A 5B7DA 3QK6A 4O3CA 1MG1A 3EHSA 2W7YA 2QS2A 3OO9A 5AA1A 2OCUA 3THIA 4PFRA 2CZHA 3K01A 2OK2A 3UGWA 4R9GA 5I56B 4R6KA 3LUZA 1FPDA 1LBYA 4DDDA 1XVYA 5TP9A 4Q8RA 5I3SA 5K2YA 2P3VA 1Y20A 3N5LA 3DELB 5TU0A 3FJGA 1XI6A 1FBEA 3VXBA 5CC2A 1POY1 2DP8A 3PV0E 4P1LA 2HHMA 2VT5A 4IGTA 5ET8A 1FPBA 3M3FA 4N17A 1ATGA 3ZSFA 1LCTA 1LB9A 2QSXA 3RT8A 4ZE9A 4N91A 4KFQA 1S7YA 3O6IA 2XXPA 3RPWA 3KJ7A 4GX3A 1IXIA 2OX3A 2ONRA 3KBRA 2O84X 4U1ZA 4PFBA 4KCDA 1US4A 2HAVA 4PBQA 1FPFA 4OQOA 1IMAA 4MNCA 2FA7A 5CI5A 4F1YA 4XTCQ 1NV5A 3AXFA 3OO7A 4OERA 2XXQA 3E9XA 1ZIUA 1P1WA 4P56A 1B3EA 5I2NA 4Q30B 1XT8A 4ZEFA 1TT1A 1NNTA 2Y7RA 3IFAA 3LV0A 4MLVA 1B3HA 4N8GA 1ELJA 2Y7IA 3Q25A 3N94A 4PAKA 1B6HA 1P1OA 2I0CA 5H8NB 2WYKA 2ZMBA 4R72A 2D3IA 4JSOA 2IA4A 2XWKA 1POTA 1OIBA 4EQ7A 3PMXA 4N07A 3IL1B 4EF1A 1UTHA 4K3FA 5J16A 3K2DA 2FBPA 5IKBA 4OESA 4C1UA 3MVZA 1HSEA 2I3VA 4R2BA 1EU8A 4OVJA 3DP6A 2DSFA 2YPNA 1PC3A 1QKAA 4Q0CA 4P47A 4F3GA 2KR0A 1JEVA 4DI4B 2Y5KA 4KI0E 2FHYA 3S4UA 2FYIA 3IB1A 2KLFA 5ICQA 4GXAA 1KWHA 4ISUA 1IEJA 4LUBA 3TTRA 1LAFE 4LZ8A 4G77A 1TXFA 3MSTA 2THIA 2Z22A 5IGAA 2ZYNA 2GQ1A 2VOZA 4H67A 1GV8A 2P0SA 3T96B 2V3UA 4PTKA 2NUVA 3DP8A 4ZZEA 2P3NA 4GWUA 5IZ1A 3ZS6A 1H43A 3Q29A 3B6TA 4ONYA 5B70A 2O6AA 3ZKLA 2HZLA 1IXCA 3CFXA 3PUVE 2HQ0A 4RK2A 4HTGA 4MNIA 1LB8A 1B32A 2Q8JA 3OD7A 5H8QA 1PB8A 3G7WA 2DWHA 1DTZA 4IY5A 1URSA 3MP6A 1SVXB 1N7WA 2DYXA 1LGBC 3S9LC 5EHMA 3TQWA 4WKMA 4G68C 3MVWA 1IXHA 1L5TA 4OWDA 4IO2A 1RYXA 4OEVA 1RDYA 3WAFA 2XHDA 3E79A 1NNPA 2XXKA 4NX1A 5IAIA 1FQAA 3K6VA 4NMYA 4DCYA 4N15A 1SI0A 4MX6A 5T3JA 4HE0A 3PUZE 4GXSB 4RPOA 3H6TA 4JB7A 1S9TA 4YMAA 4RY1A 1FBCA 1ZBMA 4JVCA 3G3IA 1URDA 4MLQA 1M5DA 1DSNA 3TKDA 4PBHA 4O3BA 4BDMA 3VE1B 4ZEKA 1ZLQA 3QYTA 4XKPA 3FXBA 5AA4B 1YTVA 3IJXB 4R9FA 5CBSA 4ND9A 2F3BA 3O9PA 1Q35A 2I3WA 5CMCA 2GFEA 1HSJA 4PFTA 4R75A 2DS9A 2ZNSA 2Y7PA 1SW1A 4KHZE 3O66A 4H8JA 1MQGA 3UP9A 5HBCA 3H6UA 2Q8MA 1SQYA 4LZ5A 3T93B 4OYVA 3C35A 5FHNA 4ZEDA 5LTCA 1LEVA 2H9BA 3VLVA 3C31A 3OO8A 3FASA 1B40A 2ZYOA 4AB6A 5FTIA 4IO6A 3TTNA 1AIVA 1JEUA 3U72A 3RTFB 1FSAA 3OELA 4IB2A 1D4NA 3T9VA 4YKKA 2RC9A 1VSOA 4JXIA 3I3VA 5CMBA 2DDKA 3RPLA 1LBWA 2PBWA 2QS3A 1NUZA 3PPPA 4ZEBA 3PMVA 2AL5A 3QXMA 3P7IA 4PE3A 4E0WA 5IM2A 4ESXA 2Z8DA 3TPAA 4PGNA 2R8TA 1DK4A 4G8MA 1AL3A 3EF7A 2HAUA 1G0IA 3EHUA 3IB0A 4XKQA 3KJTA
chains in the Genus database with same CATH topology
2JJKA 4O7IA 4PC9A 3U65A 1K9ZA 1INPA 4OVSA 5I7IA 1KA0A 5DW8A 3EKIA 2XWIA 5I5PA 4OANA 3HFUA 4OVQA 4PFRA 1NV0A 2CZHA 3KC1A 2V3QA 1IMDA 1IMBA 3FBPA 3LUZA 4H46A 1FPDA 4NQ8A 4JVDA 1LBYA 1RDZA 4XFEA 5I3SA 1FPKA 4AS4A 2V4CA 2WEFA 1EYIA 2L5VA 2P3VA 4F1UA 4GWZA 1XI6A 1FBEA 4N4UA 1FJ6A 4P1LA 1SPIA 2HHMA 2VT5A 3T1BA 5ET8A 2FIXA 4G61A 2Q9TA 1FPBA 1YYZA 4N17A 3RPLB 4UABA 4HXVA 4N91A 5A5LA 2WBDA 4MNPA 5ET5A 4GX3A 4X8RA 2OX3A 5EYHA 2CEYA 4N81A 2F5XA 4PETA 4F19A 3KBZA 4PFBA 4P8BA 2PFYA 4PBQA 4XF5A 4YZZA 4AS5A 1FPFA 1IMAA 4H45A 4MNCA 1FBHA 5IZ3A 4P9KA 3RYDA 2VPNA 1FRPA 1NV5A 4GWWA 1FPIA 2QFLA 4YICA 4NAPA 5CM6A 4P56A 4OVRA 3CHGA 3E78A 2WX9A 2DE4A 4N8YA 4OVTA 1CNQA 1DCUA 3IFAA 3LV0A 2QVUA 2VPOA 4N8GA 2PCRA 4I3EA 4MAGA 4X9TA 2XWVA 4PAKA 1NV4A 4OVPA 2F3DA 5ESYA 2FVZA 4NGUA 4JVIA 2KQZA 5FBPA 2WYKA 4MEVA 4GWXA 2XWKA 4MJOA 5EQAA 2BJIA 1D9QA 1IMFA 1K9YA 2Q74A 5J16A 2FBPA 3B8BA 3QMFA 1IMEA 4MMPA 4NF0A 4MCOA 2B4LA 4DI3D 2QPQA 1FPLA 4P47A 2KR0A 4O7MA 4DI4B 2Y5KA 2FHYA 3IFCA 1FPGA 4GX4A 1KA1A 5F24A 1BK4A 4HE1A 5IZZA 5ET6A 3KC0A 1NUYA 4HCYA 4PCDA 4PF6A 2B4MA 2PFZA 3BIGA 1JP4A 2QVVA 4IR8A 2DE2A 4PAIA 3MSTA 5IGAA 4GWSA 4QBAA 1FPJA 4OA4A 2GQ1A 2QVRA 1FBDA 1NV2A 4I3YA 1NI9A 3BIHA 4PTKA 4P3LA 2P3NA 3GYYA 4GWUA 5IZ1A 2WYPA 4NN3A 2DVZA 1NV6A 2HZLA 3PTYA 4LN5A 2XA5A 2WBBA 1EYKA 5EYGA 4PF8A 2FIEA 4HCWA 4MNIA 3W9VA 1QGXA 1VDWA 1NV7A 2XWOA 4O94A 1DBZA 5EQ9A 5EQ8A 1FBPA 4GX6A 4MIJA 5JK4A 3ISPA 1NUXA 1RDYA 2MKZA 3E79A 2XXKA 4NX1A 4N15A 4N6DA 2CEXA 4X04A 4F18A 4MX6A 4GBWA 1RDXA 4F1VA 1AWBA 5T3JA 4HE0A 1FJ9A 1Q9DA 5ET7A 4QXDA 1G0HA 1NUWA 1FBCA 2HXRA 2CZKA 4JVCA 4FBPA 4XEQA 4PFIA 3NOHA 5LDZA 2CZIA 2OWZA 4PAFA 4PBHA 4P1EA 4GBVA 3FXBA 3W9WA 2F3BA 2ZZXA 1FBFA 2ZZWA 1LBXA 1YXIA 5IZ3B 1FBGA 2Q8MA 3A29A 2HZKA 3T0JA 1KZ8A 1YZ0A 4I40A 1FPEA 4KXPA 4MHFA 4O8MA 2ZZVA 1FTAA 3B50A 5LTCA 5EQ7A 1LEVA 4GWYA 4NG7A 1IMCA 3ROJA 4M1VA 2DE3A 1FSAA 2Y5LA 3SZPA 1LBVA 4HE2A 4PDHA 3D1RA 1NV3A 1EYJA 3MYUA 2DDKA 3RPLA 1LBWA 4N6KA 1LBZA 1NUZA 2HPGA 4PE3A 5IM2A 4PGNA 2R8TA 4PDDA 1DK4A 4PGPA 1G0IA 5J1DA 1NV1A 4NHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJK A;  4GWS A;  3RYD A;  4O7I A;  1FPJ A;  1FRP A;  1NV5 A;  4GBV A;  1K9Z A;  1INP A;  4GWW A;  1FPI A;  2GQ1 A;  2QFL A;  2QVR A;  1FBD A;  1KA0 A;  2F3B A;  1NV2 A;  4I3Y A;  5DW8 A;  1NI9 A;  3BIH A;  4PTK A;  1FBF A;  2P3N A;  1CNQ A;  1DCU A;  3IFA A;  4GWU A;  3LV0 A;  5IZ1 A;  2QVU A;  1NV0 A;  2CZH A;  1LBX A;  3KC1 A;  1YXI A;  1IMD A;  1IMB A;  2PCR A;  3FBP A;  3LUZ A;  4H46 A;  5IZ3 B;  1FBG A;  1FPD A;  4I3E A;  2Q8M A;  1LBY A;  1RDZ A;  3A29 A;  1NV4 A;  5I3S A;  2F3D A;  1FPK A;  5ESY A;  2FVZ A;  4AS4 A;  1NV6 A;  1KZ8 A;  1YZ0 A;  2WEF A;  1FPE A;  4I40 A;  3T0J A;  4KXP A;  1EYI A;  1FTA A;  2P3V A;  5FBP A;  2WBB A;  1EYK A;  5EQ7 A;  5EYG A;  1LEV A;  4GWY A;  4GWZ A;  1XI6 A;  4GWX A;  1FBE A;  2FIE A;  1FJ6 A;  4MJO A;  5EQA A;  1IMC A;  1QGX A;  2BJI A;  1SPI A;  1D9Q A;  3ROJ A;  1IMF A;  2HHM A;  1VDW A;  1K9Y A;  1NV7 A;  2Q74 A;  2VT5 A;  5J16 A;  2FBP A;  3B8B A;  5ET8 A;  1DBZ A;  2FIX A;  5EQ9 A;  5EQ8 A;  1FBP A;  3QMF A;  4G61 A;  1FSA A;  1IME A;  2Y5L A;  1FPB A;  4GX6 A;  1YYZ A;  1LBV A;  4HE2 A;  3D1R A;  1NV3 A;  1NUX A;  1EYJ A;  2DDK A;  1RDY A;  3RPL A;  1LBW A;  1LBZ A;  3RPL B;  1NUZ A;  4HXV A;  5A5L A;  2WBD A;  1FPL A;  4GBW A;  1RDX A;  5ET5 A;  2Y5K A;  2FHY A;  1AWB A;  3IFC A;  4GX3 A;  5T3J A;  1FPG A;  4GX4 A;  1KA1 A;  5F24 A;  1BK4 A;  4HE1 A;  4HE0 A;  2OX3 A;  1FJ9 A;  5ET6 A;  1Q9D A;  3KC0 A;  1NUY A;  2R8T A;  5EYH A;  1DK4 A;  4N81 A;  5ET7 A;  4QXD A;  1G0H A;  3KBZ A;  1NUW A;  3BIG A;  1FBC A;  1G0I A;  2CZK A;  1JP4 A;  2QVV A;  4FBP A;  4IR8 A;  4AS5 A;  1FPF A;  1IMA A;  1NV1 A;  4H45 A;  2CZI A;  1FBH A;  5IZ3 A;  5LDZ A;  2OWZ A; 
#chains in the Genus database with same CATH topology
 2JJK A;  1ZJL A;  1K9Z A;  1INP A;  4GFR A;  4ESW A;  4IO4 A;  3SEX A;  5DW8 A;  2XWI A;  2RC8 A;  4XXU A;  4OVQ A;  3OSR A;  3OMB A;  5ICT A;  2V3Q A;  1IMD A;  1BP5 A;  3FVK A;  3FBP A;  3VLU A;  1H3D A;  4H46 A;  3W15 C;  1B0H A;  4JVD A;  2Y7K A;  1RDZ A;  4G68 A;  2XXI A;  5DVF A;  1PBP A;  4XIG Q;  4GL8 A;  1MQJ A;  3FD3 A;  3TEP A;  5TPA A;  4GWZ A;  4UAC A;  1LLS A;  5KDT A;  1N84 A;  1Y4T A;  1AOV A;  4NF5 B;  1SI1 A;  3D4G A;  4NE4 A;  3T1B A;  2FIX A;  3U94 A;  2Q9T A;  1MM6 A;  4BDQ A;  4KQP A;  2R9J A;  3LSW A;  4WEP A;  4JSD A;  1FQD A;  3Q28 A;  3M3L A;  2F97 A;  2I58 A;  2OZZ A;  4LZ7 A;  4N13 A;  4HXV A;  1FTL A;  3MP1 A;  4ELO A;  2WBD A;  3BFT A;  1B5I A;  1FQC A;  1DOT A;  4G8N A;  2RF1 A;  3UK4 A;  1NKX A;  3S2V A;  3H6V A;  3H06 B;  4YU0 A;  5I58 A;  4L17 A;  1BKA A;  5EYH A;  4GL0 A;  4PET A;  4F19 A;  4PE5 B;  4DLD A;  4OHN A;  1A8E A;  1Y4C A;  4P8B A;  3IOR A;  5DT6 A;  3QUF A;  4HS7 A;  1FBH A;  1B05 A;  5I2K B;  1MQD A;  1B0L A;  2VPN A;  3QAX A;  4ZZA A;  4YKP A;  3RN8 A;  1O63 A;  4GWW A;  1FPI A;  1B3G A;  1FQF A;  1UTB A;  1US5 A;  5CM6 A;  4YB6 A;  2LAO A;  4FAT A;  3SEY A;  4OFJ A;  2WX9 A;  3A3U A;  1M5C A;  2DE4 A;  4U4S A;  1ZTY A;  1B46 A;  3M3K A;  1CNQ A;  1DCU A;  2ZNU A;  1R9L A;  2UXA A;  1B1H A;  1XHY A;  2PCR A;  1MY0 A;  1R9Q A;  2PT1 A;  4I3E A;  2Q2C A;  3G3F A;  4R2F A;  2XWV A;  2OBG A;  5TP9 B;  3U93 A;  1MDQ A;  4JVI A;  3KSX A;  2KQZ A;  3MW0 A;  1B51 A;  4R6H A;  2F34 A;  5EQA A;  1DPP A;  1ZU0 A;  2F7A A;  1K9Y A;  3PMW A;  3JYR A;  1P99 A;  4P0G A;  2GH9 A;  3HV1 A;  3KEI A;  4TLM B;  2XXU A;  4H1X A;  3H6W A;  3RLF E;  4PFU A;  3EN3 A;  1UIU A;  2A5S A;  3H03 A;  4JWX A;  1MXZ A;  2HEU A;  2X7P A;  3T66 A;  4Z0I A;  3IR1 A;  4GX4 A;  5IZZ A;  1UQW A;  5ET6 A;  2ESN A;  4GOT A;  2OLB A;  4F3S A;  3TTM A;  1CB6 A;  4PCD A;  2B4M A;  2PFZ A;  4AB5 A;  3BIG A;  1Y1M A;  4MH5 A;  3IB2 A;  4GLI A;  4M4G A;  5I56 A;  1MPD A;  2DE2 A;  1WVJ A;  1SYH A;  1N7X A;  4F2Q A;  3Q26 A;  4I3Y A;  3ONM A;  3MPK A;  4P3L A;  3I6V A;  3OO6 A;  5AA3 A;  3FIR A;  4OXV A;  3SER A;  3OEK A;  3IOW A;  2DVZ A;  1NV6 A;  3PTY A;  3G3H A;  3MZ9 A;  5HM4 B;  3TFL A;  1LFH A;  1EYK A;  1PEB A;  4HCW A;  3H7M A;  4ELR A;  3IX1 A;  1QGX A;  1PB7 A;  4O94 A;  3VFJ A;  2HCA A;  1DBZ A;  1UTH B;  2QS4 A;  3OOA A;  1SW5 A;  3UN6 A;  1YPN A;  1M5E A;  2OWT A;  2Q88 A;  2HFB A;  4GIZ A;  1B5H A;  2MKZ A;  4U21 A;  3SES A;  5L9S A;  1A54 A;  1NH8 A;  3LSX A;  4N6D A;  4F18 A;  1RDX A;  4NF4 A;  3GBB A;  1FCK A;  1FJ9 A;  3CI8 A;  3O97 A;  2ONS A;  4QXD A;  1G0H A;  2DXY A;  4Q5T A;  4FBP A;  4GVO A;  4NTL A;  2CZI A;  4OTE A;  4OMB A;  1NMU A;  3CRB A;  3CR9 A;  3I5O A;  1N76 A;  4QSE A;  5FHM A;  4MBP A;  3K02 A;  1II5 A;  3KG2 A;  4NED A;  3PPR A;  1FTK A;  1IQ7 A;  4EXL A;  3ODB A;  3V5A A;  4FIM A;  3CIJ A;  2ZZX A;  1I6A A;  2UYE A;  2XD2 A;  4LVQ A;  4HW8 A;  2H4I A;  4RXL A;  3K6W A;  3R6U A;  1NFT A;  1YXI A;  1JQF A;  3N6U A;  5CBR A;  5IZ3 B;  3F11 A;  4E0X A;  5L8D A;  3O29 A;  1URG A;  1UIV A;  2HZK A;  2F7C A;  3T0J A;  1YZ0 A;  4I40 A;  4KXP A;  4LA9 A;  5CMK A;  2UVH A;  4O8M A;  1FTA A;  1JW5 A;  1P1U A;  3TCG A;  4GWY A;  3KOS A;  3O6G A;  1Z7N E;  4NG7 A;  1TWY A;  2AYS A;  4F3P A;  1IMC A;  1ANF A;  2XXR A;  3ROJ A;  2QMW A;  4M1V A;  2UVJ A;  5H8Q B;  3VLW A;  1GVC A;  2DWJ A;  3SKP A;  3IOU A;  2O7U A;  3MC2 A;  3FAT A;  1FQE A;  1NV3 A;  1OLA A;  4NWD A;  4NF6 A;  1LBZ A;  4Z7E A;  2WKY A;  1OVB A;  1IZ1 A;  3IJO B;  2X7Q A;  1LCF A;  5DEX B;  3CG1 A;  3KSJ A;  4KD5 A;  4JWY A;  2RC7 A;  3A09 A;  4TQU Q;  3FXR A;  1FTJ A;  4P11 A;  1CE2 A;  2DOJ A;  4NHB A;  2VHA A;  4NF8 A;  2F6P A;  3CSG A;  2VP1 A;  1JW4 A;  1J1N A;  1P1N A;  2NXO A;  3ZKK A;  2P1S A;  3HCQ A;  4OEU A;  3C33 A;  1SBP A;  4OVS A;  3QIM A;  2UVI A;  3EKI A;  1B52 A;  3G3J A;  5I5P A;  4OAN A;  4KYS A;  3KOT A;  5KCJ A;  1NV0 A;  1M5F A;  3TAJ A;  3KC1 A;  4ELP A;  2QS1 A;  2Z8E A;  4PFY A;  4YKJ A;  2PVU A;  1OLC A;  1GR2 A;  4XFE A;  1MH4 A;  4G8H A;  4AS4 A;  3N26 A;  4KR5 A;  4X1B A;  2G93 A;  4F1U A;  1BLF A;  5ISU A;  4G4P A;  1T0K A;  3BBR A;  4WXJ A;  1MPB A;  3TCH A;  5A5X A;  4QFL A;  5H8H B;  1SPI A;  2IEE A;  3S9M C;  4YKI A;  1D3K A;  2VD2 A;  1B9J A;  3TOD A;  4G61 A;  4X1D A;  2V93 A;  3USD A;  2B3B A;  4QSD A;  3B7D A;  4U2R A;  4DCX A;  4I8C A;  3SDF A;  3ECR A;  1LBB A;  4OEN A;  3RPL B;  4YB5 A;  3MUQ A;  4MNP A;  4GQO A;  4H0W A;  3S9E A;  3HN0 A;  4U23 A;  1XC1 A;  4FE8 A;  3MVY A;  4X8R A;  1MY3 A;  1QUI A;  2O1M A;  3PPQ A;  4WED A;  5DVJ A;  1MXW A;  2B3F A;  2GHB A;  4F31 B;  2PFY A;  3PD9 A;  3LR1 A;  4XF5 A;  4DE8 A;  1GGG A;  4P9K A;  3KN3 A;  4R74 A;  1MRP A;  2HXW A;  2B65 A;  4QRZ A;  4G2Z A;  3RYD A;  1RYO A;  1FRP A;  2PX1 A;  3KFM A;  5CRY A;  2QFL A;  3PD8 A;  4YIC A;  5F7V A;  2V84 A;  3JZJ A;  4OVR A;  3CHG A;  4DXU A;  4DIG A;  4JBZ A;  4N8Y A;  1MQI A;  1O7T A;  4UA8 A;  3BKI B;  2VPO A;  3EQ1 A;  3T22 A;  3OXN A;  1JNF A;  1BTJ A;  4MAG A;  4X9T A;  4F29 A;  1A8F A;  1NV4 A;  2F3D A;  1O64 A;  3V89 B;  4NGU A;  2R6G E;  2E0S A;  1MXU A;  3A3C A;  3V8X B;  3HST A;  4MEV A;  4QF9 A;  4MJO A;  5TPA B;  1NNK A;  1EZ9 A;  5KDT B;  2BJI A;  4BDL A;  1D9Q A;  3QUJ A;  4JDF A;  4U22 A;  2Q74 A;  4FOR A;  1MY1 A;  3QMF A;  3N6T A;  3SEU A;  1IME A;  1B7Z A;  2Y7W A;  4F2O A;  5FTH A;  1MS7 A;  3IOV A;  4MMP A;  4NF0 A;  1GTK A;  1B1X A;  2B4L A;  3K4U A;  4GRK A;  2OPD A;  1IIW A;  3HO7 A;  3QSL A;  4I9D A;  3MBP A;  5LOM A;  1H45 A;  1PBQ A;  1FPL A;  4O7M A;  3MAM A;  3VVF A;  3IFC A;  5H8F B;  1KA1 A;  1BK4 A;  1NUY A;  5I57 B;  4HCY A;  4YAH X;  3U92 A;  4PF6 A;  1DPE A;  1JP4 A;  4POX A;  4IR8 A;  3TEL A;  4N6P A;  1A55 A;  1OQH A;  4U1O A;  5JTY B;  3RGY A;  4DZ1 A;  4QBA A;  3O28 A;  1FPJ A;  5KZT A;  3U8Q A;  4OA4 A;  1A7L A;  1FW0 A;  2QVR A;  4NWC A;  2I4C A;  4POW A;  5DVI A;  4QFP A;  1FBD A;  1R1N A;  1SW2 A;  1UTB B;  2A5T A;  4KCC A;  3BIH A;  4FJP A;  2DQV A;  3GYY A;  2XX9 A;  3MVX A;  2WYP A;  1SW4 A;  5AA2 A;  2FNC A;  4I62 A;  4PQJ A;  3VV5 A;  4GF8 A;  2Z23 A;  1B7U A;  2H99 A;  3HHF A;  5EYG A;  2XXY A;  2DWI A;  4PF8 A;  3PGF A;  2CMO A;  2Q89 A;  3E3K A;  3FJM A;  1VDW A;  4F39 A;  1NV7 A;  2XWO A;  3EPE A;  5EQ9 A;  5EQ8 A;  3MZ1 A;  3LC8 A;  3DLN A;  4GX6 A;  1N3X A;  1Y1Z A;  1LFI A;  1Y3N A;  3ISP A;  1NUX A;  3TTL A;  3KN8 A;  4IGR A;  3MP8 A;  5I2K A;  2ABH A;  2CZL A;  2G29 A;  2F36 A;  1LAG E;  1LST A;  2CEX A;  1PB9 A;  4JWO A;  3OEN A;  3IO4 A;  1AWB A;  5I59 A;  1DMB A;  4BDR A;  5ET7 A;  1NUW A;  3IO6 A;  1H44 A;  3R26 A;  1B7H A;  4XEQ A;  1QUJ A;  3C36 A;  3NOH A;  5LDZ A;  1FTO A;  2XXX A;  3RT6 B;  4EF2 A;  2I6E A;  3S9N C;  4P1E A;  4LP2 B;  3E13 X;  4FAJ A;  5K2X A;  4GBV A;  1NL5 A;  4BDO A;  4RYA A;  4EUO A;  2R71 A;  4LON B;  3RUM A;  2O7I A;  1FBF A;  1XOC A;  2XD3 A;  4P0I A;  1B4H A;  1FBG A;  3SEV A;  2OPE A;  3GXA A;  1SDX A;  2XXW A;  3C34 A;  1KZ8 A;  1JVY A;  3FVN A;  2ZZV A;  2PT2 A;  1QW0 A;  3B50 A;  3U1O A;  4LAT A;  3PUW E;  5I2N B;  5JEI A;  5CMM A;  3TZA A;  1IUD A;  4AQ4 A;  3VVE A;  4RJZ A;  1Y3Q A;  2AIX A;  2NWJ A;  2Y5L A;  2OJT A;  1D9Y A;  2GHA A;  1LBV A;  4HE2 A;  3MYU A;  2D21 A;  4N6K A;  4ZDM A;  2RKM A;  1D9V A;  5FHO A;  4THI A;  3PU5 A;  2V25 A;  2DVC A;  2E1S A;  1WOD A;  3RNN A;  4NF4 B;  5L9O A;  2H98 A;  1EZP A;  2PMS A;  1B58 A;  3O6H A;  1BIY A;  1NV1 A;  2D5W A;  3O2A A;  3TUS A;  4O7I A;  4LQ5 A;  3U65 A;  1MH3 A;  3FXU A;  5I7I A;  1KA0 A;  4BDN A;  2ZNT A;  1H76 A;  1QJM A;  2XXH A;  3RY3 A;  3HFU A;  1TFD A;  3EHT A;  4O3A A;  1MY2 A;  1B5J A;  1IMB A;  3CSB A;  1MM7 A;  4NQ8 A;  3CFZ A;  4C0R A;  2OWS A;  1AMF A;  5HPQ A;  1FPK A;  2V4C A;  2WEF A;  5H8N A;  3FJ7 A;  1EYI A;  4KYD A;  2L5V A;  2O51 A;  3TQL A;  2GRV A;  1YCJ A;  2REG A;  1LFG A;  2I0B A;  1OVT A;  1Z7M E;  3KZG A;  4F22 A;  1JET A;  4OFL A;  4N4U A;  1FJ6 A;  4H8I A;  1FTM A;  4XKN A;  1JW1 A;  3VXC A;  1R6Z A;  4LQ2 A;  4QHQ A;  2XX8 A;  1YAE A;  1YYZ A;  1OQG A;  3FXQ A;  1PDA A;  2O68 A;  1FQB A;  3T9X B;  3L6H A;  3UIF A;  5L9M A;  4UAB A;  2O69 A;  4NF6 B;  4IO7 A;  5A5L A;  1VR5 A;  5ET5 A;  3UA8 A;  1MXX A;  2CEY A;  4N81 A;  2F5X A;  4ZE8 A;  3KBZ A;  1HSL A;  1ZMG A;  3K6X A;  3PUX E;  2RCB A;  1IIT A;  3PPO A;  3WAE A;  1VFD A;  3LSL A;  1LBC A;  4QFN A;  4YZZ A;  4AS5 A;  5F1Q A;  4H45 A;  5IZ3 A;  2ZXT A;  5AE4 A;  4H5F A;  3TTK A;  4NF8 B;  4BLA A;  1MDP 1;  4FEB A;  1EZO A;  4NAP A;  2YLN A;  1WDN A;  2REJ A;  3E78 A;  4OZ9 A;  3L6G A;  3MPL A;  3K0V A;  3OEM A;  3TCF A;  4OVT A;  2V3T A;  2BJJ X;  4F3B A;  3FV2 A;  2QVU A;  4RK9 A;  1N0T A;  5KCJ B;  3K1M A;  3JV9 A;  4RPN A;  3UOR A;  3ILU B;  4IY6 A;  2XXT A;  4OVP A;  5ESY A;  2FVZ A;  2RIN A;  3RQT A;  3OSQ A;  4R73 A;  3FZV A;  1JVX A;  4H5G A;  2VD3 A;  5FBP A;  1B2H A;  2UYF A;  4KYE A;  4GWX A;  4YMB A;  2ONK E;  4GD5 A;  2NVU B;  2PYY A;  1I6B A;  2Q2A A;  4GWO A;  3K6U A;  1SYI A;  5A5X B;  1IMF A;  2Z8F A;  5DEX A;  2I48 A;  3B8B A;  3HHG A;  1TFA A;  1SD3 A;  3IOT A;  3LSF B;  3MQ9 A;  2I49 A;  3B6Q A;  5DYH A;  4MCO A;  5EYF A;  1DTG A;  3CFL A;  2H5Y A;  3H3G A;  1S50 A;  4DI3 D;  1Y9U A;  1MXV A;  2XXV A;  3BFU A;  2QPQ A;  1OMP A;  3MWB A;  4TOZ A;  2DXR A;  1FPG A;  2VGQ A;  3D4C A;  5AA2 D;  5F24 A;  4HE1 A;  3KC0 A;  4C1T A;  2ALU A;  1F9B A;  2I4B A;  2QVV A;  1B3L A;  4QFK A;  4PAI A;  1P1Q A;  3PPN A;  1XS5 A;  4GWS A;  5AA4 A;  2RCA A;  5BWJ A;  3T9H B;  1NV2 A;  1M5B A;  1A99 A;  1NI9 A;  3GLB A;  2F6G A;  2M8C A;  5H8H A;  4NN3 A;  4QSC A;  5ITO A;  2XX7 A;  1RKM A;  1QUK A;  4DXC A;  3FGS A;  4LN5 A;  2XA5 A;  4H65 A;  2WBB A;  3H4Z A;  2FIE A;  2AL4 A;  3W9V A;  4TLL B;  1MPC A;  4EXK A;  3VVD A;  1QUL A;  2Y84 A;  1EH3 A;  3Q27 A;  3FVG A;  4X48 A;  1MQH A;  1FBP A;  3RTW B;  1I6Q A;  4G68 B;  3K1N A;  2ZYM A;  2H25 A;  1I69 A;  4MIJ A;  5JK4 A;  5ITP A;  3C4M A;  1IXG A;  1B4Z A;  3KN7 A;  4ZEI A;  2F8D A;  3FVO A;  4X04 A;  4GBW A;  2F7B A;  4F1V A;  2NOO A;  1AH5 A;  1A40 A;  4YB7 A;  1Q9D A;  3MZB A;  2QMX A;  3ILT B;  1ZKB A;  3CVG A;  3TYH A;  4FED A;  2HXR A;  2CZK A;  5DTB A;  4PFI A;  4PFW A;  2QL3 A;  1Y3P A;  3VDF A;  2OWZ A;  4PAF A;  3GBA A;  1QVS A;  3TMG A;  5BUU A;  3HPI A;  1VE4 A;  4H6D A;  3M8U A;  2UVG A;  3IK6 B;  3W9W A;  3FUZ A;  5I58 B;  3SEW A;  1USY H;  2A5T B;  2F35 A;  1B3F A;  1N3W A;  1USY E;  4I1D A;  3R7X A;  5H8S A;  5EHS A;  2ZZW A;  3PUY E;  1LBX A;  5ELV A;  1NH7 A;  2P2A A;  3C32 A;  4OFO A;  2DWA A;  5AA2 B;  3A29 A;  2QJE A;  1FPE A;  3MJN A;  4DXB A;  4MHF A;  3C9H A;  1LAH E;  5EQ7 A;  3FV1 A;  4U4X A;  4MFI A;  3E4R A;  4NF5 A;  4XKR A;  5H8F A;  4ZEC A;  2DE3 A;  5I57 A;  4IO3 A;  2YJP A;  1NNF A;  4PP0 A;  1VFE A;  4IO5 A;  5M2V A;  4RA1 A;  1XVX A;  4EDP A;  3SZP A;  3IAZ A;  4EQB A;  4PDH A;  4ZS9 A;  2X26 A;  1LAX A;  3D1R A;  3K1P A;  1EYJ A;  1Q1K A;  5JTY A;  3DP4 A;  4EQ9 A;  3B6W A;  3T9U A;  1N04 A;  4FEC A;  2O1L A;  4QFO A;  2HPG A;  3TDJ A;  4RNS A;  3CG3 A;  4OET A;  1QKB A;  5I59 B;  4PDD A;  4KPT A;  3LBS A;  4ECF A;  1MXY A;  5I84 A;  4PGP A;  3G3K A;  5J1D A;  3V83 A;  4ELQ A;  3LUY A;  4MF3 A;  2ZYK A;  3SET A;  2ANJ A;  3GZG A;  4R6Y A;  2QRY A;  4PC9 A;  3K00 A;  3DM0 A;  3KGC A;  2F78 A;  3G3G A;  1MY4 A;  5B7D A;  3QK6 A;  4O3C A;  1MG1 A;  3EHS A;  2W7Y A;  2QS2 A;  3OO9 A;  5AA1 A;  2OCU A;  3THI A;  4PFR A;  2CZH A;  3K01 A;  2OK2 A;  3UGW A;  4R9G A;  5I56 B;  4R6K A;  3LUZ A;  1FPD A;  1LBY A;  4DDD A;  1XVY A;  5TP9 A;  4Q8R A;  5I3S A;  5K2Y A;  2P3V A;  1Y20 A;  3N5L A;  3DEL B;  5TU0 A;  3FJG A;  1XI6 A;  1FBE A;  3VXB A;  5CC2 A;  1POY 1;  2DP8 A;  3PV0 E;  4P1L A;  2HHM A;  2VT5 A;  4IGT A;  5ET8 A;  1FPB A;  3M3F A;  4N17 A;  1ATG A;  3ZSF A;  1LCT A;  1LB9 A;  2QSX A;  3RT8 A;  4ZE9 A;  4N91 A;  4KFQ A;  1S7Y A;  3O6I A;  2XXP A;  3RPW A;  3KJ7 A;  4GX3 A;  1IXI A;  2OX3 A;  2ONR A;  3KBR A;  2O84 X;  4U1Z A;  4PFB A;  4KCD A;  1US4 A;  2HAV A;  4PBQ A;  1FPF A;  4OQO A;  1IMA A;  4MNC A;  2FA7 A;  5CI5 A;  4F1Y A;  4XTC Q;  1NV5 A;  3AXF A;  3OO7 A;  4OER A;  2XXQ A;  3E9X A;  1ZIU A;  1P1W A;  4P56 A;  1B3E A;  5I2N A;  4Q30 B;  1XT8 A;  4ZEF A;  1TT1 A;  1NNT A;  2Y7R A;  3IFA A;  3LV0 A;  4MLV A;  1B3H A;  4N8G A;  1ELJ A;  2Y7I A;  3Q25 A;  3N94 A;  4PAK A;  1B6H A;  1P1O A;  2I0C A;  5H8N B;  2WYK A;  2ZMB A;  4R72 A;  2D3I A;  4JSO A;  2IA4 A;  2XWK A;  1POT A;  1OIB A;  4EQ7 A;  3PMX A;  4N07 A;  3IL1 B;  4EF1 A;  1UTH A;  4K3F A;  5J16 A;  3K2D A;  2FBP A;  5IKB A;  4OES A;  4C1U A;  3MVZ A;  1HSE A;  2I3V A;  4R2B A;  1EU8 A;  4OVJ A;  3DP6 A;  2DSF A;  2YPN A;  1PC3 A;  1QKA A;  4Q0C A;  4P47 A;  4F3G A;  2KR0 A;  1JEV A;  4DI4 B;  2Y5K A;  4KI0 E;  2FHY A;  3S4U A;  2FYI A;  3IB1 A;  2KLF A;  5ICQ A;  4GXA A;  1KWH A;  4ISU A;  1IEJ A;  4LUB A;  3TTR A;  1LAF E;  4LZ8 A;  4G77 A;  1TXF A;  3MST A;  2THI A;  2Z22 A;  5IGA A;  2ZYN A;  2GQ1 A;  2VOZ A;  4H67 A;  1GV8 A;  2P0S A;  3T96 B;  2V3U A;  4PTK A;  2NUV A;  3DP8 A;  4ZZE A;  2P3N A;  4GWU A;  5IZ1 A;  3ZS6 A;  1H43 A;  3Q29 A;  3B6T A;  4ONY A;  5B70 A;  2O6A A;  3ZKL A;  2HZL A;  1IXC A;  3CFX A;  3PUV E;  2HQ0 A;  4RK2 A;  4HTG A;  4MNI A;  1LB8 A;  1B32 A;  2Q8J A;  3OD7 A;  5H8Q A;  1PB8 A;  3G7W A;  2DWH A;  1DTZ A;  4IY5 A;  1URS A;  3MP6 A;  1SVX B;  1N7W A;  2DYX A;  1LGB C;  3S9L C;  5EHM A;  3TQW A;  4WKM A;  4G68 C;  3MVW A;  1IXH A;  1L5T A;  4OWD A;  4IO2 A;  1RYX A;  4OEV A;  1RDY A;  3WAF A;  2XHD A;  3E79 A;  1NNP A;  2XXK A;  4NX1 A;  5IAI A;  1FQA A;  3K6V A;  4NMY A;  4DCY A;  4N15 A;  1SI0 A;  4MX6 A;  5T3J A;  4HE0 A;  3PUZ E;  4GXS B;  4RPO A;  3H6T A;  4JB7 A;  1S9T A;  4YMA A;  4RY1 A;  1FBC A;  1ZBM A;  4JVC A;  3G3I A;  1URD A;  4MLQ A;  1M5D A;  1DSN A;  3TKD A;  4PBH A;  4O3B A;  4BDM A;  3VE1 B;  4ZEK A;  1ZLQ A;  3QYT A;  4XKP A;  3FXB A;  5AA4 B;  1YTV A;  3IJX B;  4R9F A;  5CBS A;  4ND9 A;  2F3B A;  3O9P A;  1Q35 A;  2I3W A;  5CMC A;  2GFE A;  1HSJ A;  4PFT A;  4R75 A;  2DS9 A;  2ZNS A;  2Y7P A;  1SW1 A;  4KHZ E;  3O66 A;  4H8J A;  1MQG A;  3UP9 A;  5HBC A;  3H6U A;  2Q8M A;  1SQY A;  4LZ5 A;  3T93 B;  4OYV A;  3C35 A;  5FHN A;  4ZED A;  5LTC A;  1LEV A;  2H9B A;  3VLV A;  3C31 A;  3OO8 A;  3FAS A;  1B40 A;  2ZYO A;  4AB6 A;  5FTI A;  4IO6 A;  3TTN A;  1AIV A;  1JEU A;  3U72 A;  3RTF B;  1FSA A;  3OEL A;  4IB2 A;  1D4N A;  3T9V A;  4YKK A;  2RC9 A;  1VSO A;  4JXI A;  3I3V A;  5CMB A;  2DDK A;  3RPL A;  1LBW A;  2PBW A;  2QS3 A;  1NUZ A;  3PPP A;  4ZEB A;  3PMV A;  2AL5 A;  3QXM A;  3P7I A;  4PE3 A;  4E0W A;  5IM2 A;  4ESX A;  2Z8D A;  3TPA A;  4PGN A;  2R8T A;  1DK4 A;  4G8M A;  1AL3 A;  3EF7 A;  2HAU A;  1G0I A;  3EHU A;  3IB0 A;  4XKQ A;  3KJT A; 
#chains in the Genus database with same CATH homology
 2JJK A;  4O7I A;  4PC9 A;  3U65 A;  1K9Z A;  1INP A;  4OVS A;  5I7I A;  1KA0 A;  5DW8 A;  3EKI A;  2XWI A;  5I5P A;  4OAN A;  3HFU A;  4OVQ A;  4PFR A;  1NV0 A;  2CZH A;  3KC1 A;  2V3Q A;  1IMD A;  1IMB A;  3FBP A;  3LUZ A;  4H46 A;  1FPD A;  4NQ8 A;  4JVD A;  1LBY A;  1RDZ A;  4XFE A;  5I3S A;  1FPK A;  4AS4 A;  2V4C A;  2WEF A;  1EYI A;  2L5V A;  2P3V A;  4F1U A;  4GWZ A;  1XI6 A;  1FBE A;  4N4U A;  1FJ6 A;  4P1L A;  1SPI A;  2HHM A;  2VT5 A;  3T1B A;  5ET8 A;  2FIX A;  4G61 A;  2Q9T A;  1FPB A;  1YYZ A;  4N17 A;  3RPL B;  4UAB A;  4HXV A;  4N91 A;  5A5L A;  2WBD A;  4MNP A;  5ET5 A;  4GX3 A;  4X8R A;  2OX3 A;  5EYH A;  2CEY A;  4N81 A;  2F5X A;  4PET A;  4F19 A;  3KBZ A;  4PFB A;  4P8B A;  2PFY A;  4PBQ A;  4XF5 A;  4YZZ A;  4AS5 A;  1FPF A;  1IMA A;  4H45 A;  4MNC A;  1FBH A;  5IZ3 A;  4P9K A;  3RYD A;  2VPN A;  1FRP A;  1NV5 A;  4GWW A;  1FPI A;  2QFL A;  4YIC A;  4NAP A;  5CM6 A;  4P56 A;  4OVR A;  3CHG A;  3E78 A;  2WX9 A;  2DE4 A;  4N8Y A;  4OVT A;  1CNQ A;  1DCU A;  3IFA A;  3LV0 A;  2QVU A;  2VPO A;  4N8G A;  2PCR A;  4I3E A;  4MAG A;  4X9T A;  2XWV A;  4PAK A;  1NV4 A;  4OVP A;  2F3D A;  5ESY A;  2FVZ A;  4NGU A;  4JVI A;  2KQZ A;  5FBP A;  2WYK A;  4MEV A;  4GWX A;  2XWK A;  4MJO A;  5EQA A;  2BJI A;  1D9Q A;  1IMF A;  1K9Y A;  2Q74 A;  5J16 A;  2FBP A;  3B8B A;  3QMF A;  1IME A;  4MMP A;  4NF0 A;  4MCO A;  2B4L A;  4DI3 D;  2QPQ A;  1FPL A;  4P47 A;  2KR0 A;  4O7M A;  4DI4 B;  2Y5K A;  2FHY A;  3IFC A;  1FPG A;  4GX4 A;  1KA1 A;  5F24 A;  1BK4 A;  4HE1 A;  5IZZ A;  5ET6 A;  3KC0 A;  1NUY A;  4HCY A;  4PCD A;  4PF6 A;  2B4M A;  2PFZ A;  3BIG A;  1JP4 A;  2QVV A;  4IR8 A;  2DE2 A;  4PAI A;  3MST A;  5IGA A;  4GWS A;  4QBA A;  1FPJ A;  4OA4 A;  2GQ1 A;  2QVR A;  1FBD A;  1NV2 A;  4I3Y A;  1NI9 A;  3BIH A;  4PTK A;  4P3L A;  2P3N A;  3GYY A;  4GWU A;  5IZ1 A;  2WYP A;  4NN3 A;  2DVZ A;  1NV6 A;  2HZL A;  3PTY A;  4LN5 A;  2XA5 A;  2WBB A;  1EYK A;  5EYG A;  4PF8 A;  2FIE A;  4HCW A;  4MNI A;  3W9V A;  1QGX A;  1VDW A;  1NV7 A;  2XWO A;  4O94 A;  1DBZ A;  5EQ9 A;  5EQ8 A;  1FBP A;  4GX6 A;  4MIJ A;  5JK4 A;  3ISP A;  1NUX A;  1RDY A;  2MKZ A;  3E79 A;  2XXK A;  4NX1 A;  4N15 A;  4N6D A;  2CEX A;  4X04 A;  4F18 A;  4MX6 A;  4GBW A;  1RDX A;  4F1V A;  1AWB A;  5T3J A;  4HE0 A;  1FJ9 A;  1Q9D A;  5ET7 A;  4QXD A;  1G0H A;  1NUW A;  1FBC A;  2HXR A;  2CZK A;  4JVC A;  4FBP A;  4XEQ A;  4PFI A;  3NOH A;  5LDZ A;  2CZI A;  2OWZ A;  4PAF A;  4PBH A;  4P1E A;  4GBV A;  3FXB A;  3W9W A;  2F3B A;  2ZZX A;  1FBF A;  2ZZW A;  1LBX A;  1YXI A;  5IZ3 B;  1FBG A;  2Q8M A;  3A29 A;  2HZK A;  3T0J A;  1KZ8 A;  1YZ0 A;  4I40 A;  1FPE A;  4KXP A;  4MHF A;  4O8M A;  2ZZV A;  1FTA A;  3B50 A;  5LTC A;  5EQ7 A;  1LEV A;  4GWY A;  4NG7 A;  1IMC A;  3ROJ A;  4M1V A;  2DE3 A;  1FSA A;  2Y5L A;  3SZP A;  1LBV A;  4HE2 A;  4PDH A;  3D1R A;  1NV3 A;  1EYJ A;  3MYU A;  2DDK A;  3RPL A;  1LBW A;  4N6K A;  1LBZ A;  1NUZ A;  2HPG A;  4PE3 A;  5IM2 A;  4PGN A;  2R8T A;  4PDD A;  1DK4 A;  4PGP A;  1G0I A;  5J1D A;  1NV1 A;  4NHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...