4HE1A

Crystal structure of human muscle fructose-1,6-bisphosphatase q32r mutant complex with fructose-6-phosphate and phosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
326
structure length
309
Chain Sequence
MLTLTRYVMEKGRQAKGTGELTRLLNSMLTAIKAISSAVRKAGLAKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 309
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he1A02
4MJOA 2DDKA 3A29A 4GWZA 2VT5A 4KXPA 1NI9A 1NUXA 2CZHA 1IMEA 1FBDA 2CZIA 1FJ9A 1CNQA 5I3SA 1IMCA 2FIEA 1EYJA 2FBPA 1DCUA 1NV5A 1K9ZA 3IFAA 3RPLB 4GWYA 1BK4A 4AS5A 3KC0A 1NV1A 1YXIA 5DW8A 2Q8MA 1DK4A 1FPKA 4GWXA 4FBPA 4HE2A 1FBEA 5ET8A 5ESYA 1FPLA 1FPIA 1KZ8A 2CZKA 1FSAA 2Y5KA 2Y5LA 2OX3A 1FJ6A 4GBVA 3LUZA 1NV0A 1NV4A 4HXVA 2FVZA 4QXDA 2P3NA 4H46A 5LDZA 4I3EA 1INPA 5EYGA 1FBGA 2OWZA 1LBYA 1FPBA 1LEVA 2Q74A 1LBVA 1NV7A 1LBWA 1RDXA 1SPIA 3BIHA 5J16A 3D1RA 1AWBA 2WEFA 3FBPA 4GX3A 1YZ0A 3QMFA 1NUYA 3RYDA 1G0IA 1Q9DA 4I40A 1KA0A 2JJKA 5EQAA 1FPFA 2PCRA 1EYKA 1NV6A 3LV0A 5EYHA 5T3JA 3KBZA 5ET5A 1KA1A 4GBWA 5EQ9A 1FBHA 2GQ1A 1DBZA 1FPGA 1LBXA 4IR8A 5ET6A 5IZ3A 3ROJA 1FBCA 2QVVA 4GWUA 2P3VA 1K9YA 2FHYA 1XI6A 1IMBA 4GWSA 1NUWA 5IZ3B 1JP4A 1FBPA 2WBBA 4I3YA 1FPEA 1LBZA 2QVUA 4HE0A 5FBPA 1NV2A 2QVRA 3B8BA 3KC1A 1VDWA 1IMFA 2F3BA 2R8TA 4GX6A 5ET7A 5EQ7A 4AS4A 1D9QA 1YYZA 2BJIA 1NV3A 1QGXA 4H45A 4HE1A 5F24A 5IZ1A 4O7IA 2FIXA 1FPJA 1RDYA 1IMAA 1EYIA 4GX4A 3RPLA 3T0JA 1RDZA 2QFLA 5A5LA 2HHMA 1FBFA 2WBDA 4PTKA 5EQ8A 1FRPA 2F3DA 3BIGA 1NUZA 4G61A 4GWWA 1G0HA 1FTAA 4N81A 3IFCA 1FPDA 1IMDA
chains in the Genus database with same CATH superfamily
5DVFA 3VDFA 5TP9B 2A5SA 4TQUQ 4WEDA 1OVTA 3VXCA 1IMCA 4RK9A 4YMAA 1EYJA 3PUXE 5DEXA 1P1QA 4UA8A 2XWKA 3T22A 4GXAA 4R6HA 1TT1A 1ATGA 5AA2B 1O7TA 3FJ7A 4I9DA 4KCDA 1NL5A 4KHZE 4QSCA 3CFXA 5ISUA 1MY3A 1IIWA 1LBWA 3L6GA 5ITOA 3FBPA 4YICA 2XWIA 4GWOA 3N6TA 4NF5B 1KA0A 4MFIA 5EQAA 4NF0A 2GH9A 2DXRA 3TDJA 4EF2A 3TUSA 3HFUA 1FPGA 1UTHB 4THIA 1FBPA 4GRKA 2FYIA 3F11A 5DYHA 5FTHA 4JSDA 2QVRA 4BDRA 5ET7A 1B3HA 4QFOA 5EHMA 3OO9A 3K6XA 1LSTA 3TTNA 3T9XB 3CVGA 2WBDA 4QF9A 2V25A 1ZJLA 5L9OA 4IO4A 2DDKA 2XXHA 5K2YA 1R1NA 3W9WA 2UYFA 2HZKA 1NI9A 4OENA 3RQTA 5CI5A 4LONB 5ICQA 3Q25A 3VXBA 4UACA 2O1LA 1K9ZA 2Z8EA 4OEUA 2HQ0A 4N6PA 2XD3A 1NV1A 3TTLA 5JTYA 4YU0A 2D5WA 1FBEA 5CMBA 1VFDA 3OXNA 1DTZA 1LLSA 2O7UA 3K00A 2OWZA 2UVIA 1P1OA 3R6UA 3MJNA 4RJZA 1MM6A 2XXTA 5J16A 4PGPA 1B4ZA 1DSNA 3S9NC 1TFAA 1I6BA 4MF3A 1N76A 2OLBA 2XWVA 2MKZA 1AH5A 2L5VA 3S9MC 4NE4A 4OANA 4QBAA 1WDNA 4OYVA 5ET6A 4XKRA 1IMBA 4C1TA 2O7IA 4LN5A 3M8UA 4N8YA 4F22A 4KFQA 3UORA 3PUZE 2R8TA 2CEXA 2QS2A 4H45A 2FIXA 2OK2A 3PUWE 1FPJA 5HPQA 3HSTA 1FTMA 1TWYA 2HHMA 2REJA 1ELJA 1B51A 3OD7A 3RTFB 3T66A 1JEVA 1LCTA 1MM7A 1Y3QA 1DMBA 1UTBA 1I6QA 4YB6A 3O29A 4LQ2A 3FGSA 2H99A 3H4ZA 3KZGA 3UIFA 1MRPA 4KYSA 4MX6A 3KFMA 1B4HA 2R71A 4EQ7A 1YXIA 2REGA 3O6GA 4GWXA 4XKQA 5AA3A 2PFYA 2Z22A 2H25A 3VE1B 3D4CA 4JB7A 1LFHA 1FW0A 1AIVA 1XHYA 3E4RA 3H3GA 5B7DA 2Q74A 3H03A 5DT6A 4OVQA 1YZ0A 3U65A 1JVXA 2QSXA 5JK4A 3KBZA 1P1UA 1I69A 4ZEBA 2LAOA 1DBZA 3SEWA 4ZS9A 4GF8A 5IZ3A 2HXRA 4PFUA 2F97A 2I3VA 2QMXA 4X04A 2Y7PA 4F2OA 3QAXA 3L6HA 2XXWA 5EQ7A 2I58A 3DP8A 1NNFA 2F7AA 2V3UA 1RDYA 1PB9A 4XTCQ 2F78A 3QSLA 4RNSA 1PB7A 5H8QA 1R9LA 4GIZA 1FTAA 3IFCA 4RK2A 5F7VA 4NWCA 5ICTA 2ZXTA 4PP0A 2Q8JA 4I1DA 1DPEA 1IITA 4JWXA 5TPAB 3KN8A 1VR5A 4NGUA 1MDQA 4YKPA 4DCYA 1N84A 5DTBA 4NF8B 1FSAA 1QUJA 4YB7A 1FTLA 3TELA 1NV0A 3CRBA 3ILUB 4I3EA 1MQHA 4GFRA 1ZIUA 2A5TB 4X1DA 1LBBA 5H8HA 3MQ9A 1POY1 5JEIA 5KCJA 4EQBA 4EXLA 1PBQA 3B6QA 4UABA 4BDQA 3K02A 2P1SA 5J1DA 1NNKA 1NNTA 2Z23A 2ZNSA 5I2KA 1Y3PA 1SYHA 2R9JA 4G2ZA 4F18A 2DE4A 2F6PA 4F3PA 1LCFA 2I0BA 4MLQA 2XXYA 2F3BA 1B58A 4JBZA 1MXWA 3DM0A 1OVBA 2HPGA 3T9UA 4PAFA 3Q26A 4BDMA 3PPNA 3KN3A 4FE8A 2F8DA 3MSTA 5IM2A 4ELPA 1USYH 3FVGA 3HV1A 1RKMA 4ZDMA 4MMPA 2OZZA 5I57A 1OIBA 2XXRA 3EKIA 4OHNA 4M4GA 4OMBA 1SBPA 4YKJA 5HBCA 4PFIA 1LAHE 3CIJA 3VFJA 1Y20A 1NUXA 4F31B 2DS9A 1EZOA 1CNQA 3MUQA 3PD9A 1QJMA 3DLNA 1NV5A 1LFIA 3C34A 1AL3A 3EHUA 1F9BA 4LVQA 1PC3A 2Q8MA 3LSLA 3KOSA 5ESYA 2I49A 2Y5LA 4YKKA 1B1HA 3ZKKA 4N6DA 4H46A 4TOZA 5EYGA 1IQ7A 3K1MA 5K2XA 3PD8A 3NOHA 3V8XB 3OO6A 1EYKA 4H8JA 4PQJA 5ET5A 1CB6A 2Q88A 3O97A 4ONYA 4NF4B 3MW0A 4GXSB 4OEVA 3O6IA 2Q89A 4MNIA 1IXIA 4AS4A 2Y7WA 2I4CA 2DWIA 3TODA 3PPPA 3VLUA 1EU8A 1Z7NE 3V5AA 2HEUA 2XD2A 1D9VA 5AA2A 4KI0E 1Q35A 4LZ5A 2VP1A 3KN7A 1G0HA 1N3WA 2PT1A 3GLBA 1B6HA 1IZ1A 3I5OA 1GTKA 3WAEA 1URDA 1R9QA 4MCOA 1QUKA 3FIRA 3HPIA 2E0SA 3PGFA 3SDFA 4F2QA 1B7UA 4DIGA 3RLFE 4U1ZA 4AS5A 2IA4A 1Y1ZA 2GHAA 3Q28A 2XXQA 1SI1A 4N13A 3SERA 4G8HA 3TZAA 1US4A 4AQ4A 3A3UA 3O66A 3MZ1A 3LUZA 2RKMA 1B05A 1UTHA 3FD3A 3SEXA 4FECA 4ZEKA 1LBYA 1PBPA 1B5JA 3QYTA 3ODBA 4DI4B 3O6HA 3UP9A 1MXXA 1A7LA 2ONSA 1VE4A 3BIHA 3R7XA 1A40A 4P9KA 3D1RA 3AXFA 4OVPA 5AA4B 3K0VA 3RYDA 4Z7EA 2JJKA 4IO7A 1Y4CA 1SD3A 4XFEA 4ZE9A 3UN6A 2ABHA 2WKYA 2QRYA 5I84A 2XXPA 3IORA 3IAZA 1FBCA 1B9JA 4GWUA 2P3VA 4OVTA 1NUWA 4F29A 1XT8A 3CG1A 2ANJA 4DXUA 2DWAA 4ZZAA 4FIMA 2DVCA 1I6AA 2H5YA 3R26A 4H65A 4QSEA 3KJTA 5A5XA 1RDZA 3MP8A 2OWTA 2Y7IA 4OESA 4PTKA 4FORA 1SW5A 2RF1A 2PYYA 5CC2A 3BIGA 3RTWB 1YAEA 3UA8A 4GWWA 3SEYA 5LOMA 4JSOA 3KBRA 4GWZA 3RY3A 1GR2A 3ZSFA 2FIEA 2FBPA 4LQ5A 4N4UA 4NAPA 3G7WA 3K6VA 1HSEA 1EZ9A 3CG3A 3PU5A 1JW5A 2KQZA 2XXVA 3Q29A 4WEPA 1N0TA 4YKIA 4AB5A 3TCFA 4XIGQ 3ISPA 1O64A 1A8FA 1ZBMA 5FHOA 4JDFA 4RYAA 2ZZXA 3I6VA 1EZPA 2PFZA 3S9LC 2HCAA 2PBWA 1NMUA 4ECFA 4TLMB 3IB0A 3MPKA 2OCUA 3N6UA 5I7IA 2PCRA 5T3JA 5EHSA 5EYHA 2F36A 1H76A 1XS5A 2QS1A 1FBHA 3FATA 1B52A 4IR8A 5EYFA 1YPNA 3ROJA 1XI6A 3TKDA 5I58B 4I3YA 3MAMA 2Z8FA 3B50A 3VLVA 1LB9A 3FASA 3CSBA 5CRYA 3PPQA 4IY6A 1B3GA 3K6WA 2D21A 3PPRA 3G3JA 2YJPA 2XX9A 4M1VA 5IAIA 4EQ9A 1LFGA 3Q27A 4NQ8A 1L5TA 1NFTA 4LUBA 2R6GE 1B0HA 4GVOA 4QFNA 4NTLA 3LC8A 2ZYMA 3HHFA 4WXJA 1B5HA 1LAGE 1B1XA 2XXUA 1FJ9A 3KSXA 3G3IA 4OETA 3A09A 2Q9TA 3HO7A 3FJGA 3QK6A 2B4MA 4EF1A 3RPLB 3MVWA 3HHGA 5I56A 2F34A 5JTYB 2NVUB 1XC1A 1KZ8A 2HFBA 1II5A 4ZZEA 5I59A 3FUZA 3O28A 3VVEA 4HXVA 4NF6B 3U93A 1INPA 1IXCA 1R6ZA 1FBGA 4LZ8A 4H5GA 4O7MA 1US5A 3K4UA 1QKBA 3W9VA 2NUVA 4KYDA 4QFKA 4BDOA 5I2NA 3B7DA 4PF6A 4P8BA 4BDNA 3OO8A 1G0IA 3LV0A 2KR0A 1Q1KA 4P1LA 3EN3A 5CMMA 2GQ1A 3FXRA 3IK6B 1N7XA 3CFLA 3CFZA 2QVVA 4FEDA 1JEUA 3RT8A 2I48A 1MXYA 4DCXA 3SEUA 1LBZA 4LZ7A 4RXLA 5FHMA 1IMFA 2G93A 4HCYA 1YYZA 2BJIA 4IO5A 1NV3A 5H8NB 3MVXA 4EXKA 5CBSA 4OFJA 1ANFA 3HN0A 4H1XA 3DP4A 4GQOA 1EYIA 3U94A 4RPOA 1FTKA 4HTGA 3ONMA 4P47A 4GL8A 1SW4A 3IJXB 2I3WA 1S7YA 4MJOA 4YZZA 4R9GA 1NH7A 2O1MA 2YLNA 2ZMBA 2F5XA 2CZHA 1Z7ME 2CZIA 2HAUA 4PFBA 2M8CA 2OPDA 3IL1B 1BK4A 4G8MA 3OELA 1DK4A 1DPPA 2XA5A 3MP6A 3TMGA 1FPLA 2BJJX 1H44A 4X1BA 4PFRA 2OX3A 5CMCA 1ZTYA 5KDTA 1NKXA 4OQOA 4IO3A 3T9VA 2F7CA 3U1OA 1UIVA 3ECRA 2P2AA 4ESWA 4PETA 1MY4A 2ALUA 4MBPA 2QJEA 3T93B 4R74A 4F1YA 1PDAA 4OFOA 4P3LA 4IB2A 2V84A 4QSDA 3M3KA 3OMBA 3GBBA 4Q8RA 3KGCA 3KOTA 3PV0E 5I5PA 1Y3NA 1ZU0A 4F1VA 5H8FB 3FXUA 2FHYA 5IZ3B 1B7HA 1SI0A 3IO6A 3SZPA 2WX9A 4H6DA 1B40A 5H8SA 3KC1A 2FNCA 1H3DA 5IZ1A 3PMWA 1BP5A 2UVGA 3B6TA 1FCKA 3SESA 4GX4A 1MPDA 3IOTA 4FAJA 4YMBA 1AOVA 3EQ1A 2OPEA 4PBQA 5AA2D 1IMDA 3C36A 1DTGA 2RINA 4OXVA 4ESXA 3PUYE 3A29A 2XWOA 4DZ1A 4LA9A 3TQWA 3TTRA 3HCQA 3TAJA 4H67A 3VLWA 1A55A 1B3LA 3IOWA 3SKPA 2B4LA 3FZVA 1FTOA 5F1QA 1MXUA 4ELOA 3LBSA 3KC0A 3H6UA 1MQGA 1FPKA 4H0WA 3USDA 3K6UA 4QFLA 2Y5KA 4ZEDA 2XXKA 4OZ9A 3UK4A 1M5BA 2O84X 3T1BA 3TQLA 4I62A 1B2HA 1LEVA 5TU0A 5H8HB 4FEBA 3FVKA 1NV7A 3GZGA 2ZNUA 1P1WA 5BWJA 5KCJB 3CI8A 1DOTA 1SQYA 2V4CA 3FJMA 1Q9DA 5M2VA 3C31A 2O69A 1M5EA 1A54A 3A3CA 1MQIA 2GRVA 1TXFA 2ESNA 2QL3A 4DLDA 1ZMGA 3V83A 2UXAA 2WYPA 3O2AA 3TFLA 3M3LA 2HAVA 4PE5B 3U8QA 5F24A 3MBPA 2KLFA 3RGYA 3WAFA 2ZZWA 2I0CA 1IMAA 1SW2A 2THIA 3FV1A 4G61A 1URGA 3V89B 3RUMA 5TP9A 1MH4A 1IXHA 4Q5TA 3IJOB 1IMEA 4MIJA 4JVIA 1A8EA 4U23A 2DYXA 3GYYA 1HSJA 4R9FA 4KYEA 4PFYA 1LAFE 2O6AA 4P56A 3TCGA 3OENA 5AA4A 1LAXA 4JXIA 3O9PA 3C33A 4R73A 4POXA 4NN3A 2NXOA 2V93A 1FJ6A 1B3EA 1IEJA 2RCAA 3U92A 3MVYA 5LDZA 1N7WA 4X8RA 1JW1A 1LBVA 2E1SA 4G4PA 1AWBA 4NF5A 3OEMA 3QIMA 5L9SA 2XX8A 4I40A 2PMSA 1FPFA 1RYXA 3P7IA 4GLIA 2DWJA 1Y1MA 1XVXA 1J1NA 3IO4A 4N15A 3C4MA 4RA1A 5DVIA 3D4GA 1JP4A 4R72A 4AB6A 5AE4A 3PMXA 2FA7A 4X9TA 4U2RA 1FQFA 1MDP1 4KQPA 3LSWA 4R2BA 5A5LA 2DE2A 3C35A 5CBRA 4OVJA 3H6VA 1D3KA 4MEVA 2XX7A 2ZYKA 5IKBA 4E0XA 5L9MA 4N81A 5FTIA 4IO6A 2AYSA 1OLCA 3E13X 3ZKLA 4KXPA 5CM6A 1B7ZA 2Q2AA 4N91A 1FQBA 1FBDA 4U21A 3ZS6A 2UYEA 1KWHA 1JETA 1WVJA 1CE2A 4ZEIA 4DI3D 4G68B 2CZKA 1MY2A 4OERA 3LSFB 5IGAA 2FVZA 4FATA 3U72A 1PEBA 4YAHX 1ZLQA 3E3KA 5I58A 3C32A 3EHTA 5DEXB 4K3FA 1JNFA 1SPIA 2QS4A 3RT6B 2XXIA 2DP8A 1M5CA 4OVSA 3QMFA 1NV6A 4IO2A 4GL0A 4JWYA 2VD3A 4X48A 2WYKA 1B0LA 2ONRA 4O3CA 2RCBA 3OSQA 1MXVA 4NEDA 1SDXA 2I4BA 4POWA 3KSJA 1QULA 2RC9A 4GWSA 3VVDA 4DDDA 3IR1A 5L8DA 3T96B 4F19A 3JYRA 5CMKA 4ELRA 4XF5A 3K1PA 2DOJA 2Y7RA 1SVXB 4O7IA 3QUJA 3B6WA 4QRZA 4F39A 3RPLA 3N94A 4G8NA 2VD2A 5FHNA 4RY1A 4BLAA 1YTVA 3G3HA 2HXWA 5A5XB 1O63A 1NUZA 3JZJA 3PMVA 4ZECA 2VGQA 3H6WA 1FPDA 2ZYNA 3TYHA 4NF6A 2HZLA 1NNPA 2O51A 3QXMA 3BKIB 2PT2A 3MPLA 4H8IA 4P0GA 2VHAA 2OBGA 3H7MA 4GWYA 1YCJA 4IY5A 1LBCA 4KR5A 2ZYOA 3E9XA 4EDPA 2H4IA 4P0IA 3MZ9A 3OSRA 4PCDA 4DE8A 1N3XA 4G68C 4DXCA 2AL4A 3K01A 1NH8A 4OTEA 1BIYA 4OVRA 2DXYA 2Y7KA 1S50A 2XXXA 3CHGA 4JWOA 1MXZA 5H8NA 1ZKBA 1GV8A 1MG1A 4U22A 1S9TA 1KA1A 4GBWA 5EQ9A 3PUVE 3MZBA 5ITPA 1IUDA 5DVJA 1JQFA 2YPNA 2RC8A 1K9YA 1LGBC 4ZEFA 3S4UA 4XKPA 2P0SA 2QVUA 3G3KA 3PPOA 1WODA 5BUUA 2O68A 4NX1A 4N07A 4OA4A 4PFTA 3W15C 1QGXA 1B5IA 2X26A 3TEPA 3FVNA 3BFTA 1OMPA 1RYOA 1B46A 1T0KA 3LR1A 1JVYA 2QFLA 4KD5A 1BTJA 2VPOA 1D9YA 3GXAA 2F7BA 2OWSA 2GHBA 4WKMA 3S2VA 3EPEA 3GBAA 1OQGA 3MYUA 1A99A 1QW0A 1UQWA 2X7QA 4OFLA 4FJPA 3VVFA 1HSLA 3CR9A 3RPWA 3G3FA 5I3SA 4HCWA 4IGRA 5TPAA 1LB8A 3MC2A 4I8CA 3IOVA 3KEIA 2NOOA 5DW8A 3G3GA 1IXGA 4L17A 4FBPA 4HE2A 4MH5A 5I56B 2V3TA 4NF8A 1UTBB 4RPNA 1P1NA 4PAKA 4P1EA 1FPIA 3VV5A 4LP2B 3CSGA 3N26A 4GBVA 4F3GA 4F1UA 5H8FA 2CZLA 5I59B 1M5FA 2F6GA 3ILTB 2A5TA 1USYE 2CMOA 1FPBA 2DE3A 4MAGA 3EHSA 4H5FA 3BBRA 3BFUA 3IB2A 5I2NB 1P99A 4NG7A 1QKAA 3N5LA 3QUFA 1B3FA 4ZE8A 2D3IA 3RN8A 3C9HA 1JW4A 5KZTA 1MPBA 3DP6A 1MPCA 4OWDA 2QMWA 1OQHA 4HE0A 5FBPA 3B8BA 4MLVA 4GX6A 3FXBA 4ISUA 4O8MA 4KCCA 4G77A 4HS7A 4PAIA 2QPQA 1FBFA 2F3DA 1TFDA 3RNNA 4PDHA 1MQJA 4O3AA 3TCHA 2H98A 1N04A 2VT5A 1PB8A 1VFEA 2ZNTA 4F3SA 1DCUA 2XHDA 2NWJA 4JVCA 3TPAA 4O3BA 4Z0IA 4NWDA 4R6YA 1MS7A 4U1OA 3S9EA 5H8QB 5ET8A 2QS3A 4LATA 1XOCA 4MNCA 3KJ7A 3IX1A 3H6TA 4IGTA 4R2FA 1FQEA 2PX1A 1POTA 4QXDA 2P3NA 5KDTB 4DXBA 3MP1A 4HW8A 4PDDA 1URSA 3E78A 4N8GA 3IB1A 1MH3A 2I6EA 5IZZA 2F35A 2DVZA 3I3VA 1OLAA 1NUYA 4JVDA 4PBHA 4PFWA 4C0RA 5AA1A 4GOTA 1MY1A 2AL5A 2H9BA 2UVJA 4ELQA 2UVHA 4XXUA 3THIA 4Q0CA 4GD5A 4YB5A 4NF4A 2B65A 2ZZVA 3PTYA 1FPEA 2DWHA 5ELVA 1GVCA 4E0WA 2V3QA 4NMYA 2G29A 4PE3A 1QVSA 4HE1A 2CEYA 3H06B 3FVOA 1XVYA 3OEKA 3DELB 5I2KB 2RC7A 4MHFA 4C1UA 2X7PA 2AIXA 5EQ8A 1FRPA 4NHBA 2GFEA 1FQAA 1H43A 2W7YA 3TTKA 1FTJA 3UGWA 1MQDA 4N17A 3TTMA 1D4NA 4XKNA 3EF7A 4TLLB 1H45A 4O94A 1Y9UA 3IFAA 3IOUA 3KG2A 2Z8DA 1QUIA 4PC9A 3MVZA 1BLFA 2B3BA 1SW1A 5I57B 3OOAA 4F3BA 3K2DA 4QFPA 2DQVA 1NV4A 1SYIA 2VOZA 1MY0A 4ND9A 3SETA 1M5DA 1Y4TA 4Q30B 2ONKE 4P11A 4BDLA 2B3FA 3T9HB 4PF8A 2OJTA 1RDXA 3LSXA 2PVUA 1GGGA 2WEFA 4GX3A 4EUOA 1FQCA 3OO7A 4N6KA 3JV9A 4R6KA 5B70A 1LBXA 4U4SA 4MNPA 2WBBA 4U4XA 3FV2A 3K1NA 1NV2A 2Y84A 2VPNA 4PGNA 3MWBA 1VDWA 4QHQA 1VSOA 1D9QA 5LTCA 1FQDA 4R75A 4XEQA 3M3FA 3FXQA 3T0JA 2DSFA 1AMFA 1UIUA 1B32A 4KPTA 3SEVA 5HM4B 3LUYA 2IEEA 3E79A 4G68A 1EH3A 2Q2CA 1BKAA
chains in the Genus database with same CATH topology
4MJOA 4YZZA 3EKIA 4PFIA 2HZLA 1NUXA 2F5XA 2CZHA 2CZIA 1CNQA 1IMCA 1EYJA 1NV5A 4PFBA 2XWKA 4GWYA 1BK4A 2Q8MA 1DK4A 5ESYA 2XA5A 1FPLA 2Y5LA 4PFRA 2OX3A 4PCDA 4N6DA 4H46A 5EYGA 4OVRA 4PETA 1LBWA 3CHGA 3FBPA 4P3LA 4YICA 2XWIA 3NOHA 1KA0A 5EQAA 1EYKA 5I5PA 4NF0A 5ET5A 1KA1A 4GBWA 5EQ9A 4F1VA 3HFUA 1FPGA 1K9YA 2FHYA 5IZ3B 1FBPA 2QVUA 2QVRA 3SZPA 2WX9A 4NX1A 4MNIA 3KC1A 5ET7A 4AS4A 4OA4A 1QGXA 5IZ1A 4GX4A 2QFLA 2VPOA 2WBDA 1G0HA 4PBQA 1IMDA 3MYUA 2DDKA 3A29A 2XWOA 3W9WA 2HZKA 4MCOA 1NI9A 5I3SA 4HCWA 2B4LA 1K9ZA 4AS5A 3KC0A 1NV1A 5DW8A 1FPKA 4FBPA 4HE2A 1FBEA 4PAKA 4P1EA 1FPIA 2Y5KA 4GBVA 4F1UA 3LUZA 2XXKA 2OWZA 1LBYA 1FPBA 3T1BA 4DI4B 2DE3A 4MAGA 1LEVA 1NV7A 3BIHA 5J16A 4PGPA 4P9KA 3D1RA 4OVPA 2V4CA 4NG7A 3RYDA 1Q9DA 2XWVA 2JJKA 2MKZA 4XFEA 2L5VA 4OANA 4QBAA 5ET6A 1FBCA 4GWUA 2P3VA 4OVTA 1IMBA 1NUWA 4LN5A 4HE0A 5FBPA 4N8YA 3B8BA 2WYPA 4GX6A 2R8TA 3FXBA 2CEXA 4O8MA 5F24A 4H45A 2FIXA 1FPJA 2ZZWA 1IMAA 1RDZA 4PAIA 2HHMA 2QPQA 1FBFA 4PTKA 2F3DA 3BIGA 4G61A 4GWWA 4PDHA 4GWZA 2VT5A 1IMEA 4MIJA 4JVIA 2FIEA 2FBPA 1DCUA 4NAPA 4N4UA 4MX6A 4JVCA 3GYYA 1YXIA 4P56A 4GWXA 5ET8A 2PFYA 2KQZA 4NN3A 4MNCA 1FJ6A 3ISPA 4QXDA 2P3NA 5LDZA 4X8RA 4PDDA 3E78A 4N8GA 2ZZXA 2Q74A 2PFZA 1LBVA 5IZZA 2DVZA 4OVQA 1AWBA 1YZ0A 3U65A 1NUYA 4JVDA 4PBHA 4I40A 5I7IA 5JK4A 1FPFA 2PCRA 5T3JA 5EYHA 3KBZA 1FBHA 1DBZA 4N15A 4IR8A 5IZ3A 3ROJA 2HXRA 2ZZVA 4X04A 1XI6A 1JP4A 3PTYA 4I3YA 1FPEA 3B50A 4X9TA 2V3QA 5EQ7A 4PE3A 4HE1A 2CEYA 1RDYA 5A5LA 4MHFA 2DE2A 4M1VA 4MEVA 5EQ8A 1FRPA 4NHBA 4NQ8A 1FTAA 4N81A 3IFCA 4KXPA 4N17A 5CM6A 4N91A 1FBDA 1FJ9A 4O94A 2Q9TA 3IFAA 2B4MA 4NGUA 3RPLB 4PC9A 4DI3D 1KZ8A 2CZKA 1FSAA 1NV0A 1NV4A 4HXVA 5IGAA 2FVZA 4I3EA 1INPA 1FBGA 4O7MA 3W9VA 4PF8A 1SPIA 1RDXA 4PF6A 4UABA 4P8BA 2WEFA 4GX3A 4OVSA 3QMFA 5J1DA 1G0IA 3LV0A 2KR0A 1NV6A 4N6KA 4P1LA 2WYKA 2GQ1A 4F18A 1LBXA 2DE4A 4MNPA 2QVVA 4GWSA 2WBBA 1LBZA 1NV2A 4F19A 2VPNA 4PGNA 1VDWA 1IMFA 2F3BA 4HCYA 1D9QA 1YYZA 2BJIA 4XF5A 5LTCA 1NV3A 4O7IA 2HPGA 4XEQA 1EYIA 4PAFA 3RPLA 3T0JA 3MSTA 5IM2A 4P47A 1NUZA 4MMPA 3E79A 1FPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJO A;  2DDK A;  3A29 A;  4GWZ A;  2VT5 A;  4KXP A;  1NI9 A;  1NUX A;  2CZH A;  1IME A;  1FBD A;  2CZI A;  1FJ9 A;  1CNQ A;  5I3S A;  1IMC A;  2FIE A;  1EYJ A;  2FBP A;  1DCU A;  1NV5 A;  1K9Z A;  3IFA A;  3RPL B;  4GWY A;  1BK4 A;  4AS5 A;  3KC0 A;  1NV1 A;  1YXI A;  5DW8 A;  2Q8M A;  1DK4 A;  1FPK A;  4GWX A;  4FBP A;  4HE2 A;  1FBE A;  5ET8 A;  5ESY A;  1FPL A;  1FPI A;  1KZ8 A;  2CZK A;  1FSA A;  2Y5K A;  2Y5L A;  2OX3 A;  1FJ6 A;  4GBV A;  3LUZ A;  1NV0 A;  1NV4 A;  4HXV A;  2FVZ A;  4QXD A;  2P3N A;  4H46 A;  5LDZ A;  4I3E A;  1INP A;  5EYG A;  1FBG A;  2OWZ A;  1LBY A;  1FPB A;  1LEV A;  2Q74 A;  1LBV A;  1NV7 A;  1LBW A;  1RDX A;  1SPI A;  3BIH A;  5J16 A;  3D1R A;  1AWB A;  2WEF A;  3FBP A;  4GX3 A;  1YZ0 A;  3QMF A;  1NUY A;  3RYD A;  1G0I A;  1Q9D A;  4I40 A;  1KA0 A;  2JJK A;  5EQA A;  1FPF A;  2PCR A;  1EYK A;  1NV6 A;  3LV0 A;  5EYH A;  5T3J A;  3KBZ A;  5ET5 A;  1KA1 A;  4GBW A;  5EQ9 A;  1FBH A;  2GQ1 A;  1DBZ A;  1FPG A;  1LBX A;  4IR8 A;  5ET6 A;  5IZ3 A;  3ROJ A;  1FBC A;  2QVV A;  4GWU A;  2P3V A;  1K9Y A;  2FHY A;  1XI6 A;  1IMB A;  4GWS A;  1NUW A;  5IZ3 B;  1JP4 A;  1FBP A;  2WBB A;  4I3Y A;  1FPE A;  1LBZ A;  2QVU A;  4HE0 A;  5FBP A;  1NV2 A;  2QVR A;  3B8B A;  3KC1 A;  1VDW A;  1IMF A;  2F3B A;  2R8T A;  4GX6 A;  5ET7 A;  5EQ7 A;  4AS4 A;  1D9Q A;  1YYZ A;  2BJI A;  1NV3 A;  1QGX A;  4H45 A;  4HE1 A;  5F24 A;  5IZ1 A;  4O7I A;  2FIX A;  1FPJ A;  1RDY A;  1IMA A;  1EYI A;  4GX4 A;  3RPL A;  3T0J A;  1RDZ A;  2QFL A;  5A5L A;  2HHM A;  1FBF A;  2WBD A;  4PTK A;  5EQ8 A;  1FRP A;  2F3D A;  3BIG A;  1NUZ A;  4G61 A;  4GWW A;  1G0H A;  1FTA A;  4N81 A;  3IFC A;  1FPD A;  1IMD A; 
#chains in the Genus database with same CATH topology
 5DVF A;  3VDF A;  5TP9 B;  2A5S A;  4TQU Q;  4WED A;  1OVT A;  3VXC A;  1IMC A;  4RK9 A;  4YMA A;  1EYJ A;  3PUX E;  5DEX A;  1P1Q A;  4UA8 A;  2XWK A;  3T22 A;  4GXA A;  4R6H A;  1TT1 A;  1ATG A;  5AA2 B;  1O7T A;  3FJ7 A;  4I9D A;  4KCD A;  1NL5 A;  4KHZ E;  4QSC A;  3CFX A;  5ISU A;  1MY3 A;  1IIW A;  1LBW A;  3L6G A;  5ITO A;  3FBP A;  4YIC A;  2XWI A;  4GWO A;  3N6T A;  4NF5 B;  1KA0 A;  4MFI A;  5EQA A;  4NF0 A;  2GH9 A;  2DXR A;  3TDJ A;  4EF2 A;  3TUS A;  3HFU A;  1FPG A;  1UTH B;  4THI A;  1FBP A;  4GRK A;  2FYI A;  3F11 A;  5DYH A;  5FTH A;  4JSD A;  2QVR A;  4BDR A;  5ET7 A;  1B3H A;  4QFO A;  5EHM A;  3OO9 A;  3K6X A;  1LST A;  3TTN A;  3T9X B;  3CVG A;  2WBD A;  4QF9 A;  2V25 A;  1ZJL A;  5L9O A;  4IO4 A;  2DDK A;  2XXH A;  5K2Y A;  1R1N A;  3W9W A;  2UYF A;  2HZK A;  1NI9 A;  4OEN A;  3RQT A;  5CI5 A;  4LON B;  5ICQ A;  3Q25 A;  3VXB A;  4UAC A;  2O1L A;  1K9Z A;  2Z8E A;  4OEU A;  2HQ0 A;  4N6P A;  2XD3 A;  1NV1 A;  3TTL A;  5JTY A;  4YU0 A;  2D5W A;  1FBE A;  5CMB A;  1VFD A;  3OXN A;  1DTZ A;  1LLS A;  2O7U A;  3K00 A;  2OWZ A;  2UVI A;  1P1O A;  3R6U A;  3MJN A;  4RJZ A;  1MM6 A;  2XXT A;  5J16 A;  4PGP A;  1B4Z A;  1DSN A;  3S9N C;  1TFA A;  1I6B A;  4MF3 A;  1N76 A;  2OLB A;  2XWV A;  2MKZ A;  1AH5 A;  2L5V A;  3S9M C;  4NE4 A;  4OAN A;  4QBA A;  1WDN A;  4OYV A;  5ET6 A;  4XKR A;  1IMB A;  4C1T A;  2O7I A;  4LN5 A;  3M8U A;  4N8Y A;  4F22 A;  4KFQ A;  3UOR A;  3PUZ E;  2R8T A;  2CEX A;  2QS2 A;  4H45 A;  2FIX A;  2OK2 A;  3PUW E;  1FPJ A;  5HPQ A;  3HST A;  1FTM A;  1TWY A;  2HHM A;  2REJ A;  1ELJ A;  1B51 A;  3OD7 A;  3RTF B;  3T66 A;  1JEV A;  1LCT A;  1MM7 A;  1Y3Q A;  1DMB A;  1UTB A;  1I6Q A;  4YB6 A;  3O29 A;  4LQ2 A;  3FGS A;  2H99 A;  3H4Z A;  3KZG A;  3UIF A;  1MRP A;  4KYS A;  4MX6 A;  3KFM A;  1B4H A;  2R71 A;  4EQ7 A;  1YXI A;  2REG A;  3O6G A;  4GWX A;  4XKQ A;  5AA3 A;  2PFY A;  2Z22 A;  2H25 A;  3VE1 B;  3D4C A;  4JB7 A;  1LFH A;  1FW0 A;  1AIV A;  1XHY A;  3E4R A;  3H3G A;  5B7D A;  2Q74 A;  3H03 A;  5DT6 A;  4OVQ A;  1YZ0 A;  3U65 A;  1JVX A;  2QSX A;  5JK4 A;  3KBZ A;  1P1U A;  1I69 A;  4ZEB A;  2LAO A;  1DBZ A;  3SEW A;  4ZS9 A;  4GF8 A;  5IZ3 A;  2HXR A;  4PFU A;  2F97 A;  2I3V A;  2QMX A;  4X04 A;  2Y7P A;  4F2O A;  3QAX A;  3L6H A;  2XXW A;  5EQ7 A;  2I58 A;  3DP8 A;  1NNF A;  2F7A A;  2V3U A;  1RDY A;  1PB9 A;  4XTC Q;  2F78 A;  3QSL A;  4RNS A;  1PB7 A;  5H8Q A;  1R9L A;  4GIZ A;  1FTA A;  3IFC A;  4RK2 A;  5F7V A;  4NWC A;  5ICT A;  2ZXT A;  4PP0 A;  2Q8J A;  4I1D A;  1DPE A;  1IIT A;  4JWX A;  5TPA B;  3KN8 A;  1VR5 A;  4NGU A;  1MDQ A;  4YKP A;  4DCY A;  1N84 A;  5DTB A;  4NF8 B;  1FSA A;  1QUJ A;  4YB7 A;  1FTL A;  3TEL A;  1NV0 A;  3CRB A;  3ILU B;  4I3E A;  1MQH A;  4GFR A;  1ZIU A;  2A5T B;  4X1D A;  1LBB A;  5H8H A;  3MQ9 A;  1POY 1;  5JEI A;  5KCJ A;  4EQB A;  4EXL A;  1PBQ A;  3B6Q A;  4UAB A;  4BDQ A;  3K02 A;  2P1S A;  5J1D A;  1NNK A;  1NNT A;  2Z23 A;  2ZNS A;  5I2K A;  1Y3P A;  1SYH A;  2R9J A;  4G2Z A;  4F18 A;  2DE4 A;  2F6P A;  4F3P A;  1LCF A;  2I0B A;  4MLQ A;  2XXY A;  2F3B A;  1B58 A;  4JBZ A;  1MXW A;  3DM0 A;  1OVB A;  2HPG A;  3T9U A;  4PAF A;  3Q26 A;  4BDM A;  3PPN A;  3KN3 A;  4FE8 A;  2F8D A;  3MST A;  5IM2 A;  4ELP A;  1USY H;  3FVG A;  3HV1 A;  1RKM A;  4ZDM A;  4MMP A;  2OZZ A;  5I57 A;  1OIB A;  2XXR A;  3EKI A;  4OHN A;  4M4G A;  4OMB A;  1SBP A;  4YKJ A;  5HBC A;  4PFI A;  1LAH E;  3CIJ A;  3VFJ A;  1Y20 A;  1NUX A;  4F31 B;  2DS9 A;  1EZO A;  1CNQ A;  3MUQ A;  3PD9 A;  1QJM A;  3DLN A;  1NV5 A;  1LFI A;  3C34 A;  1AL3 A;  3EHU A;  1F9B A;  4LVQ A;  1PC3 A;  2Q8M A;  3LSL A;  3KOS A;  5ESY A;  2I49 A;  2Y5L A;  4YKK A;  1B1H A;  3ZKK A;  4N6D A;  4H46 A;  4TOZ A;  5EYG A;  1IQ7 A;  3K1M A;  5K2X A;  3PD8 A;  3NOH A;  3V8X B;  3OO6 A;  1EYK A;  4H8J A;  4PQJ A;  5ET5 A;  1CB6 A;  2Q88 A;  3O97 A;  4ONY A;  4NF4 B;  3MW0 A;  4GXS B;  4OEV A;  3O6I A;  2Q89 A;  4MNI A;  1IXI A;  4AS4 A;  2Y7W A;  2I4C A;  2DWI A;  3TOD A;  3PPP A;  3VLU A;  1EU8 A;  1Z7N E;  3V5A A;  2HEU A;  2XD2 A;  1D9V A;  5AA2 A;  4KI0 E;  1Q35 A;  4LZ5 A;  2VP1 A;  3KN7 A;  1G0H A;  1N3W A;  2PT1 A;  3GLB A;  1B6H A;  1IZ1 A;  3I5O A;  1GTK A;  3WAE A;  1URD A;  1R9Q A;  4MCO A;  1QUK A;  3FIR A;  3HPI A;  2E0S A;  3PGF A;  3SDF A;  4F2Q A;  1B7U A;  4DIG A;  3RLF E;  4U1Z A;  4AS5 A;  2IA4 A;  1Y1Z A;  2GHA A;  3Q28 A;  2XXQ A;  1SI1 A;  4N13 A;  3SER A;  4G8H A;  3TZA A;  1US4 A;  4AQ4 A;  3A3U A;  3O66 A;  3MZ1 A;  3LUZ A;  2RKM A;  1B05 A;  1UTH A;  3FD3 A;  3SEX A;  4FEC A;  4ZEK A;  1LBY A;  1PBP A;  1B5J A;  3QYT A;  3ODB A;  4DI4 B;  3O6H A;  3UP9 A;  1MXX A;  1A7L A;  2ONS A;  1VE4 A;  3BIH A;  3R7X A;  1A40 A;  4P9K A;  3D1R A;  3AXF A;  4OVP A;  5AA4 B;  3K0V A;  3RYD A;  4Z7E A;  2JJK A;  4IO7 A;  1Y4C A;  1SD3 A;  4XFE A;  4ZE9 A;  3UN6 A;  2ABH A;  2WKY A;  2QRY A;  5I84 A;  2XXP A;  3IOR A;  3IAZ A;  1FBC A;  1B9J A;  4GWU A;  2P3V A;  4OVT A;  1NUW A;  4F29 A;  1XT8 A;  3CG1 A;  2ANJ A;  4DXU A;  2DWA A;  4ZZA A;  4FIM A;  2DVC A;  1I6A A;  2H5Y A;  3R26 A;  4H65 A;  4QSE A;  3KJT A;  5A5X A;  1RDZ A;  3MP8 A;  2OWT A;  2Y7I A;  4OES A;  4PTK A;  4FOR A;  1SW5 A;  2RF1 A;  2PYY A;  5CC2 A;  3BIG A;  3RTW B;  1YAE A;  3UA8 A;  4GWW A;  3SEY A;  5LOM A;  4JSO A;  3KBR A;  4GWZ A;  3RY3 A;  1GR2 A;  3ZSF A;  2FIE A;  2FBP A;  4LQ5 A;  4N4U A;  4NAP A;  3G7W A;  3K6V A;  1HSE A;  1EZ9 A;  3CG3 A;  3PU5 A;  1JW5 A;  2KQZ A;  2XXV A;  3Q29 A;  4WEP A;  1N0T A;  4YKI A;  4AB5 A;  3TCF A;  4XIG Q;  3ISP A;  1O64 A;  1A8F A;  1ZBM A;  5FHO A;  4JDF A;  4RYA A;  2ZZX A;  3I6V A;  1EZP A;  2PFZ A;  3S9L C;  2HCA A;  2PBW A;  1NMU A;  4ECF A;  4TLM B;  3IB0 A;  3MPK A;  2OCU A;  3N6U A;  5I7I A;  2PCR A;  5T3J A;  5EHS A;  5EYH A;  2F36 A;  1H76 A;  1XS5 A;  2QS1 A;  1FBH A;  3FAT A;  1B52 A;  4IR8 A;  5EYF A;  1YPN A;  3ROJ A;  1XI6 A;  3TKD A;  5I58 B;  4I3Y A;  3MAM A;  2Z8F A;  3B50 A;  3VLV A;  1LB9 A;  3FAS A;  3CSB A;  5CRY A;  3PPQ A;  4IY6 A;  1B3G A;  3K6W A;  2D21 A;  3PPR A;  3G3J A;  2YJP A;  2XX9 A;  4M1V A;  5IAI A;  4EQ9 A;  1LFG A;  3Q27 A;  4NQ8 A;  1L5T A;  1NFT A;  4LUB A;  2R6G E;  1B0H A;  4GVO A;  4QFN A;  4NTL A;  3LC8 A;  2ZYM A;  3HHF A;  4WXJ A;  1B5H A;  1LAG E;  1B1X A;  2XXU A;  1FJ9 A;  3KSX A;  3G3I A;  4OET A;  3A09 A;  2Q9T A;  3HO7 A;  3FJG A;  3QK6 A;  2B4M A;  4EF1 A;  3RPL B;  3MVW A;  3HHG A;  5I56 A;  2F34 A;  5JTY B;  2NVU B;  1XC1 A;  1KZ8 A;  2HFB A;  1II5 A;  4ZZE A;  5I59 A;  3FUZ A;  3O28 A;  3VVE A;  4HXV A;  4NF6 B;  3U93 A;  1INP A;  1IXC A;  1R6Z A;  1FBG A;  4LZ8 A;  4H5G A;  4O7M A;  1US5 A;  3K4U A;  1QKB A;  3W9V A;  2NUV A;  4KYD A;  4QFK A;  4BDO A;  5I2N A;  3B7D A;  4PF6 A;  4P8B A;  4BDN A;  3OO8 A;  1G0I A;  3LV0 A;  2KR0 A;  1Q1K A;  4P1L A;  3EN3 A;  5CMM A;  2GQ1 A;  3FXR A;  3IK6 B;  1N7X A;  3CFL A;  3CFZ A;  2QVV A;  4FED A;  1JEU A;  3RT8 A;  2I48 A;  1MXY A;  4DCX A;  3SEU A;  1LBZ A;  4LZ7 A;  4RXL A;  5FHM A;  1IMF A;  2G93 A;  4HCY A;  1YYZ A;  2BJI A;  4IO5 A;  1NV3 A;  5H8N B;  3MVX A;  4EXK A;  5CBS A;  4OFJ A;  1ANF A;  3HN0 A;  4H1X A;  3DP4 A;  4GQO A;  1EYI A;  3U94 A;  4RPO A;  1FTK A;  4HTG A;  3ONM A;  4P47 A;  4GL8 A;  1SW4 A;  3IJX B;  2I3W A;  1S7Y A;  4MJO A;  4YZZ A;  4R9G A;  1NH7 A;  2O1M A;  2YLN A;  2ZMB A;  2F5X A;  2CZH A;  1Z7M E;  2CZI A;  2HAU A;  4PFB A;  2M8C A;  2OPD A;  3IL1 B;  1BK4 A;  4G8M A;  3OEL A;  1DK4 A;  1DPP A;  2XA5 A;  3MP6 A;  3TMG A;  1FPL A;  2BJJ X;  1H44 A;  4X1B A;  4PFR A;  2OX3 A;  5CMC A;  1ZTY A;  5KDT A;  1NKX A;  4OQO A;  4IO3 A;  3T9V A;  2F7C A;  3U1O A;  1UIV A;  3ECR A;  2P2A A;  4ESW A;  4PET A;  1MY4 A;  2ALU A;  4MBP A;  2QJE A;  3T93 B;  4R74 A;  4F1Y A;  1PDA A;  4OFO A;  4P3L A;  4IB2 A;  2V84 A;  4QSD A;  3M3K A;  3OMB A;  3GBB A;  4Q8R A;  3KGC A;  3KOT A;  3PV0 E;  5I5P A;  1Y3N A;  1ZU0 A;  4F1V A;  5H8F B;  3FXU A;  2FHY A;  5IZ3 B;  1B7H A;  1SI0 A;  3IO6 A;  3SZP A;  2WX9 A;  4H6D A;  1B40 A;  5H8S A;  3KC1 A;  2FNC A;  1H3D A;  5IZ1 A;  3PMW A;  1BP5 A;  2UVG A;  3B6T A;  1FCK A;  3SES A;  4GX4 A;  1MPD A;  3IOT A;  4FAJ A;  4YMB A;  1AOV A;  3EQ1 A;  2OPE A;  4PBQ A;  5AA2 D;  1IMD A;  3C36 A;  1DTG A;  2RIN A;  4OXV A;  4ESX A;  3PUY E;  3A29 A;  2XWO A;  4DZ1 A;  4LA9 A;  3TQW A;  3TTR A;  3HCQ A;  3TAJ A;  4H67 A;  3VLW A;  1A55 A;  1B3L A;  3IOW A;  3SKP A;  2B4L A;  3FZV A;  1FTO A;  5F1Q A;  1MXU A;  4ELO A;  3LBS A;  3KC0 A;  3H6U A;  1MQG A;  1FPK A;  4H0W A;  3USD A;  3K6U A;  4QFL A;  2Y5K A;  4ZED A;  2XXK A;  4OZ9 A;  3UK4 A;  1M5B A;  2O84 X;  3T1B A;  3TQL A;  4I62 A;  1B2H A;  1LEV A;  5TU0 A;  5H8H B;  4FEB A;  3FVK A;  1NV7 A;  3GZG A;  2ZNU A;  1P1W A;  5BWJ A;  5KCJ B;  3CI8 A;  1DOT A;  1SQY A;  2V4C A;  3FJM A;  1Q9D A;  5M2V A;  3C31 A;  2O69 A;  1M5E A;  1A54 A;  3A3C A;  1MQI A;  2GRV A;  1TXF A;  2ESN A;  2QL3 A;  4DLD A;  1ZMG A;  3V83 A;  2UXA A;  2WYP A;  3O2A A;  3TFL A;  3M3L A;  2HAV A;  4PE5 B;  3U8Q A;  5F24 A;  3MBP A;  2KLF A;  3RGY A;  3WAF A;  2ZZW A;  2I0C A;  1IMA A;  1SW2 A;  2THI A;  3FV1 A;  4G61 A;  1URG A;  3V89 B;  3RUM A;  5TP9 A;  1MH4 A;  1IXH A;  4Q5T A;  3IJO B;  1IME A;  4MIJ A;  4JVI A;  1A8E A;  4U23 A;  2DYX A;  3GYY A;  1HSJ A;  4R9F A;  4KYE A;  4PFY A;  1LAF E;  2O6A A;  4P56 A;  3TCG A;  3OEN A;  5AA4 A;  1LAX A;  4JXI A;  3O9P A;  3C33 A;  4R73 A;  4POX A;  4NN3 A;  2NXO A;  2V93 A;  1FJ6 A;  1B3E A;  1IEJ A;  2RCA A;  3U92 A;  3MVY A;  5LDZ A;  1N7W A;  4X8R A;  1JW1 A;  1LBV A;  2E1S A;  4G4P A;  1AWB A;  4NF5 A;  3OEM A;  3QIM A;  5L9S A;  2XX8 A;  4I40 A;  2PMS A;  1FPF A;  1RYX A;  3P7I A;  4GLI A;  2DWJ A;  1Y1M A;  1XVX A;  1J1N A;  3IO4 A;  4N15 A;  3C4M A;  4RA1 A;  5DVI A;  3D4G A;  1JP4 A;  4R72 A;  4AB6 A;  5AE4 A;  3PMX A;  2FA7 A;  4X9T A;  4U2R A;  1FQF A;  1MDP 1;  4KQP A;  3LSW A;  4R2B A;  5A5L A;  2DE2 A;  3C35 A;  5CBR A;  4OVJ A;  3H6V A;  1D3K A;  4MEV A;  2XX7 A;  2ZYK A;  5IKB A;  4E0X A;  5L9M A;  4N81 A;  5FTI A;  4IO6 A;  2AYS A;  1OLC A;  3E13 X;  3ZKL A;  4KXP A;  5CM6 A;  1B7Z A;  2Q2A A;  4N91 A;  1FQB A;  1FBD A;  4U21 A;  3ZS6 A;  2UYE A;  1KWH A;  1JET A;  1WVJ A;  1CE2 A;  4ZEI A;  4DI3 D;  4G68 B;  2CZK A;  1MY2 A;  4OER A;  3LSF B;  5IGA A;  2FVZ A;  4FAT A;  3U72 A;  1PEB A;  4YAH X;  1ZLQ A;  3E3K A;  5I58 A;  3C32 A;  3EHT A;  5DEX B;  4K3F A;  1JNF A;  1SPI A;  2QS4 A;  3RT6 B;  2XXI A;  2DP8 A;  1M5C A;  4OVS A;  3QMF A;  1NV6 A;  4IO2 A;  4GL0 A;  4JWY A;  2VD3 A;  4X48 A;  2WYK A;  1B0L A;  2ONR A;  4O3C A;  2RCB A;  3OSQ A;  1MXV A;  4NED A;  1SDX A;  2I4B A;  4POW A;  3KSJ A;  1QUL A;  2RC9 A;  4GWS A;  3VVD A;  4DDD A;  3IR1 A;  5L8D A;  3T96 B;  4F19 A;  3JYR A;  5CMK A;  4ELR A;  4XF5 A;  3K1P A;  2DOJ A;  2Y7R A;  1SVX B;  4O7I A;  3QUJ A;  3B6W A;  4QRZ A;  4F39 A;  3RPL A;  3N94 A;  4G8N A;  2VD2 A;  5FHN A;  4RY1 A;  4BLA A;  1YTV A;  3G3H A;  2HXW A;  5A5X B;  1O63 A;  1NUZ A;  3JZJ A;  3PMV A;  4ZEC A;  2VGQ A;  3H6W A;  1FPD A;  2ZYN A;  3TYH A;  4NF6 A;  2HZL A;  1NNP A;  2O51 A;  3QXM A;  3BKI B;  2PT2 A;  3MPL A;  4H8I A;  4P0G A;  2VHA A;  2OBG A;  3H7M A;  4GWY A;  1YCJ A;  4IY5 A;  1LBC A;  4KR5 A;  2ZYO A;  3E9X A;  4EDP A;  2H4I A;  4P0I A;  3MZ9 A;  3OSR A;  4PCD A;  4DE8 A;  1N3X A;  4G68 C;  4DXC A;  2AL4 A;  3K01 A;  1NH8 A;  4OTE A;  1BIY A;  4OVR A;  2DXY A;  2Y7K A;  1S50 A;  2XXX A;  3CHG A;  4JWO A;  1MXZ A;  5H8N A;  1ZKB A;  1GV8 A;  1MG1 A;  4U22 A;  1S9T A;  1KA1 A;  4GBW A;  5EQ9 A;  3PUV E;  3MZB A;  5ITP A;  1IUD A;  5DVJ A;  1JQF A;  2YPN A;  2RC8 A;  1K9Y A;  1LGB C;  4ZEF A;  3S4U A;  4XKP A;  2P0S A;  2QVU A;  3G3K A;  3PPO A;  1WOD A;  5BUU A;  2O68 A;  4NX1 A;  4N07 A;  4OA4 A;  4PFT A;  3W15 C;  1QGX A;  1B5I A;  2X26 A;  3TEP A;  3FVN A;  3BFT A;  1OMP A;  1RYO A;  1B46 A;  1T0K A;  3LR1 A;  1JVY A;  2QFL A;  4KD5 A;  1BTJ A;  2VPO A;  1D9Y A;  3GXA A;  2F7B A;  2OWS A;  2GHB A;  4WKM A;  3S2V A;  3EPE A;  3GBA A;  1OQG A;  3MYU A;  1A99 A;  1QW0 A;  1UQW A;  2X7Q A;  4OFL A;  4FJP A;  3VVF A;  1HSL A;  3CR9 A;  3RPW A;  3G3F A;  5I3S A;  4HCW A;  4IGR A;  5TPA A;  1LB8 A;  3MC2 A;  4I8C A;  3IOV A;  3KEI A;  2NOO A;  5DW8 A;  3G3G A;  1IXG A;  4L17 A;  4FBP A;  4HE2 A;  4MH5 A;  5I56 B;  2V3T A;  4NF8 A;  1UTB B;  4RPN A;  1P1N A;  4PAK A;  4P1E A;  1FPI A;  3VV5 A;  4LP2 B;  3CSG A;  3N26 A;  4GBV A;  4F3G A;  4F1U A;  5H8F A;  2CZL A;  5I59 B;  1M5F A;  2F6G A;  3ILT B;  2A5T A;  1USY E;  2CMO A;  1FPB A;  2DE3 A;  4MAG A;  3EHS A;  4H5F A;  3BBR A;  3BFU A;  3IB2 A;  5I2N B;  1P99 A;  4NG7 A;  1QKA A;  3N5L A;  3QUF A;  1B3F A;  4ZE8 A;  2D3I A;  3RN8 A;  3C9H A;  1JW4 A;  5KZT A;  1MPB A;  3DP6 A;  1MPC A;  4OWD A;  2QMW A;  1OQH A;  4HE0 A;  5FBP A;  3B8B A;  4MLV A;  4GX6 A;  3FXB A;  4ISU A;  4O8M A;  4KCC A;  4G77 A;  4HS7 A;  4PAI A;  2QPQ A;  1FBF A;  2F3D A;  1TFD A;  3RNN A;  4PDH A;  1MQJ A;  4O3A A;  3TCH A;  2H98 A;  1N04 A;  2VT5 A;  1PB8 A;  1VFE A;  2ZNT A;  4F3S A;  1DCU A;  2XHD A;  2NWJ A;  4JVC A;  3TPA A;  4O3B A;  4Z0I A;  4NWD A;  4R6Y A;  1MS7 A;  4U1O A;  3S9E A;  5H8Q B;  5ET8 A;  2QS3 A;  4LAT A;  1XOC A;  4MNC A;  3KJ7 A;  3IX1 A;  3H6T A;  4IGT A;  4R2F A;  1FQE A;  2PX1 A;  1POT A;  4QXD A;  2P3N A;  5KDT B;  4DXB A;  3MP1 A;  4HW8 A;  4PDD A;  1URS A;  3E78 A;  4N8G A;  3IB1 A;  1MH3 A;  2I6E A;  5IZZ A;  2F35 A;  2DVZ A;  3I3V A;  1OLA A;  1NUY A;  4JVD A;  4PBH A;  4PFW A;  4C0R A;  5AA1 A;  4GOT A;  1MY1 A;  2AL5 A;  2H9B A;  2UVJ A;  4ELQ A;  2UVH A;  4XXU A;  3THI A;  4Q0C A;  4GD5 A;  4YB5 A;  4NF4 A;  2B65 A;  2ZZV A;  3PTY A;  1FPE A;  2DWH A;  5ELV A;  1GVC A;  4E0W A;  2V3Q A;  4NMY A;  2G29 A;  4PE3 A;  1QVS A;  4HE1 A;  2CEY A;  3H06 B;  3FVO A;  1XVY A;  3OEK A;  3DEL B;  5I2K B;  2RC7 A;  4MHF A;  4C1U A;  2X7P A;  2AIX A;  5EQ8 A;  1FRP A;  4NHB A;  2GFE A;  1FQA A;  1H43 A;  2W7Y A;  3TTK A;  1FTJ A;  3UGW A;  1MQD A;  4N17 A;  3TTM A;  1D4N A;  4XKN A;  3EF7 A;  4TLL B;  1H45 A;  4O94 A;  1Y9U A;  3IFA A;  3IOU A;  3KG2 A;  2Z8D A;  1QUI A;  4PC9 A;  3MVZ A;  1BLF A;  2B3B A;  1SW1 A;  5I57 B;  3OOA A;  4F3B A;  3K2D A;  4QFP A;  2DQV A;  1NV4 A;  1SYI A;  2VOZ A;  1MY0 A;  4ND9 A;  3SET A;  1M5D A;  1Y4T A;  4Q30 B;  2ONK E;  4P11 A;  4BDL A;  2B3F A;  3T9H B;  4PF8 A;  2OJT A;  1RDX A;  3LSX A;  2PVU A;  1GGG A;  2WEF A;  4GX3 A;  4EUO A;  1FQC A;  3OO7 A;  4N6K A;  3JV9 A;  4R6K A;  5B70 A;  1LBX A;  4U4S A;  4MNP A;  2WBB A;  4U4X A;  3FV2 A;  3K1N A;  1NV2 A;  2Y84 A;  2VPN A;  4PGN A;  3MWB A;  1VDW A;  4QHQ A;  1VSO A;  1D9Q A;  5LTC A;  1FQD A;  4R75 A;  4XEQ A;  3M3F A;  3FXQ A;  3T0J A;  2DSF A;  1AMF A;  1UIU A;  1B32 A;  4KPT A;  3SEV A;  5HM4 B;  3LUY A;  2IEE A;  3E79 A;  4G68 A;  1EH3 A;  2Q2C A;  1BKA A; 
#chains in the Genus database with same CATH homology
 4MJO A;  4YZZ A;  3EKI A;  4PFI A;  2HZL A;  1NUX A;  2F5X A;  2CZH A;  2CZI A;  1CNQ A;  1IMC A;  1EYJ A;  1NV5 A;  4PFB A;  2XWK A;  4GWY A;  1BK4 A;  2Q8M A;  1DK4 A;  5ESY A;  2XA5 A;  1FPL A;  2Y5L A;  4PFR A;  2OX3 A;  4PCD A;  4N6D A;  4H46 A;  5EYG A;  4OVR A;  4PET A;  1LBW A;  3CHG A;  3FBP A;  4P3L A;  4YIC A;  2XWI A;  3NOH A;  1KA0 A;  5EQA A;  1EYK A;  5I5P A;  4NF0 A;  5ET5 A;  1KA1 A;  4GBW A;  5EQ9 A;  4F1V A;  3HFU A;  1FPG A;  1K9Y A;  2FHY A;  5IZ3 B;  1FBP A;  2QVU A;  2QVR A;  3SZP A;  2WX9 A;  4NX1 A;  4MNI A;  3KC1 A;  5ET7 A;  4AS4 A;  4OA4 A;  1QGX A;  5IZ1 A;  4GX4 A;  2QFL A;  2VPO A;  2WBD A;  1G0H A;  4PBQ A;  1IMD A;  3MYU A;  2DDK A;  3A29 A;  2XWO A;  3W9W A;  2HZK A;  4MCO A;  1NI9 A;  5I3S A;  4HCW A;  2B4L A;  1K9Z A;  4AS5 A;  3KC0 A;  1NV1 A;  5DW8 A;  1FPK A;  4FBP A;  4HE2 A;  1FBE A;  4PAK A;  4P1E A;  1FPI A;  2Y5K A;  4GBV A;  4F1U A;  3LUZ A;  2XXK A;  2OWZ A;  1LBY A;  1FPB A;  3T1B A;  4DI4 B;  2DE3 A;  4MAG A;  1LEV A;  1NV7 A;  3BIH A;  5J16 A;  4PGP A;  4P9K A;  3D1R A;  4OVP A;  2V4C A;  4NG7 A;  3RYD A;  1Q9D A;  2XWV A;  2JJK A;  2MKZ A;  4XFE A;  2L5V A;  4OAN A;  4QBA A;  5ET6 A;  1FBC A;  4GWU A;  2P3V A;  4OVT A;  1IMB A;  1NUW A;  4LN5 A;  4HE0 A;  5FBP A;  4N8Y A;  3B8B A;  2WYP A;  4GX6 A;  2R8T A;  3FXB A;  2CEX A;  4O8M A;  5F24 A;  4H45 A;  2FIX A;  1FPJ A;  2ZZW A;  1IMA A;  1RDZ A;  4PAI A;  2HHM A;  2QPQ A;  1FBF A;  4PTK A;  2F3D A;  3BIG A;  4G61 A;  4GWW A;  4PDH A;  4GWZ A;  2VT5 A;  1IME A;  4MIJ A;  4JVI A;  2FIE A;  2FBP A;  1DCU A;  4NAP A;  4N4U A;  4MX6 A;  4JVC A;  3GYY A;  1YXI A;  4P56 A;  4GWX A;  5ET8 A;  2PFY A;  2KQZ A;  4NN3 A;  4MNC A;  1FJ6 A;  3ISP A;  4QXD A;  2P3N A;  5LDZ A;  4X8R A;  4PDD A;  3E78 A;  4N8G A;  2ZZX A;  2Q74 A;  2PFZ A;  1LBV A;  5IZZ A;  2DVZ A;  4OVQ A;  1AWB A;  1YZ0 A;  3U65 A;  1NUY A;  4JVD A;  4PBH A;  4I40 A;  5I7I A;  5JK4 A;  1FPF A;  2PCR A;  5T3J A;  5EYH A;  3KBZ A;  1FBH A;  1DBZ A;  4N15 A;  4IR8 A;  5IZ3 A;  3ROJ A;  2HXR A;  2ZZV A;  4X04 A;  1XI6 A;  1JP4 A;  3PTY A;  4I3Y A;  1FPE A;  3B50 A;  4X9T A;  2V3Q A;  5EQ7 A;  4PE3 A;  4HE1 A;  2CEY A;  1RDY A;  5A5L A;  4MHF A;  2DE2 A;  4M1V A;  4MEV A;  5EQ8 A;  1FRP A;  4NHB A;  4NQ8 A;  1FTA A;  4N81 A;  3IFC A;  4KXP A;  4N17 A;  5CM6 A;  4N91 A;  1FBD A;  1FJ9 A;  4O94 A;  2Q9T A;  3IFA A;  2B4M A;  4NGU A;  3RPL B;  4PC9 A;  4DI3 D;  1KZ8 A;  2CZK A;  1FSA A;  1NV0 A;  1NV4 A;  4HXV A;  5IGA A;  2FVZ A;  4I3E A;  1INP A;  1FBG A;  4O7M A;  3W9V A;  4PF8 A;  1SPI A;  1RDX A;  4PF6 A;  4UAB A;  4P8B A;  2WEF A;  4GX3 A;  4OVS A;  3QMF A;  5J1D A;  1G0I A;  3LV0 A;  2KR0 A;  1NV6 A;  4N6K A;  4P1L A;  2WYK A;  2GQ1 A;  4F18 A;  1LBX A;  2DE4 A;  4MNP A;  2QVV A;  4GWS A;  2WBB A;  1LBZ A;  1NV2 A;  4F19 A;  2VPN A;  4PGN A;  1VDW A;  1IMF A;  2F3B A;  4HCY A;  1D9Q A;  1YYZ A;  2BJI A;  4XF5 A;  5LTC A;  1NV3 A;  4O7I A;  2HPG A;  4XEQ A;  1EYI A;  4PAF A;  3RPL A;  3T0J A;  3MST A;  5IM2 A;  4P47 A;  1NUZ A;  4MMP A;  3E79 A;  1FPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...