4HE1A

Crystal structure of human muscle fructose-1,6-bisphosphatase q32r mutant complex with fructose-6-phosphate and phosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
326
structure length
309
Chain Sequence
MLTLTRYVMEKGRQAKGTGELTRLLNSMLTAIKAISSAVRKAGLAKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 309
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he1A02
1D9QA 2FIEA 5IZ3B 1YXIA 1FTAA 1NV4A 2QVUA 1FPEA 4IR8A 4N81A 5EQ8A 1LBZA 3KC1A 3B8BA 1AWBA 1LEVA 1FPBA 1KA1A 2FHYA 1DK4A 2GQ1A 1DBZA 1EYJA 1YZ0A 4GX6A 2F3BA 1INPA 5FBPA 3BIGA 1K9ZA 5ET8A 1JP4A 2P3NA 1FJ6A 2Y5LA 1IMAA 1YYZA 1LBYA 2FVZA 3IFAA 2R8TA 4GWUA 1NUYA 4GBVA 3BIHA 1FPKA 1FRPA 3QMFA 1IMDA 4HE2A 4AS4A 2F3DA 2Y5KA 4GWXA 2OWZA 4I3EA 3RYDA 3IFCA 2Q74A 1KA0A 1FPJA 1LBVA 5T3JA 4FBPA 5IZ3A 2DDKA 4GBWA 2WEFA 1FJ9A 5EQ7A 4G61A 2Q8MA 1EYKA 4H45A 1K9YA 1NV7A 4H46A 2WBDA 1NUWA 3A29A 5EYGA 3KC0A 1FPGA 5EQ9A 1EYIA 4KXPA 2JJKA 1NUXA 1RDZA 4MJOA 1FSAA 3RPLA 1Q9DA 1QGXA 4GWSA 5DW8A 2CZIA 2BJIA 5F24A 1IMFA 3KBZA 2QVRA 2PCRA 3D1RA 1RDYA 1FBEA 1IMEA 3ROJA 5J16A 4I3YA 2HHMA 5I3SA 1XI6A 1FBDA 3FBPA 5EYHA 1FBHA 2FIXA 2QFLA 4GWWA 2CZKA 5ET7A 1KZ8A 4GX4A 2FBPA 4GWYA 2WBBA 1FPDA 1NV6A 1FPFA 2CZHA 1NV0A 4I40A 1NI9A 5ESYA 1G0HA 1G0IA 1FBFA 1NV2A 1SPIA 4HXVA 5ET6A 1FPIA 5ET5A 3LUZA 1BK4A 5A5LA 4PTKA 2QVVA 4O7IA 1RDXA 3LV0A 4GWZA 1NV5A 2OX3A 1FBGA 1DCUA 1FBCA 3RPLB 4AS5A 1IMCA 5LDZA 1LBWA 1VDWA 2P3VA 1FPLA 1IMBA 1NV1A 5EQAA 2VT5A 4GX3A 3T0JA 1CNQA 1NV3A 1LBXA 5IZ1A 1NUZA 4QXDA 4HE1A 4HE0A 1FBPA
chains in the Genus database with same CATH superfamily
1PBQA 3TDJA 4NF8B 5EQ8A 4QFPA 3MQ9A 4AB5A 3GZGA 1FPBA 3H6TA 1LAHE 4ECFA 1M5DA 2FNCA 5HM4B 3FZVA 4F3GA 3HV1A 4Q8RA 3PUYE 1FRPA 3QMFA 2Y7KA 2B4LA 2V84A 2I6EA 4ZZEA 3NOHA 1B6HA 1B0LA 2V3UA 3T66A 5DVFA 1K9YA 3FJ7A 5J1DA 3PUVE 5H8HA 2ZNTA 4QSCA 2GH9A 5JK4A 5DEXA 1B3GA 4EQ7A 1MQHA 4WEPA 2I58A 2DXYA 3PU5A 4OMBA 3MC2A 4I9DA 4RA1A 2CZIA 4ZDMA 2AL5A 3H6VA 4HS7A 2QS3A 4JVCA 5J16A 3IB0A 1N76A 4JXIA 3L6HA 1BLFA 1FQAA 4G4PA 5DVJA 3TTKA 1P1QA 2I4CA 2FIXA 2XX9A 2E1SA 4EF1A 2PX1A 4GXSB 2F36A 5H8QA 2F34A 4E0WA 1MS7A 1URDA 5HBCA 2B3FA 2WBBA 4ESXA 2H5YA 1JW4A 3OSRA 4KI0E 1SW5A 5AA4B 3LSFB 3EN3A 2XXKA 4FORA 3TTRA 4NF5B 2QMXA 5FHMA 2WYKA 3A3UA 1MXVA 4HW8A 3VV5A 4UACA 2GFEA 1FBPA 4P1LA 2HQ0A 1FCKA 1NNFA 2DWHA 1R1NA 2E0SA 2H98A 4ZEKA 3OEMA 4OVJA 4H1XA 3GLBA 4IGTA 4IO2A 1B2HA 2UXAA 4GL8A 1PEBA 1JVXA 4N4UA 1ZU0A 1USYE 1OMPA 4H8JA 3BIHA 1PBPA 1XVXA 2O6AA 2Q9TA 1M5CA 3SKPA 1JW5A 1MH4A 3TODA 5H8NB 4NF0A 4FBPA 1A7LA 4P0IA 1MH3A 3HCQA 4KYDA 3VVEA 4MNPA 4HCYA 3OMBA 4KXPA 1HSLA 4DXCA 3IL1B 3IO4A 3IK6B 2YJPA 4MMPA 2I49A 3DP8A 4Z0IA 3KBZA 4YICA 5FHNA 3TQWA 3VVFA 3ILTB 3KFMA 1LBCA 4GL0A 3EHTA 3V5AA 2O69A 1Y4TA 2DP8A 4PFWA 3U94A 1NI9A 4F19A 3LSXA 2XXVA 3LUZA 4PQJA 4NF4B 4OFJA 3T22A 2XXTA 4JB7A 1FBGA 3RPLB 3CFXA 2RC7A 1IMCA 5LDZA 5TP9A 4QFOA 1D4NA 4ELOA 4QFNA 2O84X 4GD5A 3C33A 3PGFA 1SD3A 3QSLA 3PTYA 3CSBA 4N81A 1IQ7A 4PP0A 2AIXA 4DCXA 1B52A 3WAEA 4P47A 2REGA 1MXXA 3N6UA 5CI5A 2G29A 5HPQA 1Y3PA 5CBSA 2H9BA 1P1NA 4DXUA 3FXRA 1Y9UA 4LZ8A 2HZKA 4LQ5A 1LB8A 3KJ7A 5B70A 2DE2A 2Q88A 4PBHA 4U1OA 4U1ZA 2PT2A 4DI4B 4GLIA 2Z23A 4C1UA 4UABA 1EYKA 4H45A 2WX9A 2IA4A 2XX7A 2ZZVA 1NUWA 4GQOA 2WKYA 2ABHA 1QUJA 3PUWE 1QUKA 2OPEA 1S50A 4GWSA 1WVJA 5ITOA 5I58A 4JSDA 5F24A 4M4GA 1US4A 2PCRA 1IXHA 2Y7RA 4PGPA 1EH3A 4X04A 4F18A 3SZPA 3VVDA 3IJXB 4GWYA 1N04A 4OVPA 1NV0A 3V83A 5BWJA 4PFYA 1NV2A 4OFLA 3K6WA 1SW4A 4OQOA 4LQ2A 1NNTA 3LV0A 2OX3A 4ISUA 4Z7EA 4KYSA 2VT5A 1MPDA 3KSXA 1D3KA 2PFYA 2RC8A 3KJTA 2XWIA 4XKRA 5JTYA 3CIJA 2D3IA 2F7BA 4MNIA 3T9UA 3TPAA 1LAFE 2THIA 4F39A 1QKBA 4RJZA 1DTGA 3S9LC 3UGWA 4OETA 2Y7IA 2F97A 5A5XB 4KR5A 4O7MA 1IMDA 3LUYA 4HE2A 2F3DA 4R2BA 3FVOA 3MW0A 3B6WA 3MAMA 4YKPA 4KFQA 4N6PA 1M5FA 4N6DA 2ZNUA 2YLNA 4NN3A 1YTVA 4Q0CA 3ZKKA 4G61A 1Q35A 3MWBA 1Y3NA 3TMGA 1MRPA 5AA2B 3A29A 4P11A 5L8DA 1LFIA 3ISPA 4F1VA 1FSAA 1ZMGA 3WAFA 4OXVA 1SI0A 3ONMA 1SBPA 3K2DA 4XXUA 3H4ZA 2QVRA 1YCJA 1PC3A 3CFZA 3ROJA 3PUZE 1I6BA 1LCTA 1Y1MA 3EF7A 1SVXB 4BDQA 3CG3A 3LSWA 1YPNA 3TELA 4I62A 4DI3D 3B6TA 1NV6A 4I40A 3TZAA 2DSFA 2VHAA 1B32A 5H8HB 4ZECA 3OO7A 5DEXB 2G93A 3M8UA 3Q25A 3TQLA 4BLAA 1LGBC 3U92A 1PB9A 1L5TA 2QS1A 5M2VA 5IZ1A 5I84A 5ICQA 3FXUA 3OOAA 4OHNA 2FHYA 2RC9A 4WXJA 2FYIA 4OEVA 5H8QB 2GQ1A 4MF3A 4YMAA 1UQWA 3FGSA 3LBSA 2F8DA 3OXNA 1IXGA 2Q2CA 4NF6B 5CBRA 4AB6A 2GRVA 3IFAA 4IO5A 4GWXA 3FJGA 2OWZA 3C35A 3TTNA 2Q89A 3JZJA 5FTHA 3TYHA 2WEFA 3P7IA 3H3GA 4NGUA 1MQGA 4H46A 5L9OA 4F3BA 2PBWA 1EYIA 2XD2A 2XXHA 3CFLA 4PF6A 1FTMA 1FTOA 2R6GE 3MP1A 2P0SA 3G3JA 4WKMA 1IMFA 1O64A 3FXQA 3KGCA 4OENA 2DWAA 3C4MA 1SYHA 5EYHA 2ZZWA 3HO7A 3R7XA 5ET7A 4TLLB 4GX4A 2XXRA 2V25A 1FPDA 3TCHA 2AL4A 5KZTA 3HN0A 1II5A 2RKMA 5ET5A 1OVBA 3TCFA 1SW2A 4MLVA 4LUBA 3MPKA 2I3VA 4OZ9A 1PDAA 4YZZA 4IGRA 3ILUB 3EKIA 3EHSA 2KQZA 1H45A 3T1BA 2I3WA 2ZYOA 2DVZA 1D9QA 5IZ3B 1YXIA 1BP5A 2QVUA 1KA1A 4G8HA 2L5VA 5AA1A 3M3KA 3IAZA 3VXCA 4H8IA 4MIJA 1JP4A 5I2NB 1Y4CA 4QF9A 3MVZA 2V3QA 4IO6A 3GYYA 4OA4A 1OQHA 4NWCA 4BDNA 1XHYA 4YU0A 5CMBA 1JETA 4O3AA 5TP9B 1MPBA 2X7QA 4RPOA 4IY6A 4ZZAA 1FJ9A 2OLBA 4PC9A 4ESWA 3MBPA 3N94A 4FATA 4K3FA 4OEUA 2JJKA 1Y20A 3VDFA 3VLUA 3K6XA 3DM0A 2UVIA 1CE2A 3QYTA 4PFTA 2D5WA 4PFUA 5I7IA 3MVWA 5FTIA 2HHMA 1UTBA 1FBDA 3O28A 1DOTA 3U93A 2QFLA 4F2QA 1KZ8A 3FV1A 4OVTA 1Y1ZA 1POY1 3ODBA 1M5BA 5AE4A 4PFBA 2XD3A 4NAPA 4OTEA 2DYXA 1VR5A 3VFJA 2IEEA 2REJA 5I58B 4NG7A 5I2KA 3UA8A 4HE1A 3IB2A 5F7VA 1ZBMA 3JYRA 1UTHA 4FEBA 1NV4A 4G68B 4FEDA 4X1BA 4AQ4A 3E9XA 4R6KA 3IO6A 4BDLA 4LP2B 1OIBA 1IIWA 3UP9A 4FE8A 1FJ6A 1USYH 2I4BA 1TFAA 3V89B 4LATA 1LAGE 1B5IA 5L9SA 4EXLA 2OK2A 1XOCA 4HTGA 3S9EA 3OO8A 1MQDA 1KA0A 3IOVA 3MZ9A 1JVYA 4U23A 3FVNA 3RUMA 1TXFA 3Q27A 5JTYB 3K6VA 1D9YA 5I57A 1AH5A 1A8EA 4E0XA 3W15C 1Q9DA 1AL3A 4OANA 4EXKA 3IR1A 2XXIA 5I3SA 2UVGA 3OO9A 4XFEA 4GWWA 3RPWA 3V8XB 1O63A 3K02A 5F1QA 1MY2A 4NMYA 2NVUB 4LN5A 4OVQA 3T9HB 3G7WA 1B9JA 2XXYA 3TEPA 2P3VA 4GX3A 2HFBA 1NV3A 1FQBA 1A8FA 3C32A 3CG1A 3I5OA 3M3FA 4O8MA 2XXQA 4ELRA 1B46A 2DOJA 2DQVA 3T9VA 3N5LA 2X7PA 5I59A 4JVDA 2DE3A 3ZS6A 4GOTA 4R9GA 1IXIA 5IKBA 3IOTA 1ZJLA 1A55A 4C0RA 5CMKA 2Y5KA 3SEXA 4I3EA 2HXWA 5I56B 3THIA 1R6ZA 4F1UA 1HSEA 2Y7WA 1MM7A 3G3HA 2ONRA 5CMCA 2AYSA 2QS4A 2Q8MA 1NV7A 3S4UA 3DP6A 3IOWA 2UYEA 3RLFE 4LZ7A 3RT8A 2UVJA 3FXBA 3PPRA 3R26A 1FBEA 1SDXA 4P56A 1MDQA 4R9FA 3SEWA 3MP8A 1Z7ME 3EPEA 3KN3A 1DPEA 3KG2A 1URSA 4RPNA 1FBHA 5CRYA 1PB8A 4I8CA 3CRBA 3M3LA 1MDP1 4HXVA 3C9HA 2I48A 2OBGA 4PTKA 2Y7PA 2ANJA 3TUSA 1NFTA 4NTLA 4THIA 1EZPA 1EU8A 4RK2A 5EQAA 2P2AA 1US5A 3PD9A 4QFLA 4HE0A 2PVUA 1RKMA 2ZYMA 5H8FA 2P1SA 3MZ1A 4OVSA 3KC1A 3B8BA 2XWKA 4F3SA 3T96B 4OVRA 1DBZA 1S9TA 1NKXA 1T0KA 1I6AA 3GBBA 2HXRA 4KHZE 4MLQA 4BDRA 4DZ1A 4PBQA 4L17A 4JDFA 2FVZA 2NXOA 1NUYA 1BIYA 3PMWA 3W9VA 4DE8A 4YMBA 4LA9A 4WEDA 2DWIA 4JWOA 3OENA 2DDKA 2HZLA 2OWTA 2X26A 4R74A 4IO7A 5EYGA 3ZSFA 3IORA 5AA3A 2ZZXA 3PPOA 3E79A 2CEYA 5EYFA 4X48A 4PE3A 5CMMA 1TWYA 3FATA 3G3KA 4R72A 2VD2A 4IY5A 3FJMA 3KZGA 5K2YA 2XA5A 4IB2A 4I3YA 2O7IA 1OLAA 1B1XA 4G2ZA 4JBZA 4NWDA 5IAIA 3H6WA 1LBBA 3ZKLA 2VD3A 5TPAA 2CZHA 4PAIA 2ZNSA 1QW0A 3KOSA 2V93A 4GWZA 5ITPA 1DCUA 1P1WA 1FBCA 5EHMA 2XXXA 3LC8A 3A09A 3I6VA 3S9NC 5L9MA 1GTKA 2MKZA 3HHFA 1CB6A 1UTBB 3TCGA 4IR8A 4LZ5A 1LCFA 1J1NA 3K1PA 1DK4A 5K2XA 1FQDA 2H25A 4NHBA 1B3LA 2Z8FA 4FJPA 1FQEA 2OWSA 2F35A 4P3LA 3VXBA 3QXMA 4N6KA 1JEVA 3MPLA 4NF4A 1B58A 4GWUA 4GBVA 3VE1B 5DT6A 2XXPA 3IJOB 4KPTA 4PDHA 3VLWA 4U4XA 3RYDA 2Y84A 3U72A 1N3XA 2I0BA 3QIMA 1QVSA 2HAVA 4ZEBA 4N13A 3T9XB 4FAJA 2QJEA 2Z22A 1FPGA 3W9WA 1ELJA 5DW8A 1ZTYA 4GRKA 1Z7NE 2GHAA 4R75A 4NE4A 4PE5B 3FBPA 3BFUA 2F7CA 1EZOA 3LR1A 4MCOA 2O1LA 4F3PA 3U1OA 5ESYA 5ET6A 2NWJA 1AOVA 1OVTA 5I57B 5EHSA 4R6YA 3C31A 4JWYA 4H0WA 1VDWA 1FQCA 1WDNA 1JQFA 1JW1A 4KD5A 3C34A 1LFHA 1NUZA 1N7XA 4QXDA 4R73A 1FTKA 2ZMBA 4ELPA 1LAXA 4H67A 3TFLA 1IZ1A 3O2AA 2OZZA 3I3VA 3CI8A 3HSTA 2ALUA 1NL5A 1YZ0A 3O66A 2M8CA 2DE4A 1VE4A 4JVIA 4X8RA 1XC1A 4F22A 3PD8A 3H7MA 2P3NA 2Y5LA 3O6IA 3A3CA 4JSOA 4X1DA 3RY3A 1LBYA 3QUFA 1FPKA 2I0CA 3FIRA 4OYVA 2R9JA 4N17A 3H03A 3PMXA 4YAHX 5TU0A 3DP4A 2B4MA 3FV2A 2NOOA 2W7YA 3PV0E 2LAOA 1B4ZA 3QUJA 4QSDA 3KC0A 2Q2AA 1NMUA 4IO3A 3Q29A 3EHUA 2Q8JA 2QRYA 1R9QA 1N7WA 4OERA 2KR0A 5A5XA 1OQGA 2HPGA 5IM2A 1GV8A 4R6HA 4QBAA 1MXWA 1RYXA 2RCAA 2OJTA 3SDFA 5LOMA 1FBFA 5AA2A 2QVVA 4O7IA 2O51A 2DVCA 2CEXA 3TKDA 1N0TA 3FD3A 1CNQA 4NQ8A 3MJNA 4ND9A 1FQFA 1EZ9A 3UIFA 5ICTA 2FIEA 2HAUA 3D4CA 3K00A 2CMOA 4MFIA 4KCDA 4KYEA 4N8YA 4O3BA 5BUUA 1LFGA 4GX6A 1RYOA 2F3BA 5FBPA 2ZYNA 4G77A 4N07A 1P1OA 2PT1A 3Q26A 1XT8A 1YYZA 1B0HA 2R8TA 4POWA 1MXZA 1DPPA 4EQBA 1FPJA 4TQUQ 3SESA 1UIUA 5H8FB 4F1YA 2OPDA 4G8MA 5EQ9A 1Q1KA 1NUXA 1RDZA 3F11A 1ANFA 4ELQA 4NF6A 4P9KA 4NX1A 2UVHA 3G3GA 5KDTA 1MXUA 4M1VA 1PB7A 3OD7A 3USDA 3FASA 1ZIUA 4QRZA 2XXWA 4FECA 2HCAA 5I5PA 3MVXA 1SPIA 1IUDA 5KCJA 1D9VA 2ONKE 3K0VA 3D4GA 5CM6A 2H99A 1IMBA 1NV1A 1SYIA 3BFTA 4GXAA 5CC2A 3CR9A 3O9PA 4TLMB 3VLVA 4I1DA 4MH5A 4F2OA 3TTLA 2QSXA 2RF1A 5TPAB 4Q5TA 3BIGA 3RQTA 1QUIA 2ZYKA 4DIGA 2NUVA 1H44A 2A5TA 3H6UA 4G68C 4HCWA 4YB7A 3RTFB 2D21A 1YAEA 1URGA 1XVYA 3BKIB 4ZEIA 4H5FA 4OWDA 2F6PA 1GVCA 3H06B 3PPQA 4EF2A 2Q74A 2WYPA 4G8NA 3KOTA 5IZ3A 4GBWA 4PF8A 1B3EA 1B05A 2R71A 3HHGA 4PGNA 4FIMA 1HSJA 3O97A 2RCBA 1QJMA 1H3DA 4X9TA 3SERA 4QHQA 5I2NA 3CSGA 1QGXA 4LVQA 2BJIA 1RDYA 4PETA 4U2RA 1A40A 4BDOA 2QPQA 1MQJA 4PFRA 4NF8A 1VFDA 4R2FA 2CZLA 2QS2A 3KSJA 3IX1A 2ONSA 4RXLA 1FPFA 3G3IA 3MSTA 5DYHA 3RTWB 1FTLA 3RGYA 1FPIA 3CHGA 4YKJA 5JEIA 1KWHA 4P1EA 4RNSA 2A5SA 3HPIA 2F6GA 1A99A 1NV5A 3N26A 2XWVA 1LBWA 1IXCA 4EUOA 4MHFA 3T0JA 4DXBA 1LB9A 4YKKA 1GGGA 3B7DA 2O68A 1B3FA 3TAJA 1FTAA 1FW0A 1FPEA 4YB5A 2PMSA 1LSTA 1EYJA 4MNCA 1INPA 1AIVA 4PCDA 1K9ZA 4QFKA 1OLCA 1DSNA 3K4UA 4PDDA 1NNKA 3KN7A 4EQ9A 3MP6A 4XKPA 2RINA 3RN8A 4QSEA 4G68A 4ZS9A 2WBDA 4KCCA 5AA4A 4XKQA 3FVGA 4N91A 2O7UA 4Q30B 4NF5A 3HFUA 1WODA 2UYFA 2F5XA 4XIGQ 1P1UA 4F31B 1B7ZA 1IITA 2V4CA 4H5GA 1XI6A 4DLDA 3OO6A 5LTCA 2CZKA 3O6HA 3MVYA 2GHBA 1B51A 1B5HA 2DXRA 3OELA 1MY3A 2ZXTA 1G0HA 3OSQA 1NH8A 4PAKA 1BK4A 4ZE9A 4ONYA 4MBPA 1RDXA 2PYYA 2XWOA 1B5JA 2Z8EA 3OEKA 4RYAA 2Z8DA 4U4SA 3U65A 3QAXA 1FPLA 1DMBA 1AMFA 3UN6A 1B7UA 3T93B 3PPNA 5H8NA 1I69A 1IEJA 3N6TA 2ESNA 1B40A 3JV9A 1TT1A 3KEIA 4P0GA 1R9LA 3S9MC 3G3FA 2F78A 1BKAA 3Q28A 2FA7A 4XTCQ 2DS9A 4YB6A 1IMAA 3DELB 1O7TA 1Y3QA 2QL3A 4GF8A 4GWOA 1H43A 4AS4A 3E78A 3IB1A 3AXFA 3IFCA 2XX8A 4O3CA 4N15A 2B65A 2YPNA 2KLFA 1LBVA 3FUZA 5T3JA 1I6QA 4DCYA 2F7AA 2OCUA 1A54A 1BTJA 1P99A 3E13X 1DTZA 1MXYA 3SEUA 3IOUA 4N8GA 1LLSA 5AA2D 3K6UA 3LSLA 1B1HA 1S7YA 2HEUA 3K01A 1XS5A 3CVGA 1QKAA 3FVKA 3MZBA 3RPLA 3QK6A 3B50A 4NEDA 4EDPA 3K1NA 4TOZA 4LONB 3B6QA 1N84A 5I2KB 4H6DA 5ELVA 2XXUA 4OESA 1H76A 3L6GA 1UTHB 3GBAA 1FTJA 1QULA 5I56A 3SETA 1F9BA 1ZLQA 2XHDA 2VOZA 2VPNA 2O1MA 1MY4A 5DTBA 4PAFA 1G0IA 1MPCA 3GXAA 5A5LA 3C36A 1ATGA 4U21A 1VFEA 4XEQA 4GFRA 2V3TA 4AS5A 1JNFA 1GR2A 2BJJX 2QMWA 1LBXA 4ZE8A 4P8BA 5H8SA 1LBZA 1SQYA 1AWBA 1LEVA 5KDTB 3K1MA 4O94A 4PFIA 5FHOA 5ET8A 3DLNA 1MQIA 4RY1A 1N3WA 4BDMA 4RK9A 5KCJB 4XKNA 1VSOA 3SEVA 1UIVA 5DVIA 1JEUA 1TFDA 3O29A 4JWXA 3MYUA 2PFZA 1B7HA 4XF5A 4UA8A 3PUXE 1MY1A 5EQ7A 3EQ1A 2B3BA 3UK4A 1M5EA 3S2VA 1SI1A 3SEYA 4MJOA 3PMVA 4C1TA 2VPOA 2A5TB 4YKIA 3KBRA 3R6UA 3KN8A 3D1RA 4GIZA 1SW1A 4DDDA 3RNNA 1IMEA 2VGQA 1NH7A 3ECRA 4IO4A 1NNPA 3UORA 5ISUA 4U22A 3U8QA 5IGAA 1MY0A 5B7DA 1MG1A 4H65A 3BBRA 4MX6A 3RT6B 2FBPA 4KQPA 3TTMA 1ZKBA 3E3KA 2H4IA 5I59B 1B3HA 4MEVA 5IZZA 3MUQA 4POXA 2DWJA 4OFOA 3O6GA 4ZEDA 1MM6A 3PPPA 4ZEFA 4GVOA 1POTA 2VP1A 3E4RA 4MAGA 4F29A 1B4HA
chains in the Genus database with same CATH topology
5EQ8A 4OVSA 3KC1A 3B8BA 1FPBA 2FHYA 2XWKA 2GQ1A 4OVRA 1DBZA 3BIGA 2HXRA 4HCWA 4PBQA 2FVZA 3IFAA 1NUYA 1FRPA 3QMFA 4GWXA 3W9VA 2OWZA 2Q74A 2B4LA 2WYPA 3NOHA 5IZ3A 2DDKA 4GBWA 2WEFA 4PF8A 2HZLA 1K9YA 5J1DA 4PGNA 4NGUA 4H46A 5EYGA 5JK4A 1EYIA 4X9TA 4PF6A 2ZZXA 3E79A 2CEYA 4PE3A 1QGXA 2CZIA 2BJIA 1IMFA 1RDYA 4PETA 2XA5A 4JVCA 5J16A 4I3YA 2QPQA 4PFRA 5EYHA 2ZZWA 2FIXA 5ET7A 4GX4A 2WBBA 1FPDA 2CZHA 1FPFA 3MSTA 4PAIA 1FPIA 5ET5A 3CHGA 4P1EA 2XXKA 4GWZA 1NV5A 1DCUA 1FBCA 2XWVA 2WYKA 1LBWA 4MHFA 4YZZA 3T0JA 3EKIA 2KQZA 3T1BA 2MKZA 2DVZA 1FBPA 1D9QA 4P1LA 5IZ3B 1YXIA 1FTAA 2QVUA 1FPEA 4IR8A 1KA1A 1DK4A 2L5VA 4NHBA 1EYJA 4MNCA 1INPA 4P3LA 4PCDA 1K9ZA 4MIJA 1JP4A 4N6KA 4N4UA 2V3QA 3GYYA 4OA4A 4GWUA 4GBVA 3BIHA 2Q9TA 4PDDA 4PDHA 3RYDA 4NF0A 4FBPA 1FJ9A 4PC9A 2WBDA 4MNPA 4HCYA 4N91A 1FPGA 4KXPA 2JJKA 3HFUA 3W9WA 2F5XA 4MMPA 5DW8A 3KBZA 4YICA 5I7IA 2V4CA 2HHMA 1XI6A 1FBDA 3FBPA 2QFLA 5LTCA 2CZKA 1KZ8A 4OVTA 4MCOA 1NI9A 5ESYA 1G0HA 4F19A 5ET6A 4PAKA 4PFBA 3LUZA 1BK4A 1RDXA 4NAPA 2XWOA 1FBGA 3U65A 3RPLB 1IMCA 5LDZA 1VDWA 1FPLA 4NG7A 1NUZA 4QXDA 4HE1A 3PTYA 1NV4A 4N81A 4P47A 1YZ0A 2DE4A 4JVIA 4X8RA 2P3NA 1FJ6A 2Y5LA 1IMAA 2HZKA 1LBYA 1FPKA 4AS4A 3E78A 2DE2A 4N17A 4PBHA 3IFCA 1KA0A 4N15A 1LBVA 5T3JA 4DI4B 2B4MA 4UABA 1EYKA 4H45A 2WX9A 4N8GA 2ZZVA 1NUWA 3KC0A 3RPLA 1Q9DA 3B50A 4GWSA 4OANA 5F24A 2PCRA 2KR0A 4PGPA 2HPGA 5I3SA 5IM2A 4X04A 4XFEA 4QBAA 4GWWA 4F18A 3SZPA 4GWYA 2VPNA 4OVPA 1NV0A 4LN5A 4PAFA 1G0IA 1FBFA 1NV2A 4OVQA 5A5LA 2QVVA 4O7IA 4XEQA 2CEXA 3LV0A 2OX3A 4AS5A 2P3VA 2VT5A 4GX3A 1CNQA 4NQ8A 1NV3A 1LBXA 4P8BA 2PFYA 2FIEA 2XWIA 4O8MA 1LBZA 1AWBA 1LEVA 4N8YA 4GX6A 4O94A 2F3BA 4MNIA 5FBPA 4PFIA 4JVDA 5ET8A 2DE3A 1YYZA 2R8TA 4O7MA 1IMDA 4HE2A 2F3DA 2Y5KA 4I3EA 3MYUA 2PFZA 1FPJA 4F1UA 4XF5A 4N6DA 4NN3A 5EQ7A 4G61A 2Q8MA 1NV7A 3A29A 5EQ9A 1NUXA 1RDZA 4MJOA 3ISPA 4F1VA 1FSAA 2VPOA 3FXBA 2QVRA 3D1RA 1FBEA 4P56A 4P9KA 4NX1A 1IMEA 3ROJA 5IGAA 1FBHA 4M1VA 4MX6A 2FBPA 4DI3D 1NV6A 4I40A 5I5PA 4MEVA 4HXVA 1SPIA 5IZZA 4PTKA 5CM6A 1IMBA 1NV1A 5EQAA 4MAGA 5IZ1A 4HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9Q A;  2FIE A;  5IZ3 B;  1YXI A;  1FTA A;  1NV4 A;  2QVU A;  1FPE A;  4IR8 A;  4N81 A;  5EQ8 A;  1LBZ A;  3KC1 A;  3B8B A;  1AWB A;  1LEV A;  1FPB A;  1KA1 A;  2FHY A;  1DK4 A;  2GQ1 A;  1DBZ A;  1EYJ A;  1YZ0 A;  4GX6 A;  2F3B A;  1INP A;  5FBP A;  3BIG A;  1K9Z A;  5ET8 A;  1JP4 A;  2P3N A;  1FJ6 A;  2Y5L A;  1IMA A;  1YYZ A;  1LBY A;  2FVZ A;  3IFA A;  2R8T A;  4GWU A;  1NUY A;  4GBV A;  3BIH A;  1FPK A;  1FRP A;  3QMF A;  1IMD A;  4HE2 A;  4AS4 A;  2F3D A;  2Y5K A;  4GWX A;  2OWZ A;  4I3E A;  3RYD A;  3IFC A;  2Q74 A;  1KA0 A;  1FPJ A;  1LBV A;  5T3J A;  4FBP A;  5IZ3 A;  2DDK A;  4GBW A;  2WEF A;  1FJ9 A;  5EQ7 A;  4G61 A;  2Q8M A;  1EYK A;  4H45 A;  1K9Y A;  1NV7 A;  4H46 A;  2WBD A;  1NUW A;  3A29 A;  5EYG A;  3KC0 A;  1FPG A;  5EQ9 A;  1EYI A;  4KXP A;  2JJK A;  1NUX A;  1RDZ A;  4MJO A;  1FSA A;  3RPL A;  1Q9D A;  1QGX A;  4GWS A;  5DW8 A;  2CZI A;  2BJI A;  5F24 A;  1IMF A;  3KBZ A;  2QVR A;  2PCR A;  3D1R A;  1RDY A;  1FBE A;  1IME A;  3ROJ A;  5J16 A;  4I3Y A;  2HHM A;  5I3S A;  1XI6 A;  1FBD A;  3FBP A;  5EYH A;  1FBH A;  2FIX A;  2QFL A;  4GWW A;  2CZK A;  5ET7 A;  1KZ8 A;  4GX4 A;  2FBP A;  4GWY A;  2WBB A;  1FPD A;  1NV6 A;  1FPF A;  2CZH A;  1NV0 A;  4I40 A;  1NI9 A;  5ESY A;  1G0H A;  1G0I A;  1FBF A;  1NV2 A;  1SPI A;  4HXV A;  5ET6 A;  1FPI A;  5ET5 A;  3LUZ A;  1BK4 A;  5A5L A;  4PTK A;  2QVV A;  4O7I A;  1RDX A;  3LV0 A;  4GWZ A;  1NV5 A;  2OX3 A;  1FBG A;  1DCU A;  1FBC A;  3RPL B;  4AS5 A;  1IMC A;  5LDZ A;  1LBW A;  1VDW A;  2P3V A;  1FPL A;  1IMB A;  1NV1 A;  5EQA A;  2VT5 A;  4GX3 A;  3T0J A;  1CNQ A;  1NV3 A;  1LBX A;  5IZ1 A;  1NUZ A;  4QXD A;  4HE1 A;  4HE0 A;  1FBP A; 
#chains in the Genus database with same CATH topology
 1PBQ A;  3TDJ A;  4NF8 B;  5EQ8 A;  4QFP A;  3MQ9 A;  4AB5 A;  3GZG A;  1FPB A;  3H6T A;  1LAH E;  4ECF A;  1M5D A;  2FNC A;  5HM4 B;  3FZV A;  4F3G A;  3HV1 A;  4Q8R A;  3PUY E;  1FRP A;  3QMF A;  2Y7K A;  2B4L A;  2V84 A;  2I6E A;  4ZZE A;  3NOH A;  1B6H A;  1B0L A;  2V3U A;  3T66 A;  5DVF A;  1K9Y A;  3FJ7 A;  5J1D A;  3PUV E;  5H8H A;  2ZNT A;  4QSC A;  2GH9 A;  5JK4 A;  5DEX A;  1B3G A;  4EQ7 A;  1MQH A;  4WEP A;  2I58 A;  2DXY A;  3PU5 A;  4OMB A;  3MC2 A;  4I9D A;  4RA1 A;  2CZI A;  4ZDM A;  2AL5 A;  3H6V A;  4HS7 A;  2QS3 A;  4JVC A;  5J16 A;  3IB0 A;  1N76 A;  4JXI A;  3L6H A;  1BLF A;  1FQA A;  4G4P A;  5DVJ A;  3TTK A;  1P1Q A;  2I4C A;  2FIX A;  2XX9 A;  2E1S A;  4EF1 A;  2PX1 A;  4GXS B;  2F36 A;  5H8Q A;  2F34 A;  4E0W A;  1MS7 A;  1URD A;  5HBC A;  2B3F A;  2WBB A;  4ESX A;  2H5Y A;  1JW4 A;  3OSR A;  4KI0 E;  1SW5 A;  5AA4 B;  3LSF B;  3EN3 A;  2XXK A;  4FOR A;  3TTR A;  4NF5 B;  2QMX A;  5FHM A;  2WYK A;  3A3U A;  1MXV A;  4HW8 A;  3VV5 A;  4UAC A;  2GFE A;  1FBP A;  4P1L A;  2HQ0 A;  1FCK A;  1NNF A;  2DWH A;  1R1N A;  2E0S A;  2H98 A;  4ZEK A;  3OEM A;  4OVJ A;  4H1X A;  3GLB A;  4IGT A;  4IO2 A;  1B2H A;  2UXA A;  4GL8 A;  1PEB A;  1JVX A;  4N4U A;  1ZU0 A;  1USY E;  1OMP A;  4H8J A;  3BIH A;  1PBP A;  1XVX A;  2O6A A;  2Q9T A;  1M5C A;  3SKP A;  1JW5 A;  1MH4 A;  3TOD A;  5H8N B;  4NF0 A;  4FBP A;  1A7L A;  4P0I A;  1MH3 A;  3HCQ A;  4KYD A;  3VVE A;  4MNP A;  4HCY A;  3OMB A;  4KXP A;  1HSL A;  4DXC A;  3IL1 B;  3IO4 A;  3IK6 B;  2YJP A;  4MMP A;  2I49 A;  3DP8 A;  4Z0I A;  3KBZ A;  4YIC A;  5FHN A;  3TQW A;  3VVF A;  3ILT B;  3KFM A;  1LBC A;  4GL0 A;  3EHT A;  3V5A A;  2O69 A;  1Y4T A;  2DP8 A;  4PFW A;  3U94 A;  1NI9 A;  4F19 A;  3LSX A;  2XXV A;  3LUZ A;  4PQJ A;  4NF4 B;  4OFJ A;  3T22 A;  2XXT A;  4JB7 A;  1FBG A;  3RPL B;  3CFX A;  2RC7 A;  1IMC A;  5LDZ A;  5TP9 A;  4QFO A;  1D4N A;  4ELO A;  4QFN A;  2O84 X;  4GD5 A;  3C33 A;  3PGF A;  1SD3 A;  3QSL A;  3PTY A;  3CSB A;  4N81 A;  1IQ7 A;  4PP0 A;  2AIX A;  4DCX A;  1B52 A;  3WAE A;  4P47 A;  2REG A;  1MXX A;  3N6U A;  5CI5 A;  2G29 A;  5HPQ A;  1Y3P A;  5CBS A;  2H9B A;  1P1N A;  4DXU A;  3FXR A;  1Y9U A;  4LZ8 A;  2HZK A;  4LQ5 A;  1LB8 A;  3KJ7 A;  5B70 A;  2DE2 A;  2Q88 A;  4PBH A;  4U1O A;  4U1Z A;  2PT2 A;  4DI4 B;  4GLI A;  2Z23 A;  4C1U A;  4UAB A;  1EYK A;  4H45 A;  2WX9 A;  2IA4 A;  2XX7 A;  2ZZV A;  1NUW A;  4GQO A;  2WKY A;  2ABH A;  1QUJ A;  3PUW E;  1QUK A;  2OPE A;  1S50 A;  4GWS A;  1WVJ A;  5ITO A;  5I58 A;  4JSD A;  5F24 A;  4M4G A;  1US4 A;  2PCR A;  1IXH A;  2Y7R A;  4PGP A;  1EH3 A;  4X04 A;  4F18 A;  3SZP A;  3VVD A;  3IJX B;  4GWY A;  1N04 A;  4OVP A;  1NV0 A;  3V83 A;  5BWJ A;  4PFY A;  1NV2 A;  4OFL A;  3K6W A;  1SW4 A;  4OQO A;  4LQ2 A;  1NNT A;  3LV0 A;  2OX3 A;  4ISU A;  4Z7E A;  4KYS A;  2VT5 A;  1MPD A;  3KSX A;  1D3K A;  2PFY A;  2RC8 A;  3KJT A;  2XWI A;  4XKR A;  5JTY A;  3CIJ A;  2D3I A;  2F7B A;  4MNI A;  3T9U A;  3TPA A;  1LAF E;  2THI A;  4F39 A;  1QKB A;  4RJZ A;  1DTG A;  3S9L C;  3UGW A;  4OET A;  2Y7I A;  2F97 A;  5A5X B;  4KR5 A;  4O7M A;  1IMD A;  3LUY A;  4HE2 A;  2F3D A;  4R2B A;  3FVO A;  3MW0 A;  3B6W A;  3MAM A;  4YKP A;  4KFQ A;  4N6P A;  1M5F A;  4N6D A;  2ZNU A;  2YLN A;  4NN3 A;  1YTV A;  4Q0C A;  3ZKK A;  4G61 A;  1Q35 A;  3MWB A;  1Y3N A;  3TMG A;  1MRP A;  5AA2 B;  3A29 A;  4P11 A;  5L8D A;  1LFI A;  3ISP A;  4F1V A;  1FSA A;  1ZMG A;  3WAF A;  4OXV A;  1SI0 A;  3ONM A;  1SBP A;  3K2D A;  4XXU A;  3H4Z A;  2QVR A;  1YCJ A;  1PC3 A;  3CFZ A;  3ROJ A;  3PUZ E;  1I6B A;  1LCT A;  1Y1M A;  3EF7 A;  1SVX B;  4BDQ A;  3CG3 A;  3LSW A;  1YPN A;  3TEL A;  4I62 A;  4DI3 D;  3B6T A;  1NV6 A;  4I40 A;  3TZA A;  2DSF A;  2VHA A;  1B32 A;  5H8H B;  4ZEC A;  3OO7 A;  5DEX B;  2G93 A;  3M8U A;  3Q25 A;  3TQL A;  4BLA A;  1LGB C;  3U92 A;  1PB9 A;  1L5T A;  2QS1 A;  5M2V A;  5IZ1 A;  5I84 A;  5ICQ A;  3FXU A;  3OOA A;  4OHN A;  2FHY A;  2RC9 A;  4WXJ A;  2FYI A;  4OEV A;  5H8Q B;  2GQ1 A;  4MF3 A;  4YMA A;  1UQW A;  3FGS A;  3LBS A;  2F8D A;  3OXN A;  1IXG A;  2Q2C A;  4NF6 B;  5CBR A;  4AB6 A;  2GRV A;  3IFA A;  4IO5 A;  4GWX A;  3FJG A;  2OWZ A;  3C35 A;  3TTN A;  2Q89 A;  3JZJ A;  5FTH A;  3TYH A;  2WEF A;  3P7I A;  3H3G A;  4NGU A;  1MQG A;  4H46 A;  5L9O A;  4F3B A;  2PBW A;  1EYI A;  2XD2 A;  2XXH A;  3CFL A;  4PF6 A;  1FTM A;  1FTO A;  2R6G E;  3MP1 A;  2P0S A;  3G3J A;  4WKM A;  1IMF A;  1O64 A;  3FXQ A;  3KGC A;  4OEN A;  2DWA A;  3C4M A;  1SYH A;  5EYH A;  2ZZW A;  3HO7 A;  3R7X A;  5ET7 A;  4TLL B;  4GX4 A;  2XXR A;  2V25 A;  1FPD A;  3TCH A;  2AL4 A;  5KZT A;  3HN0 A;  1II5 A;  2RKM A;  5ET5 A;  1OVB A;  3TCF A;  1SW2 A;  4MLV A;  4LUB A;  3MPK A;  2I3V A;  4OZ9 A;  1PDA A;  4YZZ A;  4IGR A;  3ILU B;  3EKI A;  3EHS A;  2KQZ A;  1H45 A;  3T1B A;  2I3W A;  2ZYO A;  2DVZ A;  1D9Q A;  5IZ3 B;  1YXI A;  1BP5 A;  2QVU A;  1KA1 A;  4G8H A;  2L5V A;  5AA1 A;  3M3K A;  3IAZ A;  3VXC A;  4H8I A;  4MIJ A;  1JP4 A;  5I2N B;  1Y4C A;  4QF9 A;  3MVZ A;  2V3Q A;  4IO6 A;  3GYY A;  4OA4 A;  1OQH A;  4NWC A;  4BDN A;  1XHY A;  4YU0 A;  5CMB A;  1JET A;  4O3A A;  5TP9 B;  1MPB A;  2X7Q A;  4RPO A;  4IY6 A;  4ZZA A;  1FJ9 A;  2OLB A;  4PC9 A;  4ESW A;  3MBP A;  3N94 A;  4FAT A;  4K3F A;  4OEU A;  2JJK A;  1Y20 A;  3VDF A;  3VLU A;  3K6X A;  3DM0 A;  2UVI A;  1CE2 A;  3QYT A;  4PFT A;  2D5W A;  4PFU A;  5I7I A;  3MVW A;  5FTI A;  2HHM A;  1UTB A;  1FBD A;  3O28 A;  1DOT A;  3U93 A;  2QFL A;  4F2Q A;  1KZ8 A;  3FV1 A;  4OVT A;  1Y1Z A;  1POY 1;  3ODB A;  1M5B A;  5AE4 A;  4PFB A;  2XD3 A;  4NAP A;  4OTE A;  2DYX A;  1VR5 A;  3VFJ A;  2IEE A;  2REJ A;  5I58 B;  4NG7 A;  5I2K A;  3UA8 A;  4HE1 A;  3IB2 A;  5F7V A;  1ZBM A;  3JYR A;  1UTH A;  4FEB A;  1NV4 A;  4G68 B;  4FED A;  4X1B A;  4AQ4 A;  3E9X A;  4R6K A;  3IO6 A;  4BDL A;  4LP2 B;  1OIB A;  1IIW A;  3UP9 A;  4FE8 A;  1FJ6 A;  1USY H;  2I4B A;  1TFA A;  3V89 B;  4LAT A;  1LAG E;  1B5I A;  5L9S A;  4EXL A;  2OK2 A;  1XOC A;  4HTG A;  3S9E A;  3OO8 A;  1MQD A;  1KA0 A;  3IOV A;  3MZ9 A;  1JVY A;  4U23 A;  3FVN A;  3RUM A;  1TXF A;  3Q27 A;  5JTY B;  3K6V A;  1D9Y A;  5I57 A;  1AH5 A;  1A8E A;  4E0X A;  3W15 C;  1Q9D A;  1AL3 A;  4OAN A;  4EXK A;  3IR1 A;  2XXI A;  5I3S A;  2UVG A;  3OO9 A;  4XFE A;  4GWW A;  3RPW A;  3V8X B;  1O63 A;  3K02 A;  5F1Q A;  1MY2 A;  4NMY A;  2NVU B;  4LN5 A;  4OVQ A;  3T9H B;  3G7W A;  1B9J A;  2XXY A;  3TEP A;  2P3V A;  4GX3 A;  2HFB A;  1NV3 A;  1FQB A;  1A8F A;  3C32 A;  3CG1 A;  3I5O A;  3M3F A;  4O8M A;  2XXQ A;  4ELR A;  1B46 A;  2DOJ A;  2DQV A;  3T9V A;  3N5L A;  2X7P A;  5I59 A;  4JVD A;  2DE3 A;  3ZS6 A;  4GOT A;  4R9G A;  1IXI A;  5IKB A;  3IOT A;  1ZJL A;  1A55 A;  4C0R A;  5CMK A;  2Y5K A;  3SEX A;  4I3E A;  2HXW A;  5I56 B;  3THI A;  1R6Z A;  4F1U A;  1HSE A;  2Y7W A;  1MM7 A;  3G3H A;  2ONR A;  5CMC A;  2AYS A;  2QS4 A;  2Q8M A;  1NV7 A;  3S4U A;  3DP6 A;  3IOW A;  2UYE A;  3RLF E;  4LZ7 A;  3RT8 A;  2UVJ A;  3FXB A;  3PPR A;  3R26 A;  1FBE A;  1SDX A;  4P56 A;  1MDQ A;  4R9F A;  3SEW A;  3MP8 A;  1Z7M E;  3EPE A;  3KN3 A;  1DPE A;  3KG2 A;  1URS A;  4RPN A;  1FBH A;  5CRY A;  1PB8 A;  4I8C A;  3CRB A;  3M3L A;  1MDP 1;  4HXV A;  3C9H A;  2I48 A;  2OBG A;  4PTK A;  2Y7P A;  2ANJ A;  3TUS A;  1NFT A;  4NTL A;  4THI A;  1EZP A;  1EU8 A;  4RK2 A;  5EQA A;  2P2A A;  1US5 A;  3PD9 A;  4QFL A;  4HE0 A;  2PVU A;  1RKM A;  2ZYM A;  5H8F A;  2P1S A;  3MZ1 A;  4OVS A;  3KC1 A;  3B8B A;  2XWK A;  4F3S A;  3T96 B;  4OVR A;  1DBZ A;  1S9T A;  1NKX A;  1T0K A;  1I6A A;  3GBB A;  2HXR A;  4KHZ E;  4MLQ A;  4BDR A;  4DZ1 A;  4PBQ A;  4L17 A;  4JDF A;  2FVZ A;  2NXO A;  1NUY A;  1BIY A;  3PMW A;  3W9V A;  4DE8 A;  4YMB A;  4LA9 A;  4WED A;  2DWI A;  4JWO A;  3OEN A;  2DDK A;  2HZL A;  2OWT A;  2X26 A;  4R74 A;  4IO7 A;  5EYG A;  3ZSF A;  3IOR A;  5AA3 A;  2ZZX A;  3PPO A;  3E79 A;  2CEY A;  5EYF A;  4X48 A;  4PE3 A;  5CMM A;  1TWY A;  3FAT A;  3G3K A;  4R72 A;  2VD2 A;  4IY5 A;  3FJM A;  3KZG A;  5K2Y A;  2XA5 A;  4IB2 A;  4I3Y A;  2O7I A;  1OLA A;  1B1X A;  4G2Z A;  4JBZ A;  4NWD A;  5IAI A;  3H6W A;  1LBB A;  3ZKL A;  2VD3 A;  5TPA A;  2CZH A;  4PAI A;  2ZNS A;  1QW0 A;  3KOS A;  2V93 A;  4GWZ A;  5ITP A;  1DCU A;  1P1W A;  1FBC A;  5EHM A;  2XXX A;  3LC8 A;  3A09 A;  3I6V A;  3S9N C;  5L9M A;  1GTK A;  2MKZ A;  3HHF A;  1CB6 A;  1UTB B;  3TCG A;  4IR8 A;  4LZ5 A;  1LCF A;  1J1N A;  3K1P A;  1DK4 A;  5K2X A;  1FQD A;  2H25 A;  4NHB A;  1B3L A;  2Z8F A;  4FJP A;  1FQE A;  2OWS A;  2F35 A;  4P3L A;  3VXB A;  3QXM A;  4N6K A;  1JEV A;  3MPL A;  4NF4 A;  1B58 A;  4GWU A;  4GBV A;  3VE1 B;  5DT6 A;  2XXP A;  3IJO B;  4KPT A;  4PDH A;  3VLW A;  4U4X A;  3RYD A;  2Y84 A;  3U72 A;  1N3X A;  2I0B A;  3QIM A;  1QVS A;  2HAV A;  4ZEB A;  4N13 A;  3T9X B;  4FAJ A;  2QJE A;  2Z22 A;  1FPG A;  3W9W A;  1ELJ A;  5DW8 A;  1ZTY A;  4GRK A;  1Z7N E;  2GHA A;  4R75 A;  4NE4 A;  4PE5 B;  3FBP A;  3BFU A;  2F7C A;  1EZO A;  3LR1 A;  4MCO A;  2O1L A;  4F3P A;  3U1O A;  5ESY A;  5ET6 A;  2NWJ A;  1AOV A;  1OVT A;  5I57 B;  5EHS A;  4R6Y A;  3C31 A;  4JWY A;  4H0W A;  1VDW A;  1FQC A;  1WDN A;  1JQF A;  1JW1 A;  4KD5 A;  3C34 A;  1LFH A;  1NUZ A;  1N7X A;  4QXD A;  4R73 A;  1FTK A;  2ZMB A;  4ELP A;  1LAX A;  4H67 A;  3TFL A;  1IZ1 A;  3O2A A;  2OZZ A;  3I3V A;  3CI8 A;  3HST A;  2ALU A;  1NL5 A;  1YZ0 A;  3O66 A;  2M8C A;  2DE4 A;  1VE4 A;  4JVI A;  4X8R A;  1XC1 A;  4F22 A;  3PD8 A;  3H7M A;  2P3N A;  2Y5L A;  3O6I A;  3A3C A;  4JSO A;  4X1D A;  3RY3 A;  1LBY A;  3QUF A;  1FPK A;  2I0C A;  3FIR A;  4OYV A;  2R9J A;  4N17 A;  3H03 A;  3PMX A;  4YAH X;  5TU0 A;  3DP4 A;  2B4M A;  3FV2 A;  2NOO A;  2W7Y A;  3PV0 E;  2LAO A;  1B4Z A;  3QUJ A;  4QSD A;  3KC0 A;  2Q2A A;  1NMU A;  4IO3 A;  3Q29 A;  3EHU A;  2Q8J A;  2QRY A;  1R9Q A;  1N7W A;  4OER A;  2KR0 A;  5A5X A;  1OQG A;  2HPG A;  5IM2 A;  1GV8 A;  4R6H A;  4QBA A;  1MXW A;  1RYX A;  2RCA A;  2OJT A;  3SDF A;  5LOM A;  1FBF A;  5AA2 A;  2QVV A;  4O7I A;  2O51 A;  2DVC A;  2CEX A;  3TKD A;  1N0T A;  3FD3 A;  1CNQ A;  4NQ8 A;  3MJN A;  4ND9 A;  1FQF A;  1EZ9 A;  3UIF A;  5ICT A;  2FIE A;  2HAU A;  3D4C A;  3K00 A;  2CMO A;  4MFI A;  4KCD A;  4KYE A;  4N8Y A;  4O3B A;  5BUU A;  1LFG A;  4GX6 A;  1RYO A;  2F3B A;  5FBP A;  2ZYN A;  4G77 A;  4N07 A;  1P1O A;  2PT1 A;  3Q26 A;  1XT8 A;  1YYZ A;  1B0H A;  2R8T A;  4POW A;  1MXZ A;  1DPP A;  4EQB A;  1FPJ A;  4TQU Q;  3SES A;  1UIU A;  5H8F B;  4F1Y A;  2OPD A;  4G8M A;  5EQ9 A;  1Q1K A;  1NUX A;  1RDZ A;  3F11 A;  1ANF A;  4ELQ A;  4NF6 A;  4P9K A;  4NX1 A;  2UVH A;  3G3G A;  5KDT A;  1MXU A;  4M1V A;  1PB7 A;  3OD7 A;  3USD A;  3FAS A;  1ZIU A;  4QRZ A;  2XXW A;  4FEC A;  2HCA A;  5I5P A;  3MVX A;  1SPI A;  1IUD A;  5KCJ A;  1D9V A;  2ONK E;  3K0V A;  3D4G A;  5CM6 A;  2H99 A;  1IMB A;  1NV1 A;  1SYI A;  3BFT A;  4GXA A;  5CC2 A;  3CR9 A;  3O9P A;  4TLM B;  3VLV A;  4I1D A;  4MH5 A;  4F2O A;  3TTL A;  2QSX A;  2RF1 A;  5TPA B;  4Q5T A;  3BIG A;  3RQT A;  1QUI A;  2ZYK A;  4DIG A;  2NUV A;  1H44 A;  2A5T A;  3H6U A;  4G68 C;  4HCW A;  4YB7 A;  3RTF B;  2D21 A;  1YAE A;  1URG A;  1XVY A;  3BKI B;  4ZEI A;  4H5F A;  4OWD A;  2F6P A;  1GVC A;  3H06 B;  3PPQ A;  4EF2 A;  2Q74 A;  2WYP A;  4G8N A;  3KOT A;  5IZ3 A;  4GBW A;  4PF8 A;  1B3E A;  1B05 A;  2R71 A;  3HHG A;  4PGN A;  4FIM A;  1HSJ A;  3O97 A;  2RCB A;  1QJM A;  1H3D A;  4X9T A;  3SER A;  4QHQ A;  5I2N A;  3CSG A;  1QGX A;  4LVQ A;  2BJI A;  1RDY A;  4PET A;  4U2R A;  1A40 A;  4BDO A;  2QPQ A;  1MQJ A;  4PFR A;  4NF8 A;  1VFD A;  4R2F A;  2CZL A;  2QS2 A;  3KSJ A;  3IX1 A;  2ONS A;  4RXL A;  1FPF A;  3G3I A;  3MST A;  5DYH A;  3RTW B;  1FTL A;  3RGY A;  1FPI A;  3CHG A;  4YKJ A;  5JEI A;  1KWH A;  4P1E A;  4RNS A;  2A5S A;  3HPI A;  2F6G A;  1A99 A;  1NV5 A;  3N26 A;  2XWV A;  1LBW A;  1IXC A;  4EUO A;  4MHF A;  3T0J A;  4DXB A;  1LB9 A;  4YKK A;  1GGG A;  3B7D A;  2O68 A;  1B3F A;  3TAJ A;  1FTA A;  1FW0 A;  1FPE A;  4YB5 A;  2PMS A;  1LST A;  1EYJ A;  4MNC A;  1INP A;  1AIV A;  4PCD A;  1K9Z A;  4QFK A;  1OLC A;  1DSN A;  3K4U A;  4PDD A;  1NNK A;  3KN7 A;  4EQ9 A;  3MP6 A;  4XKP A;  2RIN A;  3RN8 A;  4QSE A;  4G68 A;  4ZS9 A;  2WBD A;  4KCC A;  5AA4 A;  4XKQ A;  3FVG A;  4N91 A;  2O7U A;  4Q30 B;  4NF5 A;  3HFU A;  1WOD A;  2UYF A;  2F5X A;  4XIG Q;  1P1U A;  4F31 B;  1B7Z A;  1IIT A;  2V4C A;  4H5G A;  1XI6 A;  4DLD A;  3OO6 A;  5LTC A;  2CZK A;  3O6H A;  3MVY A;  2GHB A;  1B51 A;  1B5H A;  2DXR A;  3OEL A;  1MY3 A;  2ZXT A;  1G0H A;  3OSQ A;  1NH8 A;  4PAK A;  1BK4 A;  4ZE9 A;  4ONY A;  4MBP A;  1RDX A;  2PYY A;  2XWO A;  1B5J A;  2Z8E A;  3OEK A;  4RYA A;  2Z8D A;  4U4S A;  3U65 A;  3QAX A;  1FPL A;  1DMB A;  1AMF A;  3UN6 A;  1B7U A;  3T93 B;  3PPN A;  5H8N A;  1I69 A;  1IEJ A;  3N6T A;  2ESN A;  1B40 A;  3JV9 A;  1TT1 A;  3KEI A;  4P0G A;  1R9L A;  3S9M C;  3G3F A;  2F78 A;  1BKA A;  3Q28 A;  2FA7 A;  4XTC Q;  2DS9 A;  4YB6 A;  1IMA A;  3DEL B;  1O7T A;  1Y3Q A;  2QL3 A;  4GF8 A;  4GWO A;  1H43 A;  4AS4 A;  3E78 A;  3IB1 A;  3AXF A;  3IFC A;  2XX8 A;  4O3C A;  4N15 A;  2B65 A;  2YPN A;  2KLF A;  1LBV A;  3FUZ A;  5T3J A;  1I6Q A;  4DCY A;  2F7A A;  2OCU A;  1A54 A;  1BTJ A;  1P99 A;  3E13 X;  1DTZ A;  1MXY A;  3SEU A;  3IOU A;  4N8G A;  1LLS A;  5AA2 D;  3K6U A;  3LSL A;  1B1H A;  1S7Y A;  2HEU A;  3K01 A;  1XS5 A;  3CVG A;  1QKA A;  3FVK A;  3MZB A;  3RPL A;  3QK6 A;  3B50 A;  4NED A;  4EDP A;  3K1N A;  4TOZ A;  4LON B;  3B6Q A;  1N84 A;  5I2K B;  4H6D A;  5ELV A;  2XXU A;  4OES A;  1H76 A;  3L6G A;  1UTH B;  3GBA A;  1FTJ A;  1QUL A;  5I56 A;  3SET A;  1F9B A;  1ZLQ A;  2XHD A;  2VOZ A;  2VPN A;  2O1M A;  1MY4 A;  5DTB A;  4PAF A;  1G0I A;  1MPC A;  3GXA A;  5A5L A;  3C36 A;  1ATG A;  4U21 A;  1VFE A;  4XEQ A;  4GFR A;  2V3T A;  4AS5 A;  1JNF A;  1GR2 A;  2BJJ X;  2QMW A;  1LBX A;  4ZE8 A;  4P8B A;  5H8S A;  1LBZ A;  1SQY A;  1AWB A;  1LEV A;  5KDT B;  3K1M A;  4O94 A;  4PFI A;  5FHO A;  5ET8 A;  3DLN A;  1MQI A;  4RY1 A;  1N3W A;  4BDM A;  4RK9 A;  5KCJ B;  4XKN A;  1VSO A;  3SEV A;  1UIV A;  5DVI A;  1JEU A;  1TFD A;  3O29 A;  4JWX A;  3MYU A;  2PFZ A;  1B7H A;  4XF5 A;  4UA8 A;  3PUX E;  1MY1 A;  5EQ7 A;  3EQ1 A;  2B3B A;  3UK4 A;  1M5E A;  3S2V A;  1SI1 A;  3SEY A;  4MJO A;  3PMV A;  4C1T A;  2VPO A;  2A5T B;  4YKI A;  3KBR A;  3R6U A;  3KN8 A;  3D1R A;  4GIZ A;  1SW1 A;  4DDD A;  3RNN A;  1IME A;  2VGQ A;  1NH7 A;  3ECR A;  4IO4 A;  1NNP A;  3UOR A;  5ISU A;  4U22 A;  3U8Q A;  5IGA A;  1MY0 A;  5B7D A;  1MG1 A;  4H65 A;  3BBR A;  4MX6 A;  3RT6 B;  2FBP A;  4KQP A;  3TTM A;  1ZKB A;  3E3K A;  2H4I A;  5I59 B;  1B3H A;  4MEV A;  5IZZ A;  3MUQ A;  4POX A;  2DWJ A;  4OFO A;  3O6G A;  4ZED A;  1MM6 A;  3PPP A;  4ZEF A;  4GVO A;  1POT A;  2VP1 A;  3E4R A;  4MAG A;  4F29 A;  1B4H A; 
#chains in the Genus database with same CATH homology
 5EQ8 A;  4OVS A;  3KC1 A;  3B8B A;  1FPB A;  2FHY A;  2XWK A;  2GQ1 A;  4OVR A;  1DBZ A;  3BIG A;  2HXR A;  4HCW A;  4PBQ A;  2FVZ A;  3IFA A;  1NUY A;  1FRP A;  3QMF A;  4GWX A;  3W9V A;  2OWZ A;  2Q74 A;  2B4L A;  2WYP A;  3NOH A;  5IZ3 A;  2DDK A;  4GBW A;  2WEF A;  4PF8 A;  2HZL A;  1K9Y A;  5J1D A;  4PGN A;  4NGU A;  4H46 A;  5EYG A;  5JK4 A;  1EYI A;  4X9T A;  4PF6 A;  2ZZX A;  3E79 A;  2CEY A;  4PE3 A;  1QGX A;  2CZI A;  2BJI A;  1IMF A;  1RDY A;  4PET A;  2XA5 A;  4JVC A;  5J16 A;  4I3Y A;  2QPQ A;  4PFR A;  5EYH A;  2ZZW A;  2FIX A;  5ET7 A;  4GX4 A;  2WBB A;  1FPD A;  2CZH A;  1FPF A;  3MST A;  4PAI A;  1FPI A;  5ET5 A;  3CHG A;  4P1E A;  2XXK A;  4GWZ A;  1NV5 A;  1DCU A;  1FBC A;  2XWV A;  2WYK A;  1LBW A;  4MHF A;  4YZZ A;  3T0J A;  3EKI A;  2KQZ A;  3T1B A;  2MKZ A;  2DVZ A;  1FBP A;  1D9Q A;  4P1L A;  5IZ3 B;  1YXI A;  1FTA A;  2QVU A;  1FPE A;  4IR8 A;  1KA1 A;  1DK4 A;  2L5V A;  4NHB A;  1EYJ A;  4MNC A;  1INP A;  4P3L A;  4PCD A;  1K9Z A;  4MIJ A;  1JP4 A;  4N6K A;  4N4U A;  2V3Q A;  3GYY A;  4OA4 A;  4GWU A;  4GBV A;  3BIH A;  2Q9T A;  4PDD A;  4PDH A;  3RYD A;  4NF0 A;  4FBP A;  1FJ9 A;  4PC9 A;  2WBD A;  4MNP A;  4HCY A;  4N91 A;  1FPG A;  4KXP A;  2JJK A;  3HFU A;  3W9W A;  2F5X A;  4MMP A;  5DW8 A;  3KBZ A;  4YIC A;  5I7I A;  2V4C A;  2HHM A;  1XI6 A;  1FBD A;  3FBP A;  2QFL A;  5LTC A;  2CZK A;  1KZ8 A;  4OVT A;  4MCO A;  1NI9 A;  5ESY A;  1G0H A;  4F19 A;  5ET6 A;  4PAK A;  4PFB A;  3LUZ A;  1BK4 A;  1RDX A;  4NAP A;  2XWO A;  1FBG A;  3U65 A;  3RPL B;  1IMC A;  5LDZ A;  1VDW A;  1FPL A;  4NG7 A;  1NUZ A;  4QXD A;  4HE1 A;  3PTY A;  1NV4 A;  4N81 A;  4P47 A;  1YZ0 A;  2DE4 A;  4JVI A;  4X8R A;  2P3N A;  1FJ6 A;  2Y5L A;  1IMA A;  2HZK A;  1LBY A;  1FPK A;  4AS4 A;  3E78 A;  2DE2 A;  4N17 A;  4PBH A;  3IFC A;  1KA0 A;  4N15 A;  1LBV A;  5T3J A;  4DI4 B;  2B4M A;  4UAB A;  1EYK A;  4H45 A;  2WX9 A;  4N8G A;  2ZZV A;  1NUW A;  3KC0 A;  3RPL A;  1Q9D A;  3B50 A;  4GWS A;  4OAN A;  5F24 A;  2PCR A;  2KR0 A;  4PGP A;  2HPG A;  5I3S A;  5IM2 A;  4X04 A;  4XFE A;  4QBA A;  4GWW A;  4F18 A;  3SZP A;  4GWY A;  2VPN A;  4OVP A;  1NV0 A;  4LN5 A;  4PAF A;  1G0I A;  1FBF A;  1NV2 A;  4OVQ A;  5A5L A;  2QVV A;  4O7I A;  4XEQ A;  2CEX A;  3LV0 A;  2OX3 A;  4AS5 A;  2P3V A;  2VT5 A;  4GX3 A;  1CNQ A;  4NQ8 A;  1NV3 A;  1LBX A;  4P8B A;  2PFY A;  2FIE A;  2XWI A;  4O8M A;  1LBZ A;  1AWB A;  1LEV A;  4N8Y A;  4GX6 A;  4O94 A;  2F3B A;  4MNI A;  5FBP A;  4PFI A;  4JVD A;  5ET8 A;  2DE3 A;  1YYZ A;  2R8T A;  4O7M A;  1IMD A;  4HE2 A;  2F3D A;  2Y5K A;  4I3E A;  3MYU A;  2PFZ A;  1FPJ A;  4F1U A;  4XF5 A;  4N6D A;  4NN3 A;  5EQ7 A;  4G61 A;  2Q8M A;  1NV7 A;  3A29 A;  5EQ9 A;  1NUX A;  1RDZ A;  4MJO A;  3ISP A;  4F1V A;  1FSA A;  2VPO A;  3FXB A;  2QVR A;  3D1R A;  1FBE A;  4P56 A;  4P9K A;  4NX1 A;  1IME A;  3ROJ A;  5IGA A;  1FBH A;  4M1V A;  4MX6 A;  2FBP A;  4DI3 D;  1NV6 A;  4I40 A;  5I5P A;  4MEV A;  4HXV A;  1SPI A;  5IZZ A;  4PTK A;  5CM6 A;  1IMB A;  1NV1 A;  5EQA A;  4MAG A;  5IZ1 A;  4HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...