3BIHA

Crystal structure of fructose-1,6-bisphosphatase from e.coli glpx
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
324
structure length
322
Chain Sequence
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSIHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase class II glpX
publication title Structural and Biochemical Characterization of the Type II Fructose-1,6-bisphosphatase GlpX from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 102
structure length 322
sequence length 324
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3bihA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3bihA02
1K9ZA 4GWYA 1RDXA 5ET5A 1FPIA 2F3BA 1YZ0A 2FVZA 1NUXA 1G0HA 2Q74A 3QMFA 4IR8A 2Q8MA 1DCUA 3BIGA 1IMDA 1FPJA 1FJ6A 2WEFA 4GBVA 1NUYA 1FPFA 1YXIA 1FSAA 4GX4A 2VT5A 4GX3A 1IMCA 1FRPA 4G61A 2GQ1A 2WBBA 2OX3A 1EYKA 2CZIA 4PTKA 2Y5KA 3B8BA 1FPDA 5LDZA 4MJOA 1NV0A 2P3VA 2P3NA 2QVVA 3T0JA 1QGXA 1NI9A 2FBPA 4AS5A 4I3YA 5EYGA 1RDZA 1DBZA 4N81A 2FHYA 5ET7A 1IMFA 4GWUA 2Y5LA 5J16A 4H46A 5ET6A 4O7IA 3RPLA 5ET8A 1NV7A 1RDYA 5F24A 1AWBA 2HHMA 2PCRA 4HE1A 1CNQA 2F3DA 3D1RA 1LBYA 1LBWA 4QXDA 1YYZA 5IZ3B 5T3JA 5IZ1A 4GX6A 1BK4A 1VDWA 5ESYA 4GWZA 5DW8A 1FPGA 3LV0A 1LEVA 1K9YA 5FBPA 5EQ7A 2QFLA 1FBHA 4KXPA 1KA0A 2JJKA 3KC1A 2FIEA 5IZ3A 4H45A 1JP4A 1SPIA 3BIHA 3LUZA 4HE0A 5EYHA 3IFAA 1FBCA 2QVUA 3RYDA 1FJ9A 4GWSA 5EQAA 1KZ8A 2CZHA 1NV3A 1D9QA 2R8TA 5A5LA 1KA1A 5I3SA 1FBEA 1IMAA 1FBDA 3ROJA 1LBXA 3KBZA 4GWWA 1XI6A 2BJIA 5EQ9A 2FIXA 2DDKA 4AS4A 1FBFA 1FBPA 4FBPA 1Q9DA 1INPA 1NV4A 4HXVA 3A29A 1EYIA 2CZKA 1FBGA 2OWZA 1IMEA 4GBWA 1IMBA 1LBVA 1NV2A 1FTAA 3FBPA 3KC0A 1EYJA 1FPBA 4I40A 1LBZA 5EQ8A 1NV1A 3IFCA 4HE2A 1NUZA 1NUWA 2QVRA 1FPLA 3RPLB 4GWXA 4I3EA 1FPKA 1NV6A 2WBDA 1FPEA 1DK4A 1NV5A 1G0IA
chains in the Genus database with same CATH superfamily
3MWBA 3RQTA 1RDXA 2FVZA 4LZ5A 1G0HA 2RKMA 1EZPA 1B3EA 4KD5A 1NNKA 1B6HA 4NF4A 3QUJA 5I57B 5H8NB 4GQOA 1JW1A 2F78A 2XXUA 3QUFA 5DEXA 4FIMA 4PAIA 3EF7A 3TQWA 2UYFA 1NL5A 4NE4A 4PAKA 2GH9A 5I2KA 4GWUA 3KOSA 3PPOA 4H6DA 2F35A 4QFKA 1FTJA 4X1DA 4G8HA 2A5TA 2HZLA 3H6TA 4XTCQ 5I58A 4NF6A 4F3GA 1LBWA 4HS7A 3SZPA 1B52A 2I49A 2R9JA 2I3WA 1MY4A 5FBPA 2XXYA 3RT8A 3KBRA 2Y7PA 3MW0A 1Z7ME 2AL5A 4BDRA 2XXKA 4F39A 1B46A 1LFGA 5CBRA 1J1NA 5LOMA 3QXMA 4OVSA 2VPOA 3V5AA 4H8IA 4IO6A 3MSTA 4QHQA 3QYTA 3O6HA 4GD5A 2W7YA 4PE3A 3QK6A 3E13X 1XI6A 3ECRA 3IB2A 3AXFA 2OPDA 1MPCA 3LUYA 3LBSA 4WEPA 2ZZWA 1FTAA 1UTHA 3IFCA 3CRBA 3B6TA 1Q35A 4QRZA 5JK4A 3WAFA 1SD3A 1H76A 1MQJA 2QJEA 3CG3A 4OVJA 2RINA 1VE4A 4YKPA 3DP8A 3C31A 3N6TA 3FZVA 5H8FB 4F3BA 1B0HA 2F7BA 4H5GA 1LAGE 4KHZE 4H67A 1EYKA 1P1QA 4MJOA 4N6DA 1SBPA 1UTBB 4XF5A 4R74A 4P9KA 2XXTA 4NGUA 3LC8A 4LUBA 4RK9A 2YPNA 2V4CA 4RPOA 4GFRA 2WKYA 2HHMA 3CFXA 1EU8A 3O66A 2HAVA 1B0LA 5DW8A 1R6ZA 4Q30B 2PYYA 1FBHA 4Z7EA 4KXPA 5I57A 1LAHE 5F7VA 5IZ3A 1Y3QA 2V25A 3RYDA 3TTRA 1OIBA 3ILTB 4ELRA 1XT8A 2KLFA 2CZHA 4G8MA 4NHBA 5M2VA 3DELB 1B58A 3I3VA 1GV8A 1FBDA 4LATA 4FBPA 3E3KA 3OXNA 4PDDA 2CZKA 1R9QA 2PBWA 1LBVA 3FJGA 1EYJA 4I40A 2DWAA 4HE2A 1NUWA 1XS5A 4I3EA 3KG2A 2GHBA 3I5OA 2D3IA 3C4MA 2R6GE 1NNTA 3BFTA 3R7XA 3PPPA 1OVBA 4NF8B 3KOTA 2P2AA 1WVJA 3G3IA 1CE2A 4PCDA 5FTHA 3VV5A 2ANJA 4I62A 4ELPA 1AH5A 2I48A 4IY6A 4P3LA 3P7IA 3FV2A 2DE2A 3MP6A 2DVCA 3IO4A 4PC9A 1NV7A 2ZYNA 4P8BA 1AIVA 1MXWA 2AYSA 3TODA 1OQHA 4NN3A 5DVJA 2PX1A 2I0CA 3TPAA 3PMVA 2ZNTA 3PD8A 1FCKA 2THIA 4DCYA 4MHFA 5ELVA 3OO6A 2FIEA 4H45A 1JVYA 1SPIA 3PV0E 3PPNA 3KN7A 4JB7A 4JSOA 5CC2A 3KFMA 4PE5B 1UTBA 2QS2A 4KQPA 5I59B 2I4BA 3LSFB 4P47A 3ZKKA 4LA9A 1EZ9A 4BDOA 3CHGA 1M5FA 1LBXA 3KBZA 1WODA 2BJIA 1QULA 4AS4A 1FBPA 2UVIA 2XX8A 2H98A 3KZGA 1I6QA 2QRYA 2RCAA 3H03A 4QSCA 3SESA 4H8JA 1A55A 2PFZA 3DP4A 5AA2B 5EQ8A 4C1UA 1B2HA 2QVRA 2ONKE 4G2ZA 3H06B 4GWYA 3TAJA 4IR8A 3G3JA 1XC1A 1QUKA 3IX1A 3O9PA 4F29A 1DCUA 4WXJA 4ELQA 1ZU0A 3IOUA 1SVXB 2WBBA 3RTFB 5EYFA 5CM6A 3OSQA 2FBPA 2ZNUA 4WKMA 1DBZA 2MKZA 4NTLA 2Z8DA 3RY3A 4O7IA 1RDYA 5LTCA 2WYKA 1P1OA 4GIZA 3KN3A 4GWOA 2F7AA 5DTBA 3S9EA 1VDWA 4YICA 4FEDA 4FATA 3OSRA 1AL3A 3O29A 2O69A 1XVYA 3LSWA 1FQFA 4N6PA 3LR1A 3T9UA 3KSXA 1DTZA 3UGWA 1MY0A 4F22A 3NOHA 2ZZXA 2Q89A 4DI3D 2VHAA 5IKBA 4TLLB 4OEVA 1N76A 2DWJA 1RKMA 3T9VA 3O6GA 1DPPA 1EYIA 3TMGA 3VLWA 3KJ7A 2D21A 4ESXA 2AIXA 2IA4A 4PDHA 3FBPA 3U93A 4OYVA 3PU5A 4ESWA 1I6BA 3IOVA 2E1SA 1YCJA 3TEPA 4THIA 2CMOA 4BDNA 1D4NA 4NF4B 1NV5A 5CMBA 3CSBA 2QMWA 4QFNA 2PMSA 1YZ0A 5DEXB 3C9HA 1B1XA 1JNFA 4R75A 3FASA 5A5XA 3C33A 2DE3A 3MVZA 1NNPA 1B7ZA 3MBPA 4EF1A 2A5TB 1BIYA 1HSEA 3C36A 5I58B 4NF6B 4G77A 3QIMA 1RDZA 1FQBA 3L6HA 3VE1B 4X8RA 4OFLA 4GVOA 1RYOA 1I6AA 4DXBA 2XWVA 1B3HA 2ZYKA 4POWA 3SEVA 4N8YA 4X1BA 1RYXA 1ZBMA 1H44A 4PFBA 4JWXA 2V3QA 3K6XA 3M8UA 4PF8A 5EYHA 3N6UA 1HSLA 5H8HA 4JDFA 4U4XA 4NG7A 3K6WA 3OMBA 5EQAA 4ND9A 1KZ8A 1HSJA 1PBPA 5ICQA 1UTHB 3RUMA 5H8SA 5B70A 1QUIA 1FTLA 2B4LA 4O3CA 1FBFA 4PBQA 3A29A 1LLSA 3IB0A 3HCQA 3JZJA 3PD9A 4PAFA 3SKPA 3GXAA 3OO7A 2VD2A 4Q8RA 2XX9A 4PQJA 2UYEA 4ZS9A 2WBDA 4OTEA 5DT6A 3RNNA 3MPKA 4QFOA 2Q74A 2V3TA 3GZGA 3BKIB 1ZJLA 4HCWA 5FHNA 1OLAA 1YXIA 3HSTA 1JETA 4OVQA 4YU0A 3C34A 3MVWA 5LDZA 1B5IA 2UVJA 1QGXA 4NF0A 1B40A 3E4RA 4OWDA 1B5HA 1LB9A 5B7DA 4I9DA 3QAXA 4OENA 3N5LA 5IZ3B 5IZ1A 4GX6A 4PF6A 2Y84A 4OXVA 1SW5A 4MEVA 3LV0A 2Q2AA 1NMUA 1B4ZA 2P1SA 1KA0A 4XKRA 3M3FA 3F11A 3JV9A 3LUZA 5KZTA 3UN6A 2QVUA 3ZSFA 4IGRA 3N94A 3MVYA 4QFLA 3EHTA 3R26A 1H3DA 2XXXA 3S9MC 1B9JA 5I3SA 1ZTYA 1FBEA 2G29A 1EZOA 4JVIA 2ONRA 4GRKA 5K2XA 5AA2D 1Q9DA 1INPA 2H4IA 1BP5A 5BWJA 3G7WA 2H5YA 2F8DA 1FPBA 5L9SA 1LBZA 1SYHA 2V93A 1QUJA 3BBRA 4U22A 2PT1A 1BTJA 2UVHA 4HE0A 3HV1A 2ZNSA 4YB5A 1G0IA 4KFQA 1K9ZA 3TDJA 5AA3A 4EQ7A 5TP9A 2DSFA 1XVXA 4LONB 1F9BA 1MH4A 3K6VA 3B6QA 3MZ9A 4F3PA 3HN0A 1B5JA 1OMPA 4OETA 4POXA 4GX4A 3VVEA 4F1UA 2L5VA 2GQ1A 1SW2A 4N6KA 1NV0A 2P3NA 4ZEKA 4DCXA 4Q5TA 4JWOA 5EYGA 2NWJA 3FIRA 5ET7A 1IMFA 1N3XA 4TLMB 1LSTA 2NVUB 3TCGA 4UABA 2VPNA 3V8XB 4RA1A 1FW0A 1CNQA 3K1PA 5JTYA 3JYRA 3G3FA 3MJNA 4F31B 4F1VA 2VP1A 4XFEA 3W9VA 3RN8A 3ONMA 3KN8A 4DIGA 4RK2A 2F36A 4IO3A 1JQFA 2QL3A 1B51A 4G4PA 2X7QA 1MY3A 3RLFE 5ITPA 2O6AA 1MQGA 1Y3PA 4HXVA 4R73A 1MPDA 4DZ1A 1S9TA 1QVSA 4QSEA 2XXVA 4ZZAA 1S50A 3RPWA 2Z8EA 3CR9A 3MAMA 4NF5A 2QMXA 1S7YA 4IO5A 3V89B 4DI4B 3KSJA 2REJA 4DXUA 1A8EA 3H7MA 3QMFA 4AQ4A 4OVRA 2XWKA 4P1EA 5KCJA 1NUYA 4PBHA 2B4MA 4G61A 2RC9A 3MC2A 4O8MA 3V83A 2FA7A 3OEKA 3TCHA 2DWIA 4OHNA 3RGYA 4C0RA 4RJZA 2O1MA 1US4A 3CVGA 1LCFA 2OPEA 3SDFA 3TTKA 3M3LA 1N7WA 3C35A 2XX7A 2DP8A 1PB9A 1H45A 3D1RA 5T3JA 4MBPA 2F5XA 4MLQA 4M1VA 4KCDA 3FXRA 3TQLA 4QF9A 4NEDA 3KC1A 3IO6A 4IO2A 1IZ1A 1P99A 4MFIA 1AOVA 1PB7A 4ZEBA 5DYHA 4EUOA 3G3GA 2F97A 1ZIUA 1KA1A 4R6KA 5IZZA 2R71A 4JBZA 1B05A 1SI0A 3B7DA 2B3FA 4N15A 2XA5A 3LSXA 1FTMA 1XHYA 3VFJA 3KC0A 1YPNA 1QKAA 1M5BA 1FQDA 3PUYE 2DYXA 2I0BA 2FNCA 1DK4A 1NNFA 5A5XB 2HFBA 5J1DA 2O7UA 4TOZA 2F3BA 1IEJA 3TTLA 2Q8MA 4LVQA 2OBGA 4NMYA 3HHFA 3FUZA 5I7IA 2O68A 4KCCA 2Y5KA 3EPEA 1R9LA 4N8GA 4X04A 4EXKA 3U1OA 3TZAA 3EQ1A 4FECA 1KWHA 3SERA 1Y1MA 2LAOA 5J16A 4KYEA 4H1XA 1Y20A 3DLNA 3UIFA 3CG1A 3TTMA 5HBCA 4Q0CA 5F1QA 3ODBA 1LBYA 1SYIA 4QFPA 1BK4A 5H8HB 3OENA 5IGAA 1LEVA 3K1MA 4U1ZA 2QFLA 1IITA 4PGNA 2V84A 2OZZA 5DVFA 1PC3A 4GLIA 3IOTA 3D4CA 5ISUA 2I6EA 3E79A 5AA4A 3C32A 3TELA 1B7UA 1NV3A 2REGA 4JWYA 4PFIA 4ZE9A 2R8TA 1ZMGA 1SQYA 5JEIA 2ZYOA 3H6UA 1O64A 2Z8FA 1MXXA 1NV4A 2F6PA 5DVIA 2Y7KA 4GBWA 4WEDA 4F18A 2FYIA 1UIVA 3N26A 3T9HB 1Y3NA 5I5PA 4OVTA 1FPLA 2ALUA 1DTGA 1IXCA 3VDFA 4ONYA 5CMMA 5CBSA 1IUDA 1A99A 3Q29A 2OWSA 3S4UA 3W15C 1FPJA 2D5WA 3FJMA 1NH7A 3Q26A 3K2DA 5HM4B 4ELOA 1FPDA 2DWHA 2Y7RA 1URDA 3PPRA 2XXIA 4PFTA 4EDPA 1YTVA 4U4SA 2UVGA 4NWDA 4MAGA 3T9XB 4O94A 1LAFE 5FTIA 3PMWA 1POY1 1DMBA 1L5TA 2Q88A 4KPTA 4LQ5A 1ZLQA 1IXIA 1M5DA 3RT6B 3TFLA 1LCTA 4XIGQ 3FXBA 4OZ9A 3PTYA 5IM2A 3VVFA 3S9NC 1URSA 4IY5A 5EQ7A 3H6WA 2NOOA 3CSGA 2QS4A 1A8FA 1M5EA 4PFUA 1FTKA 3G3KA 3GYYA 2ABHA 4MX6A 4P56A 1SW1A 4PP0A 4KYDA 4L17A 3PPQA 2IEEA 1DOTA 5BUUA 3ROJA 4YKJA 2Q2CA 3CIJA 2H9BA 3TUSA 1MQDA 4PFWA 4RPNA 2PT2A 5TU0A 2F7CA 2RC7A 2Q9TA 5TP9B 3IB1A 1WDNA 3O28A 1SI1A 3OD7A 4ZEDA 3OELA 4R2FA 5K2YA 3EN3A 4P0IA 2XXHA 2Y5LA 3TCFA 4XKQA 4PGPA 4I8CA 5CMCA 2ZMBA 1LBBA 1NH8A 1JVXA 1MQHA 4U1OA 1PBQA 3K1NA 5EHMA 3MPLA 5CRYA 2OX3A 1VFDA 4E0XA 4LZ8A 2P3VA 4NAPA 2ESNA 3MP8A 5JTYB 4R6YA 2FHYA 4U23A 4H46A 3EKIA 4ZEIA 2DS9A 1ANFA 1MDQA 1AWBA 2UXAA 3BFUA 3OOAA 4PETA 3T96B 2DOJA 4FJPA 4EQBA 1MXYA 2HEUA 3E78A 4FAJA 1GGGA 2VD3A 2JJKA 1VSOA 2HAUA 4LQ2A 4RXLA 3EHSA 1B3GA 3O6IA 4OERA 4X9TA 4LP2B 1URGA 3DM0A 2PVUA 1QW0A 1FQAA 4N91A 3FVNA 2I4CA 1POTA 2XHDA 3IR1A 3T93B 2OWZA 4NF5B 1TT1A 2VGQA 1M5CA 1NV2A 1DPEA 1VR5A 4GXSB 3PUWE 1SDXA 1MXVA 1NV1A 4R9GA 2I3VA 5FHMA 3GBAA 1UIUA 1ZKBA 2Y7IA 5KCJB 1FPKA 1ELJA 1MXZA 2HXWA 3SETA 3QSLA 4IGTA 2Z22A 3MYUA 4LZ7A 1MRPA 1IMCA 4PFYA 1MH3A 4F19A 2NUVA 1Y4CA 3A09A 1P1UA 1MPBA 3IAZA 5TPAB 1D9VA 3UP9A 4UA8A 3U94A 5EHSA 1B1HA 4RY1A 5L9MA 2PCRA 2DXRA 2X7PA 4H5FA 3FV1A 2HZKA 4XKPA 3A3CA 4G68A 2DQVA 1LB8A 1Q1KA 4F1YA 1MM7A 3MZ1A 1FQCA 2G93A 3FXUA 1FBCA 4ZZEA 4X48A 1DSNA 4GF8A 3T66A 3S9LC 1YAEA 4KI0E 4YKKA 3W9WA 1QJMA 4ECFA 4K3FA 2BJJX 4IO4A 2YLNA 4OMBA 3MQ9A 5L8DA 4YB7A 4MNIA 3Q25A 4F2QA 3B6WA 1NUZA 1BLFA 4DLDA 5I84A 5H8QA 4O7MA 1JW4A 5L9OA 2XXRA 5KDTA 3PUVE 4G68C 4FEBA 3FXQA 3HFUA 1MQIA 2CEYA 2O7IA 1FJ6A 4HCYA 1N04A 5HPQA 3K0VA 3U72A 2XD3A 2VOZA 4KYSA 3B50A 2VT5A 4GX3A 1FRPA 1PDAA 1PB8A 3GBBA 1XOCA 2F6GA 3B8BA 4MCOA 3EHUA 4ZEFA 3KGCA 3IK6B 3ILUB 4DDDA 4N81A 2HPGA 1B32A 5H8NA 5ET6A 1Y9UA 1US5A 4QSDA 4PFRA 5I56B 2CEXA 1IQ7A 1D9YA 5I2NB 1USYH 2Y7WA 3UK4A 2HQ0A 4U2RA 2OJTA 3VVDA 1Y4TA 5ESYA 3ZS6A 3FVKA 2XXQA 4MH5A 5AA4B 1K9YA 1IXGA 4YMAA 4MLVA 2Z23A 4TQUQ 1GVCA 2QPQA 3IJXB 1B7HA 4AB5A 4EQ9A 3SEUA 2XWIA 3T1BA 4F2OA 4MIJA 3R6UA 1TXFA 4JVDA 5TPAA 1P1WA 3CFLA 1A54A 3GLBA 4OQOA 3O97A 2DVZA 4M4GA 3D4GA 3M3KA 4OESA 5EQ9A 4R6HA 1MG1A 1FBGA 5AE4A 2QSXA 2I58A 3RTWB 3WAEA 3PUZE 5ET5A 4R9FA 1N7XA 3H4ZA 2RCBA 3OO9A 1Y1ZA 1TWYA 2CZLA 3G3HA 2WEFA 4HTGA 4O3AA 2B65A 2GRVA 1Z7NE 4UACA 1OLCA 1MM6A 1LFHA 5H8FA 2M8CA 1NI9A 4IO7A 2OWTA 3FVOA 3O2AA 4QBAA 4RYAA 5ICTA 1O63A 4EF2A 3HO7A 3DP6A 3A3UA 1LAXA 2XXPA 1EH3A 2OK2A 4P0GA 2XWOA 4YAHX 1BKAA 3TTNA 4JXIA 3FD3A 4MMPA 2A5SA 4OEUA 1LGBC 4FORA 2PFYA 3MUQA 4E0WA 3SEXA 4NX1A 5IAIA 3BIHA 1II5A 4O3BA 1O7TA 1A7LA 4GL0A 4GXAA 4P1LA 4N07A 3T22A 4YZZA 3E9XA 1D9QA 5A5LA 3U65A 1IMAA 2KQZA 2KR0A 5I56A 5I2NA 3VLVA 3MP1A 3TKDA 3K4UA 1GTKA 3K02A 1N3WA 3H3GA 1MY1A 4H0WA 4N13A 4MNCA 3RPLB 3TYHA 4GWXA 4DE8A 3IJOB 2H99A 3Q28A 3UA8A 3U8QA 3LSLA 1P1NA 3KEIA 1FPIA 4NWCA 1NUXA 4ZDMA 3ZKLA 3BIGA 1MXUA 2O51A 1IMDA 3K6UA 2QS3A 1TFAA 2XXWA 3VXBA 4GOTA 2ONSA 4PTKA 2CZIA 2QS1A 1NKXA 2QVVA 3T0JA 1SW4A 1MDP1 4YB6A 4AS5A 4G8NA 4AB6A 4NF8A 4I3YA 3ISPA 5FHOA 2P0SA 4Z0IA 1B3LA 4BDMA 3PGFA 1FTOA 3IL1B 5ET8A 2YJPA 5F24A 1USYE 2XD2A 3USDA 2F3DA 4H65A 4QXDA 1FQEA 4XKNA 3FGSA 1FPGA 4MF3A 4F3SA 2WYPA 3IORA 1A40A 3HPIA 3K01A 2E0SA 2X26A 4P11A 4ZECA 4I1DA 1B4HA 3IFAA 1LBCA 4KR5A 1FJ9A 4OFOA 4GWSA 4EXLA 3UORA 2NXOA 4MNPA 2OCUA 1N84A 3HHGA 4RNSA 1MS7A 1GR2A 4ISUA 4GWWA 4R72A 4JVCA 2FIXA 2DDKA 4BLAA 4FE8A 4YKIA 5I59A 1ATGA 4XXUA 1IMEA 3SEWA 2F34A 5I2KB 4LN5A 4DXCA 2DE4A 1CB6A 4HW8A 1I69A 4U21A 4N4UA 4BDQA 1B3FA 2GFEA 2HCAA 1NV6A 2RC8A 1FPEA 5CMKA 2WX9A 1IIWA 4BDLA 1VFEA 4OA4A 5AA2A 1UQWA 1JEUA 5CI5A 2O1LA 3H6VA 1QKBA 3KJTA 4GBVA 1JW5A 1FPFA 3K00A 1FSAA 1TFDA 4IB2A 2RF1A 4GL8A 4ZE8A 2Q8JA 4OFJA 3MZBA 3FVGA 3Q27A 3L6GA 4G68B 3CI8A 3RPLA 5ITOA 4JSDA 1NFTA 4HE1A 1N0TA 4C1TA 1YYZA 2HXRA 4GWZA 1PEBA 3CFZA 3THIA 1R1NA 3PMXA 3U92A 1T0KA 1H43A 2OLBA 3PUXE 2O84X 1JP4A 2ZXTA 3FATA 1D3KA 1OQGA 2AL4A 4OVPA 1AMFA 3VLUA 2H25A 1IXHA 1LFIA 1MY2A 1OVTA 5AA1A 2ZYMA 3FJ7A 3S2VA 4NQ8A 2DXYA 4N17A 1JEVA 5H8QB 3SEYA 3OO8A 3MVXA 5KDTB 1IMBA 2GHAA 4XEQA 3VXCA 4OANA 4R2BA 2V3UA 3I6VA 4YMBA 2B3BA 3IOWA 3OEMA 2ZZVA
chains in the Genus database with same CATH topology
5J1DA 1RDXA 2F3BA 1YZ0A 2FVZA 1G0HA 3HFUA 2CEYA 2Q8MA 1FJ6A 4HCYA 2DE3A 3B50A 2VT5A 4GX3A 1FRPA 5I7IA 2Y5KA 3B8BA 4N8GA 4X04A 4MCOA 4PAIA 1RDZA 4PAKA 4N81A 2HPGA 4GWUA 5J16A 4X8RA 5ET6A 4PFRA 2CEXA 2HZLA 2XWVA 1LBYA 1LBWA 1BK4A 5ESYA 4N8YA 3SZPA 5IGAA 1LEVA 1K9YA 4PFBA 5FBPA 2QFLA 4PGNA 2QPQA 2V3QA 4PF8A 2XXKA 2XWIA 5EYHA 3T1BA 4MIJA 4JVDA 4NG7A 3E79A 5EQAA 4OVSA 1KZ8A 2VPOA 3MSTA 4PFIA 1NV3A 2R8TA 2DVZA 4PE3A 1XI6A 5EQ9A 2B4LA 1FBFA 4PBQA 1NV4A 3A29A 1FBGA 4PAFA 4GBWA 2ZZWA 1FTAA 4F18A 5I5PA 3IFCA 4OVTA 1FPLA 5JK4A 2WBDA 5ET5A 2Q74A 4HCWA 1FPJA 2WEFA 1YXIA 4OVQA 1EYKA 1FPDA 5LDZA 4MJOA 4N6DA 1QGXA 4NF0A 4XF5A 1NI9A 4QBAA 4P9KA 4NGUA 2XWOA 4MAGA 4O94A 2V4CA 4MMPA 2HHMA 5IZ3B 5IZ1A 4GX6A 4PF6A 5DW8A 4MEVA 3FXBA 3LV0A 3PTYA 2PFYA 5IM2A 5EQ7A 1FBHA 4KXPA 1KA0A 5IZ3A 4NX1A 3BIHA 3LUZA 2QVUA 3RYDA 3GYYA 4P1LA 4MX6A 4P56A 4YZZA 2CZHA 4NHBA 1D9QA 5A5LA 5I3SA 3U65A 1FBEA 1IMAA 1FBDA 3ROJA 2KQZA 2KR0A 4JVIA 4FBPA 1Q9DA 1INPA 4PDDA 2CZKA 1LBVA 2Q9TA 1EYJA 1FPBA 4I40A 1LBZA 4MNCA 4HE2A 1NUWA 3RPLB 4GWXA 4I3EA 4HE0A 2Y5LA 1G0IA 1K9ZA 4PGPA 1FPIA 1NUXA 3BIGA 1IMDA 4GX4A 4F1UA 2L5VA 2GQ1A 2OX3A 2CZIA 4PTKA 4PCDA 4N6KA 1NV0A 2P3VA 2P3NA 2QVVA 3T0JA 4NAPA 4AS5A 4I3YA 3ISPA 5EYGA 2FHYA 5ET7A 1IMFA 4P3LA 4H46A 4UABA 2VPNA 3EKIA 2DE2A 4PC9A 5ET8A 1NV7A 4P8BA 5F24A 1AWBA 1CNQA 2F3DA 4NN3A 4QXDA 4PETA 1FPGA 2WYPA 4F1VA 3E78A 4XFEA 4MHFA 3W9VA 2JJKA 2FIEA 4H45A 1SPIA 3IFAA 4X9TA 1FJ9A 4GWSA 4MNPA 4P47A 4N91A 3CHGA 1LBXA 3KBZA 4GWWA 2BJIA 4JVCA 2FIXA 2DDKA 4AS4A 1FBPA 4HXVA 2OWZA 1IMEA 1NV2A 4LN5A 2PFZA 2DE4A 5EQ8A 1NV1A 4N4UA 2QVRA 1FPKA 1NV6A 4GWYA 1FPEA 2WX9A 4IR8A 4OA4A 4DI4B 3QMFA 3MYUA 4OVRA 2XWKA 1DCUA 4P1EA 4GBVA 1NUYA 4PBHA 1FPFA 2B4MA 1FSAA 1IMCA 4G61A 2WBBA 4F19A 4O8MA 5CM6A 2FBPA 1DBZA 2MKZA 4O7IA 3RPLA 1RDYA 5LTCA 2WYKA 2PCRA 4HE1A 3D1RA 1YYZA 5T3JA 2HZKA 2HXRA 1VDWA 4GWZA 2F5XA 4YICA 4M1VA 3KC1A 1JP4A 1FBCA 3NOHA 2ZZXA 4OVPA 4DI3D 3W9WA 1KA1A 5IZZA 4NQ8A 4N17A 4N15A 1EYIA 2XA5A 1IMBA 4PDHA 3FBPA 3KC0A 4XEQA 4MNIA 4OANA 1NUZA 4O7MA 1DK4A 2ZZVA 1NV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9Z A;  4GWY A;  1RDX A;  5ET5 A;  1FPI A;  2F3B A;  1YZ0 A;  2FVZ A;  1NUX A;  1G0H A;  2Q74 A;  3QMF A;  4IR8 A;  2Q8M A;  1DCU A;  3BIG A;  1IMD A;  1FPJ A;  1FJ6 A;  2WEF A;  4GBV A;  1NUY A;  1FPF A;  1YXI A;  1FSA A;  4GX4 A;  2VT5 A;  4GX3 A;  1IMC A;  1FRP A;  4G61 A;  2GQ1 A;  2WBB A;  2OX3 A;  1EYK A;  2CZI A;  4PTK A;  2Y5K A;  3B8B A;  1FPD A;  5LDZ A;  4MJO A;  1NV0 A;  2P3V A;  2P3N A;  2QVV A;  3T0J A;  1QGX A;  1NI9 A;  2FBP A;  4AS5 A;  4I3Y A;  5EYG A;  1RDZ A;  1DBZ A;  4N81 A;  2FHY A;  5ET7 A;  1IMF A;  4GWU A;  2Y5L A;  5J16 A;  4H46 A;  5ET6 A;  4O7I A;  3RPL A;  5ET8 A;  1NV7 A;  1RDY A;  5F24 A;  1AWB A;  2HHM A;  2PCR A;  4HE1 A;  1CNQ A;  2F3D A;  3D1R A;  1LBY A;  1LBW A;  4QXD A;  1YYZ A;  5IZ3 B;  5T3J A;  5IZ1 A;  4GX6 A;  1BK4 A;  1VDW A;  5ESY A;  4GWZ A;  5DW8 A;  1FPG A;  3LV0 A;  1LEV A;  1K9Y A;  5FBP A;  5EQ7 A;  2QFL A;  1FBH A;  4KXP A;  1KA0 A;  2JJK A;  3KC1 A;  2FIE A;  5IZ3 A;  4H45 A;  1JP4 A;  1SPI A;  3BIH A;  3LUZ A;  4HE0 A;  5EYH A;  3IFA A;  1FBC A;  2QVU A;  3RYD A;  1FJ9 A;  4GWS A;  5EQA A;  1KZ8 A;  2CZH A;  1NV3 A;  1D9Q A;  2R8T A;  5A5L A;  1KA1 A;  5I3S A;  1FBE A;  1IMA A;  1FBD A;  3ROJ A;  1LBX A;  3KBZ A;  4GWW A;  1XI6 A;  2BJI A;  5EQ9 A;  2FIX A;  2DDK A;  4AS4 A;  1FBF A;  1FBP A;  4FBP A;  1Q9D A;  1INP A;  1NV4 A;  4HXV A;  3A29 A;  1EYI A;  2CZK A;  1FBG A;  2OWZ A;  1IME A;  4GBW A;  1IMB A;  1LBV A;  1NV2 A;  1FTA A;  3FBP A;  3KC0 A;  1EYJ A;  1FPB A;  4I40 A;  1LBZ A;  5EQ8 A;  1NV1 A;  3IFC A;  4HE2 A;  1NUZ A;  1NUW A;  2QVR A;  1FPL A;  3RPL B;  4GWX A;  4I3E A;  1FPK A;  1NV6 A;  2WBD A;  1FPE A;  1DK4 A;  1NV5 A;  1G0I A; 
#chains in the Genus database with same CATH topology
 3MWB A;  3RQT A;  1RDX A;  2FVZ A;  4LZ5 A;  1G0H A;  2RKM A;  1EZP A;  1B3E A;  4KD5 A;  1NNK A;  1B6H A;  4NF4 A;  3QUJ A;  5I57 B;  5H8N B;  4GQO A;  1JW1 A;  2F78 A;  2XXU A;  3QUF A;  5DEX A;  4FIM A;  4PAI A;  3EF7 A;  3TQW A;  2UYF A;  1NL5 A;  4NE4 A;  4PAK A;  2GH9 A;  5I2K A;  4GWU A;  3KOS A;  3PPO A;  4H6D A;  2F35 A;  4QFK A;  1FTJ A;  4X1D A;  4G8H A;  2A5T A;  2HZL A;  3H6T A;  4XTC Q;  5I58 A;  4NF6 A;  4F3G A;  1LBW A;  4HS7 A;  3SZP A;  1B52 A;  2I49 A;  2R9J A;  2I3W A;  1MY4 A;  5FBP A;  2XXY A;  3RT8 A;  3KBR A;  2Y7P A;  3MW0 A;  1Z7M E;  2AL5 A;  4BDR A;  2XXK A;  4F39 A;  1B46 A;  1LFG A;  5CBR A;  1J1N A;  5LOM A;  3QXM A;  4OVS A;  2VPO A;  3V5A A;  4H8I A;  4IO6 A;  3MST A;  4QHQ A;  3QYT A;  3O6H A;  4GD5 A;  2W7Y A;  4PE3 A;  3QK6 A;  3E13 X;  1XI6 A;  3ECR A;  3IB2 A;  3AXF A;  2OPD A;  1MPC A;  3LUY A;  3LBS A;  4WEP A;  2ZZW A;  1FTA A;  1UTH A;  3IFC A;  3CRB A;  3B6T A;  1Q35 A;  4QRZ A;  5JK4 A;  3WAF A;  1SD3 A;  1H76 A;  1MQJ A;  2QJE A;  3CG3 A;  4OVJ A;  2RIN A;  1VE4 A;  4YKP A;  3DP8 A;  3C31 A;  3N6T A;  3FZV A;  5H8F B;  4F3B A;  1B0H A;  2F7B A;  4H5G A;  1LAG E;  4KHZ E;  4H67 A;  1EYK A;  1P1Q A;  4MJO A;  4N6D A;  1SBP A;  1UTB B;  4XF5 A;  4R74 A;  4P9K A;  2XXT A;  4NGU A;  3LC8 A;  4LUB A;  4RK9 A;  2YPN A;  2V4C A;  4RPO A;  4GFR A;  2WKY A;  2HHM A;  3CFX A;  1EU8 A;  3O66 A;  2HAV A;  1B0L A;  5DW8 A;  1R6Z A;  4Q30 B;  2PYY A;  1FBH A;  4Z7E A;  4KXP A;  5I57 A;  1LAH E;  5F7V A;  5IZ3 A;  1Y3Q A;  2V25 A;  3RYD A;  3TTR A;  1OIB A;  3ILT B;  4ELR A;  1XT8 A;  2KLF A;  2CZH A;  4G8M A;  4NHB A;  5M2V A;  3DEL B;  1B58 A;  3I3V A;  1GV8 A;  1FBD A;  4LAT A;  4FBP A;  3E3K A;  3OXN A;  4PDD A;  2CZK A;  1R9Q A;  2PBW A;  1LBV A;  3FJG A;  1EYJ A;  4I40 A;  2DWA A;  4HE2 A;  1NUW A;  1XS5 A;  4I3E A;  3KG2 A;  2GHB A;  3I5O A;  2D3I A;  3C4M A;  2R6G E;  1NNT A;  3BFT A;  3R7X A;  3PPP A;  1OVB A;  4NF8 B;  3KOT A;  2P2A A;  1WVJ A;  3G3I A;  1CE2 A;  4PCD A;  5FTH A;  3VV5 A;  2ANJ A;  4I62 A;  4ELP A;  1AH5 A;  2I48 A;  4IY6 A;  4P3L A;  3P7I A;  3FV2 A;  2DE2 A;  3MP6 A;  2DVC A;  3IO4 A;  4PC9 A;  1NV7 A;  2ZYN A;  4P8B A;  1AIV A;  1MXW A;  2AYS A;  3TOD A;  1OQH A;  4NN3 A;  5DVJ A;  2PX1 A;  2I0C A;  3TPA A;  3PMV A;  2ZNT A;  3PD8 A;  1FCK A;  2THI A;  4DCY A;  4MHF A;  5ELV A;  3OO6 A;  2FIE A;  4H45 A;  1JVY A;  1SPI A;  3PV0 E;  3PPN A;  3KN7 A;  4JB7 A;  4JSO A;  5CC2 A;  3KFM A;  4PE5 B;  1UTB A;  2QS2 A;  4KQP A;  5I59 B;  2I4B A;  3LSF B;  4P47 A;  3ZKK A;  4LA9 A;  1EZ9 A;  4BDO A;  3CHG A;  1M5F A;  1LBX A;  3KBZ A;  1WOD A;  2BJI A;  1QUL A;  4AS4 A;  1FBP A;  2UVI A;  2XX8 A;  2H98 A;  3KZG A;  1I6Q A;  2QRY A;  2RCA A;  3H03 A;  4QSC A;  3SES A;  4H8J A;  1A55 A;  2PFZ A;  3DP4 A;  5AA2 B;  5EQ8 A;  4C1U A;  1B2H A;  2QVR A;  2ONK E;  4G2Z A;  3H06 B;  4GWY A;  3TAJ A;  4IR8 A;  3G3J A;  1XC1 A;  1QUK A;  3IX1 A;  3O9P A;  4F29 A;  1DCU A;  4WXJ A;  4ELQ A;  1ZU0 A;  3IOU A;  1SVX B;  2WBB A;  3RTF B;  5EYF A;  5CM6 A;  3OSQ A;  2FBP A;  2ZNU A;  4WKM A;  1DBZ A;  2MKZ A;  4NTL A;  2Z8D A;  3RY3 A;  4O7I A;  1RDY A;  5LTC A;  2WYK A;  1P1O A;  4GIZ A;  3KN3 A;  4GWO A;  2F7A A;  5DTB A;  3S9E A;  1VDW A;  4YIC A;  4FED A;  4FAT A;  3OSR A;  1AL3 A;  3O29 A;  2O69 A;  1XVY A;  3LSW A;  1FQF A;  4N6P A;  3LR1 A;  3T9U A;  3KSX A;  1DTZ A;  3UGW A;  1MY0 A;  4F22 A;  3NOH A;  2ZZX A;  2Q89 A;  4DI3 D;  2VHA A;  5IKB A;  4TLL B;  4OEV A;  1N76 A;  2DWJ A;  1RKM A;  3T9V A;  3O6G A;  1DPP A;  1EYI A;  3TMG A;  3VLW A;  3KJ7 A;  2D21 A;  4ESX A;  2AIX A;  2IA4 A;  4PDH A;  3FBP A;  3U93 A;  4OYV A;  3PU5 A;  4ESW A;  1I6B A;  3IOV A;  2E1S A;  1YCJ A;  3TEP A;  4THI A;  2CMO A;  4BDN A;  1D4N A;  4NF4 B;  1NV5 A;  5CMB A;  3CSB A;  2QMW A;  4QFN A;  2PMS A;  1YZ0 A;  5DEX B;  3C9H A;  1B1X A;  1JNF A;  4R75 A;  3FAS A;  5A5X A;  3C33 A;  2DE3 A;  3MVZ A;  1NNP A;  1B7Z A;  3MBP A;  4EF1 A;  2A5T B;  1BIY A;  1HSE A;  3C36 A;  5I58 B;  4NF6 B;  4G77 A;  3QIM A;  1RDZ A;  1FQB A;  3L6H A;  3VE1 B;  4X8R A;  4OFL A;  4GVO A;  1RYO A;  1I6A A;  4DXB A;  2XWV A;  1B3H A;  2ZYK A;  4POW A;  3SEV A;  4N8Y A;  4X1B A;  1RYX A;  1ZBM A;  1H44 A;  4PFB A;  4JWX A;  2V3Q A;  3K6X A;  3M8U A;  4PF8 A;  5EYH A;  3N6U A;  1HSL A;  5H8H A;  4JDF A;  4U4X A;  4NG7 A;  3K6W A;  3OMB A;  5EQA A;  4ND9 A;  1KZ8 A;  1HSJ A;  1PBP A;  5ICQ A;  1UTH B;  3RUM A;  5H8S A;  5B70 A;  1QUI A;  1FTL A;  2B4L A;  4O3C A;  1FBF A;  4PBQ A;  3A29 A;  1LLS A;  3IB0 A;  3HCQ A;  3JZJ A;  3PD9 A;  4PAF A;  3SKP A;  3GXA A;  3OO7 A;  2VD2 A;  4Q8R A;  2XX9 A;  4PQJ A;  2UYE A;  4ZS9 A;  2WBD A;  4OTE A;  5DT6 A;  3RNN A;  3MPK A;  4QFO A;  2Q74 A;  2V3T A;  3GZG A;  3BKI B;  1ZJL A;  4HCW A;  5FHN A;  1OLA A;  1YXI A;  3HST A;  1JET A;  4OVQ A;  4YU0 A;  3C34 A;  3MVW A;  5LDZ A;  1B5I A;  2UVJ A;  1QGX A;  4NF0 A;  1B40 A;  3E4R A;  4OWD A;  1B5H A;  1LB9 A;  5B7D A;  4I9D A;  3QAX A;  4OEN A;  3N5L A;  5IZ3 B;  5IZ1 A;  4GX6 A;  4PF6 A;  2Y84 A;  4OXV A;  1SW5 A;  4MEV A;  3LV0 A;  2Q2A A;  1NMU A;  1B4Z A;  2P1S A;  1KA0 A;  4XKR A;  3M3F A;  3F11 A;  3JV9 A;  3LUZ A;  5KZT A;  3UN6 A;  2QVU A;  3ZSF A;  4IGR A;  3N94 A;  3MVY A;  4QFL A;  3EHT A;  3R26 A;  1H3D A;  2XXX A;  3S9M C;  1B9J A;  5I3S A;  1ZTY A;  1FBE A;  2G29 A;  1EZO A;  4JVI A;  2ONR A;  4GRK A;  5K2X A;  5AA2 D;  1Q9D A;  1INP A;  2H4I A;  1BP5 A;  5BWJ A;  3G7W A;  2H5Y A;  2F8D A;  1FPB A;  5L9S A;  1LBZ A;  1SYH A;  2V93 A;  1QUJ A;  3BBR A;  4U22 A;  2PT1 A;  1BTJ A;  2UVH A;  4HE0 A;  3HV1 A;  2ZNS A;  4YB5 A;  1G0I A;  4KFQ A;  1K9Z A;  3TDJ A;  5AA3 A;  4EQ7 A;  5TP9 A;  2DSF A;  1XVX A;  4LON B;  1F9B A;  1MH4 A;  3K6V A;  3B6Q A;  3MZ9 A;  4F3P A;  3HN0 A;  1B5J A;  1OMP A;  4OET A;  4POX A;  4GX4 A;  3VVE A;  4F1U A;  2L5V A;  2GQ1 A;  1SW2 A;  4N6K A;  1NV0 A;  2P3N A;  4ZEK A;  4DCX A;  4Q5T A;  4JWO A;  5EYG A;  2NWJ A;  3FIR A;  5ET7 A;  1IMF A;  1N3X A;  4TLM B;  1LST A;  2NVU B;  3TCG A;  4UAB A;  2VPN A;  3V8X B;  4RA1 A;  1FW0 A;  1CNQ A;  3K1P A;  5JTY A;  3JYR A;  3G3F A;  3MJN A;  4F31 B;  4F1V A;  2VP1 A;  4XFE A;  3W9V A;  3RN8 A;  3ONM A;  3KN8 A;  4DIG A;  4RK2 A;  2F36 A;  4IO3 A;  1JQF A;  2QL3 A;  1B51 A;  4G4P A;  2X7Q A;  1MY3 A;  3RLF E;  5ITP A;  2O6A A;  1MQG A;  1Y3P A;  4HXV A;  4R73 A;  1MPD A;  4DZ1 A;  1S9T A;  1QVS A;  4QSE A;  2XXV A;  4ZZA A;  1S50 A;  3RPW A;  2Z8E A;  3CR9 A;  3MAM A;  4NF5 A;  2QMX A;  1S7Y A;  4IO5 A;  3V89 B;  4DI4 B;  3KSJ A;  2REJ A;  4DXU A;  1A8E A;  3H7M A;  3QMF A;  4AQ4 A;  4OVR A;  2XWK A;  4P1E A;  5KCJ A;  1NUY A;  4PBH A;  2B4M A;  4G61 A;  2RC9 A;  3MC2 A;  4O8M A;  3V83 A;  2FA7 A;  3OEK A;  3TCH A;  2DWI A;  4OHN A;  3RGY A;  4C0R A;  4RJZ A;  2O1M A;  1US4 A;  3CVG A;  1LCF A;  2OPE A;  3SDF A;  3TTK A;  3M3L A;  1N7W A;  3C35 A;  2XX7 A;  2DP8 A;  1PB9 A;  1H45 A;  3D1R A;  5T3J A;  4MBP A;  2F5X A;  4MLQ A;  4M1V A;  4KCD A;  3FXR A;  3TQL A;  4QF9 A;  4NED A;  3KC1 A;  3IO6 A;  4IO2 A;  1IZ1 A;  1P99 A;  4MFI A;  1AOV A;  1PB7 A;  4ZEB A;  5DYH A;  4EUO A;  3G3G A;  2F97 A;  1ZIU A;  1KA1 A;  4R6K A;  5IZZ A;  2R71 A;  4JBZ A;  1B05 A;  1SI0 A;  3B7D A;  2B3F A;  4N15 A;  2XA5 A;  3LSX A;  1FTM A;  1XHY A;  3VFJ A;  3KC0 A;  1YPN A;  1QKA A;  1M5B A;  1FQD A;  3PUY E;  2DYX A;  2I0B A;  2FNC A;  1DK4 A;  1NNF A;  5A5X B;  2HFB A;  5J1D A;  2O7U A;  4TOZ A;  2F3B A;  1IEJ A;  3TTL A;  2Q8M A;  4LVQ A;  2OBG A;  4NMY A;  3HHF A;  3FUZ A;  5I7I A;  2O68 A;  4KCC A;  2Y5K A;  3EPE A;  1R9L A;  4N8G A;  4X04 A;  4EXK A;  3U1O A;  3TZA A;  3EQ1 A;  4FEC A;  1KWH A;  3SER A;  1Y1M A;  2LAO A;  5J16 A;  4KYE A;  4H1X A;  1Y20 A;  3DLN A;  3UIF A;  3CG1 A;  3TTM A;  5HBC A;  4Q0C A;  5F1Q A;  3ODB A;  1LBY A;  1SYI A;  4QFP A;  1BK4 A;  5H8H B;  3OEN A;  5IGA A;  1LEV A;  3K1M A;  4U1Z A;  2QFL A;  1IIT A;  4PGN A;  2V84 A;  2OZZ A;  5DVF A;  1PC3 A;  4GLI A;  3IOT A;  3D4C A;  5ISU A;  2I6E A;  3E79 A;  5AA4 A;  3C32 A;  3TEL A;  1B7U A;  1NV3 A;  2REG A;  4JWY A;  4PFI A;  4ZE9 A;  2R8T A;  1ZMG A;  1SQY A;  5JEI A;  2ZYO A;  3H6U A;  1O64 A;  2Z8F A;  1MXX A;  1NV4 A;  2F6P A;  5DVI A;  2Y7K A;  4GBW A;  4WED A;  4F18 A;  2FYI A;  1UIV A;  3N26 A;  3T9H B;  1Y3N A;  5I5P A;  4OVT A;  1FPL A;  2ALU A;  1DTG A;  1IXC A;  3VDF A;  4ONY A;  5CMM A;  5CBS A;  1IUD A;  1A99 A;  3Q29 A;  2OWS A;  3S4U A;  3W15 C;  1FPJ A;  2D5W A;  3FJM A;  1NH7 A;  3Q26 A;  3K2D A;  5HM4 B;  4ELO A;  1FPD A;  2DWH A;  2Y7R A;  1URD A;  3PPR A;  2XXI A;  4PFT A;  4EDP A;  1YTV A;  4U4S A;  2UVG A;  4NWD A;  4MAG A;  3T9X B;  4O94 A;  1LAF E;  5FTI A;  3PMW A;  1POY 1;  1DMB A;  1L5T A;  2Q88 A;  4KPT A;  4LQ5 A;  1ZLQ A;  1IXI A;  1M5D A;  3RT6 B;  3TFL A;  1LCT A;  4XIG Q;  3FXB A;  4OZ9 A;  3PTY A;  5IM2 A;  3VVF A;  3S9N C;  1URS A;  4IY5 A;  5EQ7 A;  3H6W A;  2NOO A;  3CSG A;  2QS4 A;  1A8F A;  1M5E A;  4PFU A;  1FTK A;  3G3K A;  3GYY A;  2ABH A;  4MX6 A;  4P56 A;  1SW1 A;  4PP0 A;  4KYD A;  4L17 A;  3PPQ A;  2IEE A;  1DOT A;  5BUU A;  3ROJ A;  4YKJ A;  2Q2C A;  3CIJ A;  2H9B A;  3TUS A;  1MQD A;  4PFW A;  4RPN A;  2PT2 A;  5TU0 A;  2F7C A;  2RC7 A;  2Q9T A;  5TP9 B;  3IB1 A;  1WDN A;  3O28 A;  1SI1 A;  3OD7 A;  4ZED A;  3OEL A;  4R2F A;  5K2Y A;  3EN3 A;  4P0I A;  2XXH A;  2Y5L A;  3TCF A;  4XKQ A;  4PGP A;  4I8C A;  5CMC A;  2ZMB A;  1LBB A;  1NH8 A;  1JVX A;  1MQH A;  4U1O A;  1PBQ A;  3K1N A;  5EHM A;  3MPL A;  5CRY A;  2OX3 A;  1VFD A;  4E0X A;  4LZ8 A;  2P3V A;  4NAP A;  2ESN A;  3MP8 A;  5JTY B;  4R6Y A;  2FHY A;  4U23 A;  4H46 A;  3EKI A;  4ZEI A;  2DS9 A;  1ANF A;  1MDQ A;  1AWB A;  2UXA A;  3BFU A;  3OOA A;  4PET A;  3T96 B;  2DOJ A;  4FJP A;  4EQB A;  1MXY A;  2HEU A;  3E78 A;  4FAJ A;  1GGG A;  2VD3 A;  2JJK A;  1VSO A;  2HAU A;  4LQ2 A;  4RXL A;  3EHS A;  1B3G A;  3O6I A;  4OER A;  4X9T A;  4LP2 B;  1URG A;  3DM0 A;  2PVU A;  1QW0 A;  1FQA A;  4N91 A;  3FVN A;  2I4C A;  1POT A;  2XHD A;  3IR1 A;  3T93 B;  2OWZ A;  4NF5 B;  1TT1 A;  2VGQ A;  1M5C A;  1NV2 A;  1DPE A;  1VR5 A;  4GXS B;  3PUW E;  1SDX A;  1MXV A;  1NV1 A;  4R9G A;  2I3V A;  5FHM A;  3GBA A;  1UIU A;  1ZKB A;  2Y7I A;  5KCJ B;  1FPK A;  1ELJ A;  1MXZ A;  2HXW A;  3SET A;  3QSL A;  4IGT A;  2Z22 A;  3MYU A;  4LZ7 A;  1MRP A;  1IMC A;  4PFY A;  1MH3 A;  4F19 A;  2NUV A;  1Y4C A;  3A09 A;  1P1U A;  1MPB A;  3IAZ A;  5TPA B;  1D9V A;  3UP9 A;  4UA8 A;  3U94 A;  5EHS A;  1B1H A;  4RY1 A;  5L9M A;  2PCR A;  2DXR A;  2X7P A;  4H5F A;  3FV1 A;  2HZK A;  4XKP A;  3A3C A;  4G68 A;  2DQV A;  1LB8 A;  1Q1K A;  4F1Y A;  1MM7 A;  3MZ1 A;  1FQC A;  2G93 A;  3FXU A;  1FBC A;  4ZZE A;  4X48 A;  1DSN A;  4GF8 A;  3T66 A;  3S9L C;  1YAE A;  4KI0 E;  4YKK A;  3W9W A;  1QJM A;  4ECF A;  4K3F A;  2BJJ X;  4IO4 A;  2YLN A;  4OMB A;  3MQ9 A;  5L8D A;  4YB7 A;  4MNI A;  3Q25 A;  4F2Q A;  3B6W A;  1NUZ A;  1BLF A;  4DLD A;  5I84 A;  5H8Q A;  4O7M A;  1JW4 A;  5L9O A;  2XXR A;  5KDT A;  3PUV E;  4G68 C;  4FEB A;  3FXQ A;  3HFU A;  1MQI A;  2CEY A;  2O7I A;  1FJ6 A;  4HCY A;  1N04 A;  5HPQ A;  3K0V A;  3U72 A;  2XD3 A;  2VOZ A;  4KYS A;  3B50 A;  2VT5 A;  4GX3 A;  1FRP A;  1PDA A;  1PB8 A;  3GBB A;  1XOC A;  2F6G A;  3B8B A;  4MCO A;  3EHU A;  4ZEF A;  3KGC A;  3IK6 B;  3ILU B;  4DDD A;  4N81 A;  2HPG A;  1B32 A;  5H8N A;  5ET6 A;  1Y9U A;  1US5 A;  4QSD A;  4PFR A;  5I56 B;  2CEX A;  1IQ7 A;  1D9Y A;  5I2N B;  1USY H;  2Y7W A;  3UK4 A;  2HQ0 A;  4U2R A;  2OJT A;  3VVD A;  1Y4T A;  5ESY A;  3ZS6 A;  3FVK A;  2XXQ A;  4MH5 A;  5AA4 B;  1K9Y A;  1IXG A;  4YMA A;  4MLV A;  2Z23 A;  4TQU Q;  1GVC A;  2QPQ A;  3IJX B;  1B7H A;  4AB5 A;  4EQ9 A;  3SEU A;  2XWI A;  3T1B A;  4F2O A;  4MIJ A;  3R6U A;  1TXF A;  4JVD A;  5TPA A;  1P1W A;  3CFL A;  1A54 A;  3GLB A;  4OQO A;  3O97 A;  2DVZ A;  4M4G A;  3D4G A;  3M3K A;  4OES A;  5EQ9 A;  4R6H A;  1MG1 A;  1FBG A;  5AE4 A;  2QSX A;  2I58 A;  3RTW B;  3WAE A;  3PUZ E;  5ET5 A;  4R9F A;  1N7X A;  3H4Z A;  2RCB A;  3OO9 A;  1Y1Z A;  1TWY A;  2CZL A;  3G3H A;  2WEF A;  4HTG A;  4O3A A;  2B65 A;  2GRV A;  1Z7N E;  4UAC A;  1OLC A;  1MM6 A;  1LFH A;  5H8F A;  2M8C A;  1NI9 A;  4IO7 A;  2OWT A;  3FVO A;  3O2A A;  4QBA A;  4RYA A;  5ICT A;  1O63 A;  4EF2 A;  3HO7 A;  3DP6 A;  3A3U A;  1LAX A;  2XXP A;  1EH3 A;  2OK2 A;  4P0G A;  2XWO A;  4YAH X;  1BKA A;  3TTN A;  4JXI A;  3FD3 A;  4MMP A;  2A5S A;  4OEU A;  1LGB C;  4FOR A;  2PFY A;  3MUQ A;  4E0W A;  3SEX A;  4NX1 A;  5IAI A;  3BIH A;  1II5 A;  4O3B A;  1O7T A;  1A7L A;  4GL0 A;  4GXA A;  4P1L A;  4N07 A;  3T22 A;  4YZZ A;  3E9X A;  1D9Q A;  5A5L A;  3U65 A;  1IMA A;  2KQZ A;  2KR0 A;  5I56 A;  5I2N A;  3VLV A;  3MP1 A;  3TKD A;  3K4U A;  1GTK A;  3K02 A;  1N3W A;  3H3G A;  1MY1 A;  4H0W A;  4N13 A;  4MNC A;  3RPL B;  3TYH A;  4GWX A;  4DE8 A;  3IJO B;  2H99 A;  3Q28 A;  3UA8 A;  3U8Q A;  3LSL A;  1P1N A;  3KEI A;  1FPI A;  4NWC A;  1NUX A;  4ZDM A;  3ZKL A;  3BIG A;  1MXU A;  2O51 A;  1IMD A;  3K6U A;  2QS3 A;  1TFA A;  2XXW A;  3VXB A;  4GOT A;  2ONS A;  4PTK A;  2CZI A;  2QS1 A;  1NKX A;  2QVV A;  3T0J A;  1SW4 A;  1MDP 1;  4YB6 A;  4AS5 A;  4G8N A;  4AB6 A;  4NF8 A;  4I3Y A;  3ISP A;  5FHO A;  2P0S A;  4Z0I A;  1B3L A;  4BDM A;  3PGF A;  1FTO A;  3IL1 B;  5ET8 A;  2YJP A;  5F24 A;  1USY E;  2XD2 A;  3USD A;  2F3D A;  4H65 A;  4QXD A;  1FQE A;  4XKN A;  3FGS A;  1FPG A;  4MF3 A;  4F3S A;  2WYP A;  3IOR A;  1A40 A;  3HPI A;  3K01 A;  2E0S A;  2X26 A;  4P11 A;  4ZEC A;  4I1D A;  1B4H A;  3IFA A;  1LBC A;  4KR5 A;  1FJ9 A;  4OFO A;  4GWS A;  4EXL A;  3UOR A;  2NXO A;  4MNP A;  2OCU A;  1N84 A;  3HHG A;  4RNS A;  1MS7 A;  1GR2 A;  4ISU A;  4GWW A;  4R72 A;  4JVC A;  2FIX A;  2DDK A;  4BLA A;  4FE8 A;  4YKI A;  5I59 A;  1ATG A;  4XXU A;  1IME A;  3SEW A;  2F34 A;  5I2K B;  4LN5 A;  4DXC A;  2DE4 A;  1CB6 A;  4HW8 A;  1I69 A;  4U21 A;  4N4U A;  4BDQ A;  1B3F A;  2GFE A;  2HCA A;  1NV6 A;  2RC8 A;  1FPE A;  5CMK A;  2WX9 A;  1IIW A;  4BDL A;  1VFE A;  4OA4 A;  5AA2 A;  1UQW A;  1JEU A;  5CI5 A;  2O1L A;  3H6V A;  1QKB A;  3KJT A;  4GBV A;  1JW5 A;  1FPF A;  3K00 A;  1FSA A;  1TFD A;  4IB2 A;  2RF1 A;  4GL8 A;  4ZE8 A;  2Q8J A;  4OFJ A;  3MZB A;  3FVG A;  3Q27 A;  3L6G A;  4G68 B;  3CI8 A;  3RPL A;  5ITO A;  4JSD A;  1NFT A;  4HE1 A;  1N0T A;  4C1T A;  1YYZ A;  2HXR A;  4GWZ A;  1PEB A;  3CFZ A;  3THI A;  1R1N A;  3PMX A;  3U92 A;  1T0K A;  1H43 A;  2OLB A;  3PUX E;  2O84 X;  1JP4 A;  2ZXT A;  3FAT A;  1D3K A;  1OQG A;  2AL4 A;  4OVP A;  1AMF A;  3VLU A;  2H25 A;  1IXH A;  1LFI A;  1MY2 A;  1OVT A;  5AA1 A;  2ZYM A;  3FJ7 A;  3S2V A;  4NQ8 A;  2DXY A;  4N17 A;  1JEV A;  5H8Q B;  3SEY A;  3OO8 A;  3MVX A;  5KDT B;  1IMB A;  2GHA A;  4XEQ A;  3VXC A;  4OAN A;  4R2B A;  2V3U A;  3I6V A;  4YMB A;  2B3B A;  3IOW A;  3OEM A;  2ZZV A; 
#chains in the Genus database with same CATH homology
 5J1D A;  1RDX A;  2F3B A;  1YZ0 A;  2FVZ A;  1G0H A;  3HFU A;  2CEY A;  2Q8M A;  1FJ6 A;  4HCY A;  2DE3 A;  3B50 A;  2VT5 A;  4GX3 A;  1FRP A;  5I7I A;  2Y5K A;  3B8B A;  4N8G A;  4X04 A;  4MCO A;  4PAI A;  1RDZ A;  4PAK A;  4N81 A;  2HPG A;  4GWU A;  5J16 A;  4X8R A;  5ET6 A;  4PFR A;  2CEX A;  2HZL A;  2XWV A;  1LBY A;  1LBW A;  1BK4 A;  5ESY A;  4N8Y A;  3SZP A;  5IGA A;  1LEV A;  1K9Y A;  4PFB A;  5FBP A;  2QFL A;  4PGN A;  2QPQ A;  2V3Q A;  4PF8 A;  2XXK A;  2XWI A;  5EYH A;  3T1B A;  4MIJ A;  4JVD A;  4NG7 A;  3E79 A;  5EQA A;  4OVS A;  1KZ8 A;  2VPO A;  3MST A;  4PFI A;  1NV3 A;  2R8T A;  2DVZ A;  4PE3 A;  1XI6 A;  5EQ9 A;  2B4L A;  1FBF A;  4PBQ A;  1NV4 A;  3A29 A;  1FBG A;  4PAF A;  4GBW A;  2ZZW A;  1FTA A;  4F18 A;  5I5P A;  3IFC A;  4OVT A;  1FPL A;  5JK4 A;  2WBD A;  5ET5 A;  2Q74 A;  4HCW A;  1FPJ A;  2WEF A;  1YXI A;  4OVQ A;  1EYK A;  1FPD A;  5LDZ A;  4MJO A;  4N6D A;  1QGX A;  4NF0 A;  4XF5 A;  1NI9 A;  4QBA A;  4P9K A;  4NGU A;  2XWO A;  4MAG A;  4O94 A;  2V4C A;  4MMP A;  2HHM A;  5IZ3 B;  5IZ1 A;  4GX6 A;  4PF6 A;  5DW8 A;  4MEV A;  3FXB A;  3LV0 A;  3PTY A;  2PFY A;  5IM2 A;  5EQ7 A;  1FBH A;  4KXP A;  1KA0 A;  5IZ3 A;  4NX1 A;  3BIH A;  3LUZ A;  2QVU A;  3RYD A;  3GYY A;  4P1L A;  4MX6 A;  4P56 A;  4YZZ A;  2CZH A;  4NHB A;  1D9Q A;  5A5L A;  5I3S A;  3U65 A;  1FBE A;  1IMA A;  1FBD A;  3ROJ A;  2KQZ A;  2KR0 A;  4JVI A;  4FBP A;  1Q9D A;  1INP A;  4PDD A;  2CZK A;  1LBV A;  2Q9T A;  1EYJ A;  1FPB A;  4I40 A;  1LBZ A;  4MNC A;  4HE2 A;  1NUW A;  3RPL B;  4GWX A;  4I3E A;  4HE0 A;  2Y5L A;  1G0I A;  1K9Z A;  4PGP A;  1FPI A;  1NUX A;  3BIG A;  1IMD A;  4GX4 A;  4F1U A;  2L5V A;  2GQ1 A;  2OX3 A;  2CZI A;  4PTK A;  4PCD A;  4N6K A;  1NV0 A;  2P3V A;  2P3N A;  2QVV A;  3T0J A;  4NAP A;  4AS5 A;  4I3Y A;  3ISP A;  5EYG A;  2FHY A;  5ET7 A;  1IMF A;  4P3L A;  4H46 A;  4UAB A;  2VPN A;  3EKI A;  2DE2 A;  4PC9 A;  5ET8 A;  1NV7 A;  4P8B A;  5F24 A;  1AWB A;  1CNQ A;  2F3D A;  4NN3 A;  4QXD A;  4PET A;  1FPG A;  2WYP A;  4F1V A;  3E78 A;  4XFE A;  4MHF A;  3W9V A;  2JJK A;  2FIE A;  4H45 A;  1SPI A;  3IFA A;  4X9T A;  1FJ9 A;  4GWS A;  4MNP A;  4P47 A;  4N91 A;  3CHG A;  1LBX A;  3KBZ A;  4GWW A;  2BJI A;  4JVC A;  2FIX A;  2DDK A;  4AS4 A;  1FBP A;  4HXV A;  2OWZ A;  1IME A;  1NV2 A;  4LN5 A;  2PFZ A;  2DE4 A;  5EQ8 A;  1NV1 A;  4N4U A;  2QVR A;  1FPK A;  1NV6 A;  4GWY A;  1FPE A;  2WX9 A;  4IR8 A;  4OA4 A;  4DI4 B;  3QMF A;  3MYU A;  4OVR A;  2XWK A;  1DCU A;  4P1E A;  4GBV A;  1NUY A;  4PBH A;  1FPF A;  2B4M A;  1FSA A;  1IMC A;  4G61 A;  2WBB A;  4F19 A;  4O8M A;  5CM6 A;  2FBP A;  1DBZ A;  2MKZ A;  4O7I A;  3RPL A;  1RDY A;  5LTC A;  2WYK A;  2PCR A;  4HE1 A;  3D1R A;  1YYZ A;  5T3J A;  2HZK A;  2HXR A;  1VDW A;  4GWZ A;  2F5X A;  4YIC A;  4M1V A;  3KC1 A;  1JP4 A;  1FBC A;  3NOH A;  2ZZX A;  4OVP A;  4DI3 D;  3W9W A;  1KA1 A;  5IZZ A;  4NQ8 A;  4N17 A;  4N15 A;  1EYI A;  2XA5 A;  1IMB A;  4PDH A;  3FBP A;  3KC0 A;  4XEQ A;  4MNI A;  4OAN A;  1NUZ A;  4O7M A;  1DK4 A;  2ZZV A;  1NV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...