5ET8A

Human muscle fructose-1,6-bisphosphatase in active r-state in complex with fructose-6-phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
287
Chain Sequence
DMLTLTRYVMGELTQLLNSMLTAIKAISSAVRKAVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGASIGTIFAIYRKPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title T-to-R switch of muscle FBPase involves extreme changes of secondary and quaternary structure
rcsb
source organism Homo sapiens
total genus 88
structure length 287
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et8A02
1LBYA 1XI6A 1IMCA 1FPJA 2Y5KA 4KXPA 4HE2A 4MJOA 2R8TA 1JP4A 4GX3A 5A5LA 3KBZA 1IMAA 1NV3A 5I3SA 1DK4A 1FTAA 4PTKA 1FBCA 4GX6A 1EYJA 5ET6A 2CZKA 1EYIA 4I40A 3BIHA 4N81A 3KC0A 1RDXA 1YXIA 1RDZA 2GQ1A 2HHMA 3LUZA 5ET7A 4O7IA 2F3DA 1Q9DA 1IMEA 2QFLA 1CNQA 2Q74A 2FIXA 3D1RA 4GBWA 5DW8A 1FPGA 4GWUA 1SPIA 3IFAA 2QVVA 4H46A 4I3YA 5LDZA 4FBPA 1LBZA 3QMFA 5ET8A 4AS4A 1KA0A 2OX3A 1FPDA 1FPKA 1LBXA 1BK4A 1NV7A 3B8BA 3RPLA 1FPBA 5EYGA 1NUZA 2PCRA 1NV0A 5EYHA 4HXVA 1LEVA 1FRPA 4H45A 5ESYA 1FPIA 4AS5A 2BJIA 2F3BA 1FPEA 2WEFA 1LBWA 1NV1A 5IZ1A 1FPFA 5EQ7A 1IMFA 1RDYA 2OWZA 4GWWA 4GWYA 5IZ3A 1NUXA 1IMDA 2FIEA 4HE1A 5J16A 1LBVA 1YZ0A 2Q8MA 5EQ9A 4GWSA 3RPLB 4QXDA 3BIGA 2FVZA 1AWBA 2WBDA 1FBDA 1NV5A 2WBBA 1NV4A 1FJ6A 5EQ8A 1EYKA 1FBPA 4GBVA 3ROJA 2CZIA 3KC1A 1DBZA 2QVUA 2FHYA 1NUYA 3T0JA 5EQAA 5ET5A 1FPLA 1K9YA 1NI9A 2VT5A 1IMBA 1QGXA 2P3VA 4GWXA 4GX4A 1YYZA 1VDWA 1FBEA 1K9ZA 5IZ3B 1NV6A 2QVRA 1FBFA 4G61A 4GWZA 3IFCA 3A29A 1NV2A 4IR8A 1FBHA 1INPA 2DDKA 2JJKA 3RYDA 1G0HA 4HE0A 4I3EA 1FSAA 1FBGA 1NUWA 5F24A 2P3NA 1DCUA 3LV0A 1FJ9A 1G0IA 1KA1A 5FBPA 3FBPA 2Y5LA 1D9QA 2FBPA 1KZ8A 2CZHA 5T3JA
chains in the Genus database with same CATH superfamily
4MNPA 1BTJA 4GX3A 3DP6A 3G3FA 4LZ7A 1VSOA 1PB8A 1EYIA 1R6ZA 5DT6A 3K2DA 4NF6A 3IOUA 3MQ9A 3OENA 5IGAA 5DW8A 4MAGA 2XXIA 5BUUA 1B3HA 2VP1A 3FJGA 2XXWA 4H8JA 4Z0IA 3MP1A 1FPBA 1ZTYA 3PPQA 4LP2B 2HFBA 2REGA 4LZ5A 2PVUA 4P1EA 2A5TA 3O29A 1OLAA 3TTRA 3K1PA 3OO7A 3VVEA 5FTHA 3SDFA 5EQ7A 3S2VA 4BDLA 1MH4A 2OWZA 3EPEA 4JVDA 3VV5A 5B7DA 3MZ9A 2Y7RA 4WEPA 2ZZXA 2DWHA 4EQ7A 2F7CA 3UA8A 2XX9A 4MIJA 1P1UA 4OWDA 4F3PA 2HZKA 4XXUA 1MXZA 3KC1A 1MXXA 1IXIA 2W7YA 1K9YA 3TKDA 1LLSA 1K9ZA 1IITA 4E0WA 1N3WA 1AL3A 1II5A 3BKIB 1PBQA 3VXCA 3A29A 4F3GA 4PGPA 3C35A 4U23A 1B3EA 3FVOA 3W15C 4EF1A 2B65A 3E13X 4NE4A 4ZEBA 3K02A 2ZZWA 5I57B 3N94A 4YKIA 3HN0A 1S9TA 3T96B 5A5LA 4P1LA 3LSXA 1B52A 4PTKA 3FZVA 2XXVA 4JDFA 2OPEA 3OELA 4IB2A 5CMKA 3TZAA 4PBQA 2F8DA 1UIUA 4FORA 2ZYKA 3PV0E 4X1BA 1M5DA 1BK4A 3E78A 4ZEIA 4F29A 4NF5A 1FQAA 4KI0E 1B7HA 3MWBA 3SEUA 4PFRA 3G3JA 2UYEA 5K2XA 3Q26A 2BJIA 4FATA 1B9JA 3U92A 3K00A 4PGNA 1FW0A 3TPAA 4X1DA 2ANJA 4GWYA 4NMYA 3EHUA 3IB2A 3H3GA 5J16A 4QFLA 4G4PA 1HSLA 2V3TA 2I58A 2PT2A 3PUYE 4H5FA 3HPIA 4GXSB 4AQ4A 5KCJA 2XXTA 4G68C 4QFPA 3TQWA 3UN6A 4MHFA 1YTVA 4OFLA 2FHYA 1USYE 3U1OA 3GZGA 2B4MA 4DXUA 1MDP1 5H8FB 2VPNA 5A5XB 3KBRA 3LUYA 5CMBA 4NQ8A 3O9PA 1TXFA 2KLFA 1EU8A 1FBGA 1UQWA 4XIGQ 2I4BA 2P3NA 4MLVA 2V84A 1LFGA 4BDNA 2DP8A 4F3BA 2X7PA 4NEDA 3SZPA 1FTLA 3LSFB 4PFTA 4F1VA 5B70A 4L17A 3MYUA 4YB6A 2XXUA 1LAFE 3K6VA 1MM7A 4DI3D 1JEVA 3D1RA 3G3KA 4O3BA 1NKXA 4ONYA 4ESWA 3KZGA 4I3YA 1WODA 2AL5A 5ET8A 3N6TA 3PMVA 1B0HA 3L6GA 1Y4CA 1O63A 5JK4A 3FV1A 1FTKA 4AB6A 1M5CA 4N8GA 3N5LA 3K1NA 5AA4B 4OZ9A 2FA7A 5TU0A 1IMFA 3CHGA 2GHBA 5FHOA 2UXAA 3FUZA 3ODBA 2QVUA 2UVIA 4LATA 3T0JA 3DM0A 3MUQA 4GWXA 1CB6A 3KJTA 1IUDA 4GWZA 3I6VA 2L5VA 1JVXA 4F22A 1LGBC 2AYSA 1N7XA 3C34A 5L9OA 3OEKA 4H67A 4F3SA 3MZBA 4OVSA 5I7IA 3K01A 5ELVA 1PB7A 4GWOA 3RPWA 5H8NB 2YPNA 1IMCA 3PPRA 1JP4A 2DXRA 1NV3A 3SERA 1MDQA 4FIMA 4XFEA 2F34A 2F3DA 5AA2D 2QFLA 2FIXA 3TCFA 3DLNA 3FATA 2QVVA 4BDMA 3TUSA 5I5PA 1FQBA 1KWHA 4GIZA 3UK4A 1DSNA 2P1SA 2F36A 3RPLA 5I58B 1Y1ZA 3TDJA 2HEUA 2E0SA 2IA4A 4ZZEA 4PFWA 2QMXA 3NOHA 2WEFA 4RK2A 1MXWA 3ECRA 3O28A 2P0SA 3E9XA 5H8NA 1B4ZA 4O7MA 4YU0A 2XWOA 4QXDA 4NX1A 4OVQA 2WYKA 4I1DA 4YAHX 4QFNA 1SI0A 1SW4A 4DXCA 3FGSA 5DEXA 1EZOA 5TP9A 2OPDA 3Q27A 4EQ9A 4IO4A 2D21A 3VFJA 4DCXA 1MQHA 4IY5A 2REJA 3RYDA 1MRPA 4EUOA 1T0KA 5BWJA 4P11A 5IZZA 3THIA 3IB1A 4PP0A 4KFQA 5AA2A 3C4MA 3TELA 3SEVA 4NWCA 3M3KA 2I48A 2THIA 3KEIA 2R8TA 4R72A 3T22A 3HHFA 2PYYA 2GRVA 4N6DA 2XX8A 1O7TA 4JBZA 1A54A 1QULA 1P1NA 3IORA 3C31A 4FECA 3ZS6A 2HQ0A 3SEYA 3R6UA 3PUVE 4GOTA 3U8QA 2QS3A 4O3CA 2RC9A 3KSJA 5ICQA 4U1ZA 4R9GA 4YB5A 3LSWA 4DCYA 4PFBA 4KCCA 4MNIA 3AXFA 2Z8FA 3KN8A 1FPFA 4U1OA 3O6GA 4GWSA 3CG1A 3M3LA 2OBGA 4H65A 2H5YA 3TMGA 5IKBA 1NV5A 2Q9TA 3O6IA 4KHZE 1NUYA 3MP8A 5HBCA 2VT5A 2QS4A 3SESA 4ZE9A 3MSTA 4BLAA 4OANA 4PQJA 1HSEA 1IXGA 1FBHA 4IY6A 4WXJA 3I5OA 3T9VA 3H03A 3SEXA 3GBBA 1G0IA 2OK2A 2E1SA 4JB7A 1TT1A 2NOOA 4YMBA 1KZ8A 3FXUA 3TTNA 3IB0A 3GYYA 1FTOA 3K6UA 1CE2A 1MQJA 4OQOA 2ONSA 2ZYMA 1A8EA 1YXIA 2F7AA 4HS7A 3TCGA 5DVFA 2Q2CA 1DPPA 1H76A 3S9MC 3TODA 3IFAA 2CEYA 3E3KA 2KR0A 4U22A 3DELB 3MPLA 5CBRA 4IO7A 2CEXA 3Q28A 4LUBA 3IAZA 4OVPA 4F1UA 3BFTA 1ZLQA 3G3HA 4O94A 4KPTA 1B1HA 1B40A 1LAXA 1LBVA 3B6TA 1B2HA 2WBDA 4N17A 2WBBA 4IGRA 1DOTA 5JTYB 1IXHA 3IK6B 3QUFA 1EYKA 4NF4B 3UGWA 3G3GA 1LB9A 3OO8A 3EF7A 5TPAA 1P99A 3QUJA 3KSXA 3EHSA 4JWYA 1QGXA 3UORA 4GLIA 4ZS9A 2UVHA 2PFZA 2O84X 3CG3A 4MMPA 1NV2A 3CFLA 2F7BA 2ONRA 4HE0A 3LR1A 5KDTB 4PDDA 1WDNA 4KQPA 1POTA 3FVKA 3MC2A 2AL4A 2FNCA 4QBAA 5H8HB 3PUXE 2I3VA 2ZMBA 3IX1A 2H4IA 1VE4A 1XI6A 4KXPA 1N04A 4TOZA 3OSQA 4NHBA 5I3SA 1VFEA 1DK4A 3EQ1A 1FQEA 2Y7PA 3KG2A 3H06B 1LBBA 1USYH 3MVYA 5DVIA 5JTYA 5EYFA 4XEQA 4NF4A 3PD8A 2V3QA 3B50A 4GD5A 2AIXA 4OENA 1BP5A 2V25A 4DI4B 3QMFA 4GXAA 2RKMA 3IL1B 3QIMA 5HM4B 3OO9A 1QKBA 4ELOA 5L8DA 4FJPA 5EYGA 4R9FA 5H8SA 2LAOA 3TTKA 4NF0A 5EYHA 5KDTA 3GBAA 4PFYA 1MY0A 3OMBA 1MPCA 1PC3A 3FXBA 3MVXA 1NV1A 5IZ1A 4DXBA 3PD9A 3LC8A 3RQTA 1GGGA 4NF8B 1F9BA 3FXQA 3O97A 3U93A 1NMUA 1M5FA 5I57A 2ZXTA 1MQGA 3TQLA 1VDWA 1N84A 3FASA 2UVGA 3FIRA 4C1TA 1B7UA 3PUZE 4EF2A 3PMXA 4IR8A 1XOCA 2O51A 4MH5A 3G3IA 1FQCA 5I2KB 2O69A 2XXKA 3RT6B 5L9SA 4THIA 4OFJA 2ABHA 1Y20A 5CMMA 1IIWA 3B6WA 1B5JA 2HAVA 1EYJA 3Q29A 4PAFA 1POY1 4YKKA 4N6KA 4N81A 5CC2A 4X9TA 3QK6A 3C36A 3K0VA 2ZYOA 2Q74A 2VOZA 4RXLA 2NVUB 5EHSA 2DQVA 1SW1A 1NNFA 1B3LA 1TFAA 2RCAA 4F39A 2DWJA 1FTMA 3HV1A 3MVWA 3CSGA 4M1VA 3FJMA 1GV8A 2I0CA 1FPIA 2O6AA 1H44A 2VGQA 4R2FA 2PMSA 3S9LC 3KOSA 3QYTA 3RT8A 2ALUA 2QL3A 5H8FA 5I59B 3MVZA 3IO6A 3OOAA 5A5XA 2VD2A 4N91A 3OO6A 4Q0CA 5FTIA 3RTWB 2WX9A 3ROJA 1AH5A 1I6BA 4P9KA 4PFIA 4DIGA 5LTCA 1NI9A 4FEDA 4U21A 4UACA 2G29A 5IZ3B 4RJZA 5I56B 5JEIA 2DS9A 1JW5A 2O1LA 3KOTA 3FJ7A 1SYHA 1LFHA 2QJEA 2B3BA 1DCUA 1LAGE 4N8YA 3T1BA 2Y5LA 1HSJA 3H4ZA 3PPNA 1Y3QA 1XC1A 4QHQA 4GFRA 1PBPA 1UTHB 4MJOA 4X48A 1D4NA 4OEVA 3M3FA 2ZZVA 1B7ZA 5I2NB 4QFKA 3E79A 1A7LA 1RDXA 3U65A 4GVOA 2MKZA 4FAJA 4ZECA 5AA4A 1Q9DA 2RC7A 3VVFA 4LA9A 1TWYA 1ZU0A 4GF8A 2XWIA 4FBPA 4P8BA 1B5HA 1FPDA 3KN3A 4KYSA 1J1NA 4IO3A 4PE3A 3GXAA 4ZEFA 3K4UA 4K3FA 4JSOA 4HXVA 4G2ZA 2V3UA 1LEVA 3T9XB 1O64A 1ZBMA 2HXWA 3B7DA 1ANFA 3A3CA 2DXYA 2GFEA 3QXMA 4N4UA 3V89B 4POXA 4EXLA 2FIEA 4ZEKA 1YZ0A 4F1YA 3SKPA 2QS1A 4YKPA 5EQ9A 2ONKE 2XXXA 5I2NA 4NN3A 2I49A 5EHMA 4I9DA 5IAIA 4OHNA 2XA5A 3N6UA 3TEPA 2X26A 3W9WA 3HO7A 4H6DA 2R71A 1YYZA 5CRYA 3CFXA 1S50A 1MXUA 1LBCA 1MS7A 2V4CA 1A99A 4DE8A 4ELQA 1DPEA 2HXRA 3LV0A 4ZEDA 3O66A 4GRKA 1RYXA 3T9UA 1D9YA 3RN8A 2DWIA 1XVYA 2NXOA 1MY1A 2OCUA 4HE2A 4ISUA 1SDXA 3KBZA 3T9HB 3VVDA 1FTAA 1GVCA 1JETA 4GX6A 5I58A 4X8RA 1ZJLA 1MY4A 3LBSA 2HHMA 4O7IA 2Y7KA 3OSRA 4GBWA 1NNKA 4OYVA 1EZPA 4O8MA 1FTJA 1B1XA 4MBPA 2H25A 1FPKA 1BKAA 3K1MA 2HZLA 4R74A 2UVJA 1B4HA 3CRBA 3IOWA 2Y7WA 4POWA 1MY2A 3RY3A 1Y3NA 5CI5A 1H3DA 1RDYA 1MM6A 1M5BA 4WEDA 1NUXA 3ILTB 4U2RA 2UYFA 5DYHA 3UIFA 4NAPA 1JW1A 1LCTA 4HTGA 1FBEA 3EKIA 5F1QA 4Q8RA 1FCKA 1QKAA 1FBFA 2GH9A 4JSDA 1DTZA 4F19A 1OIBA 2VPOA 4OETA 2Q8JA 2F5XA 3LSLA 4G68B 1ATGA 4XKRA 4MX6A 4MF3A 5FBPA 1Y3PA 1XT8A 3MZ1A 4ELPA 4HW8A 3CFZA 2Y84A 5T3JA 1S7YA 1GR2A 1P1QA 1ZIUA 3HFUA 1IMAA 2HPGA 4PC9A 4QSEA 1QUKA 1BLFA 3KGCA 5ET6A 3RUMA 4PETA 4I40A 2FYIA 2OZZA 1B51A 1M5EA 2R9JA 3ILUB 1Y9UA 3TTLA 4NG7A 5H8QB 5FHMA 5AA3A 3PUWE 3DP4A 1B5IA 2DSFA 2O7IA 3FVGA 2XXYA 4NF6B 4H45A 3A3UA 1SI1A 4U4XA 4AS5A 3CR9A 2F3BA 3H6WA 4MLQA 3TCHA 5DTBA 1EH3A 5FHNA 1NFTA 4TQUQ 1B05A 4E0XA 2PT1A 3BIGA 5CMCA 3QAXA 1IXCA 2RCBA 2PX1A 4GL8A 1SD3A 2A5TB 2DVCA 1FBPA 4GBVA 4Q30B 1P1OA 1ZKBA 3RGYA 2P3VA 3GLBA 2M8CA 1QJMA 1NV6A 1URGA 2PFYA 3L6HA 1JEUA 5HPQA 4LQ2A 1R9LA 3IFCA 3W9VA 3FXRA 1INPA 3E4RA 2CMOA 1Q1KA 2V93A 5F24A 4TLMB 4RNSA 2VD3A 5IM2A 5CM6A 1FJ9A 2DE3A 4RPNA 1A40A 3MBPA 3VLUA 3VLVA 4MNCA 3IOTA 1H43A 3USDA 2XX7A 2ZYNA 1JNFA 4XKPA 1XHYA 2PBWA 3CVGA 4P0GA 3O6HA 2QPQA 1VR5A 5ET7A 3VXBA 3TFLA 3KFMA 4TLLB 4H46A 1MG1A 5KZTA 3HCQA 3ISPA 3B6QA 2HCAA 1NNPA 2XD3A 1JW4A 1B46A 4PAKA 1R9QA 3IJOB 1NV0A 4EDPA 4KYEA 4UA8A 3C33A 4XF5A 1MPBA 2WKYA 3ZKLA 1UTBB 1MH3A 1QUJA 3PPPA 4Q5TA 4UABA 1YAEA 1LSTA 2DWAA 1MQDA 1IEJA 4XKQA 3C32A 4YICA 2QSXA 3R26A 3OEMA 4NF5B 2H99A 3PTYA 4F18A 3I3VA 1NV4A 2QRYA 3H7MA 5DVJA 4JVCA 2P2AA 2Z8DA 1DBZA 4IO6A 4PFUA 4P56A 2YLNA 4NWDA 5H8HA 1URSA 1N0TA 3IOVA 4G61A 4R6HA 1EZ9A 4H0WA 2NWJA 1P1WA 1US4A 3DP8A 2NUVA 4LVQA 1I6QA 4P47A 5KCJB 1OQHA 2XWKA 1UTBA 1OVBA 4MCOA 3HSTA 1D9VA 4WKMA 2RINA 3S9EA 2YJPA 2CZHA 3T93B 1ZMGA 2Y5KA 4GL0A 1FPJA 1LCFA 5AE4A 4YMAA 1Z7NE 3KJ7A 1DMBA 2O7UA 4G8NA 4P3LA 4H5GA 2CZKA 3R7XA 3BIHA 1PDAA 2F6GA 1URDA 2Z22A 3D4CA 4OMBA 2Q89A 1CNQA 1SPIA 3P7IA 4KD5A 4AS4A 4ZDMA 2XWVA 2OX3A 4F2OA 4JWXA 4N15A 2B4LA 3B8BA 1SVXB 3H6TA 3TYHA 2O68A 3TTMA 2XXHA 4NF8A 4ND9A 2D3IA 5ESYA 2QS2A 1RKMA 2QMWA 4C0RA 3CI8A 3WAEA 4F31B 3A09A 4AB5A 1IMDA 4NGUA 1OMPA 2Q8MA 1SW2A 2I0BA 1OLCA 3T66A 2XD2A 1YPNA 1AOVA 1D3KA 2O1MA 2ZNTA 4R6KA 1FJ6A 4PE5B 2DYXA 2XXPA 4XTCQ 3G7WA 1NL5A 1IQ7A 4F2QA 1R1NA 3IO4A 1B58A 4PF6A 3SEWA 5I2KA 1QW0A 3BFUA 5K2YA 1FPLA 4JXIA 2DVZA 4GX4A 4KYDA 3WAFA 3IJXB 4MFIA 4I8CA 1JQFA 2DDKA 3CSBA 1MXVA 4PF8A 4H1XA 1H45A 4QSDA 4RA1A 1KA1A 4KR5A 1QVSA 3FBPA 2GHAA 1LB8A 3H6VA 3F11A 1D9QA 4HCYA 4OFOA 2FBPA 4QFOA 2Q88A 4QRZA 3PPOA 1FQDA 3JV9A 4NTLA 4R6YA 1FBCA 1SYIA 4LZ8A 1RDZA 3LUZA 5ICTA 4ELRA 2RF1A 1ELJA 4RY1A 4FEBA 3V8XB 2OWSA 4RK9A 5L9MA 1N7WA 3ZKKA 5I59A 2ESNA 4X04A 4BDRA 1SQYA 2F6PA 2DE2A 2XXQA 3PU5A 1NUZA 4OA4A 3FV2A 1AIVA 1MXYA 4OVTA 1TFDA 1IZ1A 4LQ5A 1FPEA 1LBWA 3K6WA 5J1DA 5IZ3A 4IGTA 3CIJA 5I56A 2XHDA 3KN7A 3RPLB 3HHGA 2FVZA 1AWBA 3MAMA 1FBDA 1B6HA 3O2AA 5F7VA 1A55A 2X7QA 1L5TA 2CZLA 4OEUA 1MPDA 1IMBA 4U4SA 3ONMA 4C1UA 3K6XA 4QF9A 1Y1MA 2KQZA 1UTHA 2Y7IA 1XVXA 5ITOA 2R6GE 4PBHA 3V83A 1MY3A 4PDHA 2JJKA 1VFDA 2BJJX 3JYRA 1US5A 1PB9A 3PMWA 1NUWA 1LAHE 1LFIA 2OJTA 2A5SA 5DEXB 5ISUA 5TP9B 2XXRA 2F78A 2Z8EA 2OWTA 4N6PA 4KCDA 1LBYA 4BDOA 3FVNA 4PAIA 4H8IA 3Q25A 2DE4A 4BDQA 1GTKA 3KC0A 2GQ1A 5AA2B 4QSCA 4XKNA 4Z7EA 1IMEA 2Z23A 4EQBA 4P0IA 5LDZA 1KA0A 4R75A 3M8UA 2H9BA 3VE1B 1FQFA 4OVJA 3BBRA 3D4GA 4FE8A 5LOMA 1A8FA 1XS5A 4G8MA 1FRPA 4IO2A 2WYPA 4ECFA 2F35A 4MEVA 4LN5A 3IR1A 2ZNSA 3V5AA 1I69A 4JWOA 3OXNA 3U72A 2G93A 4LONB 4M4GA 1B3FA 5EQ8A 2CZIA 2RC8A 1N76A 5EQAA 1MQIA 3MJNA 1B3GA 3MW0A 4OERA 2F97A 1I6AA 2D5WA 1B0LA 4DLDA 3UP9A 1BIYA 1NH7A 4O3AA 4DZ1A 4JVIA 5AA1A 4I3EA 1FSAA 3VLWA 3FD3A 3N26A 3JZJA 1N3XA 5I84A 2I6EA 3U94A 3PGFA 2I4CA 2Q2AA 4DDDA 5M2VA 3SETA 3EN3A 4R73A 2I3WA 4ESXA 1UIVA 1NNTA 1FPGA 4RYAA 4GWUA 4R2BA 3RLFE 3H6UA 1NH8A 3VDFA 1LBZA 4OXVA 1SW5A 4G77A 1LBXA 2H98A 4OESA 3QSLA 1AMFA 1NV7A 2PCRA 1RYOA 4RPOA 1B32A 1YCJA 4EXKA 2DOJA 4OTEA 3S9NC 1SBPA 3MPKA 3ZSFA 1OVTA 3S4UA 4IO5A 3TAJA 4GWWA 4HE1A 4YB7A 1Y4TA 1OQGA 2HAUA 4G68A 1WVJA 4GQOA 2OLBA 1JVYA 2VHAA 1Z7ME 4I62A 5ITPA 5ET5A 4N07A 1DTGA 3MP6A 3EHTA 1PEBA 2QVRA 4G8HA 5CBSA 4PCDA 2ZNUA 4YZZA 4OVRA 3RNNA 1G0HA 3C9HA 4ZE8A 4YKJA 2IEEA 3RTFB 1QUIA 4HCWA 4N13A 5TPAB 1Q35A 2B3FA 3OD7A 4ZZAA 5H8QA
chains in the Genus database with same CATH topology
2Y5KA 4MJOA 1FPJA 4MNPA 2R8TA 4GX3A 4P3LA 2ZZVA 2CZKA 4N6DA 1EYIA 3BIHA 3E79A 3U65A 1RDXA 2MKZA 1Q9DA 1CNQA 5IGAA 5DW8A 1SPIA 4MAGA 2XWIA 4FBPA 4P8BA 4AS4A 2XWVA 2OX3A 1FPDA 4N15A 2B4LA 4PE3A 3B8BA 1FPBA 4HXVA 1LEVA 4PFBA 5ESYA 4P1EA 4MNIA 1FPFA 5EQ7A 2OWZA 4N4UA 4JVDA 1IMDA 4NGUA 2FIEA 1YZ0A 2Q8MA 2ZZXA 5EQ9A 4GWSA 1NV5A 4NN3A 1FJ6A 2Q9TA 4MIJA 2HZKA 3KC1A 2XA5A 1NUYA 3W9WA 4PF6A 1FPLA 1K9YA 2VT5A 2DVZA 4GX4A 1YYZA 1K9ZA 3MSTA 4OANA 3A29A 4PGPA 1FBHA 2DDKA 2V4CA 4PF8A 2HXRA 3LV0A 1G0IA 1KA1A 2ZZWA 3FBPA 1D9QA 4HCYA 2FBPA 1KZ8A 5A5LA 4HE2A 3GYYA 4P1LA 3KBZA 1FTAA 4PTKA 1FBCA 4GX6A 4X8RA 1YXIA 1RDZA 2HHMA 3LUZA 4O7IA 4PBQA 4GBWA 3IFAA 4O8MA 2CEYA 2KR0A 1FPKA 4X04A 2HZLA 1BK4A 2DE2A 3E78A 1NUZA 4OA4A 2CEXA 4OVPA 4F1UA 4PFRA 4OVTA 2BJIA 1FPEA 4PGNA 1LBWA 5J1DA 4O94A 1RDYA 4GWYA 5IZ3A 1NUXA 5J16A 1LBVA 3RPLB 2FVZA 1AWBA 2WBDA 1FBDA 4N17A 2WBBA 4NAPA 1EYKA 4MHFA 2FHYA 2B4MA 1IMBA 1QGXA 1FBEA 2VPNA 3EKIA 2KQZA 1FBFA 2PFZA 4F19A 4PBHA 4NQ8A 4MMPA 1NV2A 2VPOA 2F5XA 4PDHA 2JJKA 4HE0A 1FBGA 1NUWA 4PDDA 2P3NA 4MX6A 5FBPA 4QBAA 5T3JA 1LBYA 1XI6A 4KXPA 4PAIA 3HFUA 1IMAA 2HPGA 4PC9A 4NHBA 3SZPA 5I3SA 1DK4A 4F1VA 2DE4A 5ET6A 3MYUA 4PETA 4I40A 3KC0A 2GQ1A 4XEQA 4DI3D 2V3QA 3B50A 1IMEA 3D1RA 4DI4B 4I3YA 5LDZA 4NG7A 5ET8A 3QMFA 1KA0A 5JK4A 5EYGA 4N8GA 5EYHA 4NF0A 1FRPA 4H45A 4AS5A 2WYPA 2F3BA 3FXBA 1NV1A 5IZ1A 4MEVA 4LN5A 1IMFA 3CHGA 3BIGA 5EQ8A 1FBPA 4GBVA 2CZIA 2QVUA 3T0JA 5EQAA 4GWXA 2P3VA 1VDWA 1NV6A 2PFYA 4GWZA 2L5VA 3IFCA 3W9VA 4IR8A 1INPA 4JVIA 4I3EA 1FSAA 5F24A 4OVSA 5IM2A 5CM6A 1FJ9A 2DE3A 2XXKA 5I7IA 4MNCA 1IMCA 1JP4A 1NV3A 1EYJA 4PAFA 4N6KA 4N81A 2QPQA 5ET7A 4X9TA 4XFEA 2F3DA 2QFLA 2Q74A 2FIXA 1FPGA 4GWUA 2QVVA 4H46A 5I5PA 1LBZA 1LBXA 3ISPA 1NV7A 3RPLA 4M1VA 4PAKA 2PCRA 1NV0A 4XF5A 1FPIA 3NOHA 2WEFA 4UABA 4GWWA 4YICA 4HE1A 4O7MA 2XWOA 4QXDA 3PTYA 4NX1A 4N91A 4F18A 4OVQA 1NV4A 2WYKA 4JVCA 2WX9A 3ROJA 1DBZA 4P9KA 4PFIA 5LTCA 4P56A 5ET5A 1NI9A 5IZ3B 2QVRA 4G61A 4PCDA 4YZZA 4OVRA 3RYDA 1G0HA 4P47A 2XWKA 5IZZA 1DCUA 4N8YA 3T1BA 4HCWA 4MCOA 2Y5LA 2CZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBY A;  1XI6 A;  1IMC A;  1FPJ A;  2Y5K A;  4KXP A;  4HE2 A;  4MJO A;  2R8T A;  1JP4 A;  4GX3 A;  5A5L A;  3KBZ A;  1IMA A;  1NV3 A;  5I3S A;  1DK4 A;  1FTA A;  4PTK A;  1FBC A;  4GX6 A;  1EYJ A;  5ET6 A;  2CZK A;  1EYI A;  4I40 A;  3BIH A;  4N81 A;  3KC0 A;  1RDX A;  1YXI A;  1RDZ A;  2GQ1 A;  2HHM A;  3LUZ A;  5ET7 A;  4O7I A;  2F3D A;  1Q9D A;  1IME A;  2QFL A;  1CNQ A;  2Q74 A;  2FIX A;  3D1R A;  4GBW A;  5DW8 A;  1FPG A;  4GWU A;  1SPI A;  3IFA A;  2QVV A;  4H46 A;  4I3Y A;  5LDZ A;  4FBP A;  1LBZ A;  3QMF A;  5ET8 A;  4AS4 A;  1KA0 A;  2OX3 A;  1FPD A;  1FPK A;  1LBX A;  1BK4 A;  1NV7 A;  3B8B A;  3RPL A;  1FPB A;  5EYG A;  1NUZ A;  2PCR A;  1NV0 A;  5EYH A;  4HXV A;  1LEV A;  1FRP A;  4H45 A;  5ESY A;  1FPI A;  4AS5 A;  2BJI A;  2F3B A;  1FPE A;  2WEF A;  1LBW A;  1NV1 A;  5IZ1 A;  1FPF A;  5EQ7 A;  1IMF A;  1RDY A;  2OWZ A;  4GWW A;  4GWY A;  5IZ3 A;  1NUX A;  1IMD A;  2FIE A;  4HE1 A;  5J16 A;  1LBV A;  1YZ0 A;  2Q8M A;  5EQ9 A;  4GWS A;  3RPL B;  4QXD A;  3BIG A;  2FVZ A;  1AWB A;  2WBD A;  1FBD A;  1NV5 A;  2WBB A;  1NV4 A;  1FJ6 A;  5EQ8 A;  1EYK A;  1FBP A;  4GBV A;  3ROJ A;  2CZI A;  3KC1 A;  1DBZ A;  2QVU A;  2FHY A;  1NUY A;  3T0J A;  5EQA A;  5ET5 A;  1FPL A;  1K9Y A;  1NI9 A;  2VT5 A;  1IMB A;  1QGX A;  2P3V A;  4GWX A;  4GX4 A;  1YYZ A;  1VDW A;  1FBE A;  1K9Z A;  5IZ3 B;  1NV6 A;  2QVR A;  1FBF A;  4G61 A;  4GWZ A;  3IFC A;  3A29 A;  1NV2 A;  4IR8 A;  1FBH A;  1INP A;  2DDK A;  2JJK A;  3RYD A;  1G0H A;  4HE0 A;  4I3E A;  1FSA A;  1FBG A;  1NUW A;  5F24 A;  2P3N A;  1DCU A;  3LV0 A;  1FJ9 A;  1G0I A;  1KA1 A;  5FBP A;  3FBP A;  2Y5L A;  1D9Q A;  2FBP A;  1KZ8 A;  2CZH A;  5T3J A; 
#chains in the Genus database with same CATH topology
 4MNP A;  1BTJ A;  4GX3 A;  3DP6 A;  3G3F A;  4LZ7 A;  1VSO A;  1PB8 A;  1EYI A;  1R6Z A;  5DT6 A;  3K2D A;  4NF6 A;  3IOU A;  3MQ9 A;  3OEN A;  5IGA A;  5DW8 A;  4MAG A;  2XXI A;  5BUU A;  1B3H A;  2VP1 A;  3FJG A;  2XXW A;  4H8J A;  4Z0I A;  3MP1 A;  1FPB A;  1ZTY A;  3PPQ A;  4LP2 B;  2HFB A;  2REG A;  4LZ5 A;  2PVU A;  4P1E A;  2A5T A;  3O29 A;  1OLA A;  3TTR A;  3K1P A;  3OO7 A;  3VVE A;  5FTH A;  3SDF A;  5EQ7 A;  3S2V A;  4BDL A;  1MH4 A;  2OWZ A;  3EPE A;  4JVD A;  3VV5 A;  5B7D A;  3MZ9 A;  2Y7R A;  4WEP A;  2ZZX A;  2DWH A;  4EQ7 A;  2F7C A;  3UA8 A;  2XX9 A;  4MIJ A;  1P1U A;  4OWD A;  4F3P A;  2HZK A;  4XXU A;  1MXZ A;  3KC1 A;  1MXX A;  1IXI A;  2W7Y A;  1K9Y A;  3TKD A;  1LLS A;  1K9Z A;  1IIT A;  4E0W A;  1N3W A;  1AL3 A;  1II5 A;  3BKI B;  1PBQ A;  3VXC A;  3A29 A;  4F3G A;  4PGP A;  3C35 A;  4U23 A;  1B3E A;  3FVO A;  3W15 C;  4EF1 A;  2B65 A;  3E13 X;  4NE4 A;  4ZEB A;  3K02 A;  2ZZW A;  5I57 B;  3N94 A;  4YKI A;  3HN0 A;  1S9T A;  3T96 B;  5A5L A;  4P1L A;  3LSX A;  1B52 A;  4PTK A;  3FZV A;  2XXV A;  4JDF A;  2OPE A;  3OEL A;  4IB2 A;  5CMK A;  3TZA A;  4PBQ A;  2F8D A;  1UIU A;  4FOR A;  2ZYK A;  3PV0 E;  4X1B A;  1M5D A;  1BK4 A;  3E78 A;  4ZEI A;  4F29 A;  4NF5 A;  1FQA A;  4KI0 E;  1B7H A;  3MWB A;  3SEU A;  4PFR A;  3G3J A;  2UYE A;  5K2X A;  3Q26 A;  2BJI A;  4FAT A;  1B9J A;  3U92 A;  3K00 A;  4PGN A;  1FW0 A;  3TPA A;  4X1D A;  2ANJ A;  4GWY A;  4NMY A;  3EHU A;  3IB2 A;  3H3G A;  5J16 A;  4QFL A;  4G4P A;  1HSL A;  2V3T A;  2I58 A;  2PT2 A;  3PUY E;  4H5F A;  3HPI A;  4GXS B;  4AQ4 A;  5KCJ A;  2XXT A;  4G68 C;  4QFP A;  3TQW A;  3UN6 A;  4MHF A;  1YTV A;  4OFL A;  2FHY A;  1USY E;  3U1O A;  3GZG A;  2B4M A;  4DXU A;  1MDP 1;  5H8F B;  2VPN A;  5A5X B;  3KBR A;  3LUY A;  5CMB A;  4NQ8 A;  3O9P A;  1TXF A;  2KLF A;  1EU8 A;  1FBG A;  1UQW A;  4XIG Q;  2I4B A;  2P3N A;  4MLV A;  2V84 A;  1LFG A;  4BDN A;  2DP8 A;  4F3B A;  2X7P A;  4NED A;  3SZP A;  1FTL A;  3LSF B;  4PFT A;  4F1V A;  5B70 A;  4L17 A;  3MYU A;  4YB6 A;  2XXU A;  1LAF E;  3K6V A;  1MM7 A;  4DI3 D;  1JEV A;  3D1R A;  3G3K A;  4O3B A;  1NKX A;  4ONY A;  4ESW A;  3KZG A;  4I3Y A;  1WOD A;  2AL5 A;  5ET8 A;  3N6T A;  3PMV A;  1B0H A;  3L6G A;  1Y4C A;  1O63 A;  5JK4 A;  3FV1 A;  1FTK A;  4AB6 A;  1M5C A;  4N8G A;  3N5L A;  3K1N A;  5AA4 B;  4OZ9 A;  2FA7 A;  5TU0 A;  1IMF A;  3CHG A;  2GHB A;  5FHO A;  2UXA A;  3FUZ A;  3ODB A;  2QVU A;  2UVI A;  4LAT A;  3T0J A;  3DM0 A;  3MUQ A;  4GWX A;  1CB6 A;  3KJT A;  1IUD A;  4GWZ A;  3I6V A;  2L5V A;  1JVX A;  4F22 A;  1LGB C;  2AYS A;  1N7X A;  3C34 A;  5L9O A;  3OEK A;  4H67 A;  4F3S A;  3MZB A;  4OVS A;  5I7I A;  3K01 A;  5ELV A;  1PB7 A;  4GWO A;  3RPW A;  5H8N B;  2YPN A;  1IMC A;  3PPR A;  1JP4 A;  2DXR A;  1NV3 A;  3SER A;  1MDQ A;  4FIM A;  4XFE A;  2F34 A;  2F3D A;  5AA2 D;  2QFL A;  2FIX A;  3TCF A;  3DLN A;  3FAT A;  2QVV A;  4BDM A;  3TUS A;  5I5P A;  1FQB A;  1KWH A;  4GIZ A;  3UK4 A;  1DSN A;  2P1S A;  2F36 A;  3RPL A;  5I58 B;  1Y1Z A;  3TDJ A;  2HEU A;  2E0S A;  2IA4 A;  4ZZE A;  4PFW A;  2QMX A;  3NOH A;  2WEF A;  4RK2 A;  1MXW A;  3ECR A;  3O28 A;  2P0S A;  3E9X A;  5H8N A;  1B4Z A;  4O7M A;  4YU0 A;  2XWO A;  4QXD A;  4NX1 A;  4OVQ A;  2WYK A;  4I1D A;  4YAH X;  4QFN A;  1SI0 A;  1SW4 A;  4DXC A;  3FGS A;  5DEX A;  1EZO A;  5TP9 A;  2OPD A;  3Q27 A;  4EQ9 A;  4IO4 A;  2D21 A;  3VFJ A;  4DCX A;  1MQH A;  4IY5 A;  2REJ A;  3RYD A;  1MRP A;  4EUO A;  1T0K A;  5BWJ A;  4P11 A;  5IZZ A;  3THI A;  3IB1 A;  4PP0 A;  4KFQ A;  5AA2 A;  3C4M A;  3TEL A;  3SEV A;  4NWC A;  3M3K A;  2I48 A;  2THI A;  3KEI A;  2R8T A;  4R72 A;  3T22 A;  3HHF A;  2PYY A;  2GRV A;  4N6D A;  2XX8 A;  1O7T A;  4JBZ A;  1A54 A;  1QUL A;  1P1N A;  3IOR A;  3C31 A;  4FEC A;  3ZS6 A;  2HQ0 A;  3SEY A;  3R6U A;  3PUV E;  4GOT A;  3U8Q A;  2QS3 A;  4O3C A;  2RC9 A;  3KSJ A;  5ICQ A;  4U1Z A;  4R9G A;  4YB5 A;  3LSW A;  4DCY A;  4PFB A;  4KCC A;  4MNI A;  3AXF A;  2Z8F A;  3KN8 A;  1FPF A;  4U1O A;  3O6G A;  4GWS A;  3CG1 A;  3M3L A;  2OBG A;  4H65 A;  2H5Y A;  3TMG A;  5IKB A;  1NV5 A;  2Q9T A;  3O6I A;  4KHZ E;  1NUY A;  3MP8 A;  5HBC A;  2VT5 A;  2QS4 A;  3SES A;  4ZE9 A;  3MST A;  4BLA A;  4OAN A;  4PQJ A;  1HSE A;  1IXG A;  1FBH A;  4IY6 A;  4WXJ A;  3I5O A;  3T9V A;  3H03 A;  3SEX A;  3GBB A;  1G0I A;  2OK2 A;  2E1S A;  4JB7 A;  1TT1 A;  2NOO A;  4YMB A;  1KZ8 A;  3FXU A;  3TTN A;  3IB0 A;  3GYY A;  1FTO A;  3K6U A;  1CE2 A;  1MQJ A;  4OQO A;  2ONS A;  2ZYM A;  1A8E A;  1YXI A;  2F7A A;  4HS7 A;  3TCG A;  5DVF A;  2Q2C A;  1DPP A;  1H76 A;  3S9M C;  3TOD A;  3IFA A;  2CEY A;  3E3K A;  2KR0 A;  4U22 A;  3DEL B;  3MPL A;  5CBR A;  4IO7 A;  2CEX A;  3Q28 A;  4LUB A;  3IAZ A;  4OVP A;  4F1U A;  3BFT A;  1ZLQ A;  3G3H A;  4O94 A;  4KPT A;  1B1H A;  1B40 A;  1LAX A;  1LBV A;  3B6T A;  1B2H A;  2WBD A;  4N17 A;  2WBB A;  4IGR A;  1DOT A;  5JTY B;  1IXH A;  3IK6 B;  3QUF A;  1EYK A;  4NF4 B;  3UGW A;  3G3G A;  1LB9 A;  3OO8 A;  3EF7 A;  5TPA A;  1P99 A;  3QUJ A;  3KSX A;  3EHS A;  4JWY A;  1QGX A;  3UOR A;  4GLI A;  4ZS9 A;  2UVH A;  2PFZ A;  2O84 X;  3CG3 A;  4MMP A;  1NV2 A;  3CFL A;  2F7B A;  2ONR A;  4HE0 A;  3LR1 A;  5KDT B;  4PDD A;  1WDN A;  4KQP A;  1POT A;  3FVK A;  3MC2 A;  2AL4 A;  2FNC A;  4QBA A;  5H8H B;  3PUX E;  2I3V A;  2ZMB A;  3IX1 A;  2H4I A;  1VE4 A;  1XI6 A;  4KXP A;  1N04 A;  4TOZ A;  3OSQ A;  4NHB A;  5I3S A;  1VFE A;  1DK4 A;  3EQ1 A;  1FQE A;  2Y7P A;  3KG2 A;  3H06 B;  1LBB A;  1USY H;  3MVY A;  5DVI A;  5JTY A;  5EYF A;  4XEQ A;  4NF4 A;  3PD8 A;  2V3Q A;  3B50 A;  4GD5 A;  2AIX A;  4OEN A;  1BP5 A;  2V25 A;  4DI4 B;  3QMF A;  4GXA A;  2RKM A;  3IL1 B;  3QIM A;  5HM4 B;  3OO9 A;  1QKB A;  4ELO A;  5L8D A;  4FJP A;  5EYG A;  4R9F A;  5H8S A;  2LAO A;  3TTK A;  4NF0 A;  5EYH A;  5KDT A;  3GBA A;  4PFY A;  1MY0 A;  3OMB A;  1MPC A;  1PC3 A;  3FXB A;  3MVX A;  1NV1 A;  5IZ1 A;  4DXB A;  3PD9 A;  3LC8 A;  3RQT A;  1GGG A;  4NF8 B;  1F9B A;  3FXQ A;  3O97 A;  3U93 A;  1NMU A;  1M5F A;  5I57 A;  2ZXT A;  1MQG A;  3TQL A;  1VDW A;  1N84 A;  3FAS A;  2UVG A;  3FIR A;  4C1T A;  1B7U A;  3PUZ E;  4EF2 A;  3PMX A;  4IR8 A;  1XOC A;  2O51 A;  4MH5 A;  3G3I A;  1FQC A;  5I2K B;  2O69 A;  2XXK A;  3RT6 B;  5L9S A;  4THI A;  4OFJ A;  2ABH A;  1Y20 A;  5CMM A;  1IIW A;  3B6W A;  1B5J A;  2HAV A;  1EYJ A;  3Q29 A;  4PAF A;  1POY 1;  4YKK A;  4N6K A;  4N81 A;  5CC2 A;  4X9T A;  3QK6 A;  3C36 A;  3K0V A;  2ZYO A;  2Q74 A;  2VOZ A;  4RXL A;  2NVU B;  5EHS A;  2DQV A;  1SW1 A;  1NNF A;  1B3L A;  1TFA A;  2RCA A;  4F39 A;  2DWJ A;  1FTM A;  3HV1 A;  3MVW A;  3CSG A;  4M1V A;  3FJM A;  1GV8 A;  2I0C A;  1FPI A;  2O6A A;  1H44 A;  2VGQ A;  4R2F A;  2PMS A;  3S9L C;  3KOS A;  3QYT A;  3RT8 A;  2ALU A;  2QL3 A;  5H8F A;  5I59 B;  3MVZ A;  3IO6 A;  3OOA A;  5A5X A;  2VD2 A;  4N91 A;  3OO6 A;  4Q0C A;  5FTI A;  3RTW B;  2WX9 A;  3ROJ A;  1AH5 A;  1I6B A;  4P9K A;  4PFI A;  4DIG A;  5LTC A;  1NI9 A;  4FED A;  4U21 A;  4UAC A;  2G29 A;  5IZ3 B;  4RJZ A;  5I56 B;  5JEI A;  2DS9 A;  1JW5 A;  2O1L A;  3KOT A;  3FJ7 A;  1SYH A;  1LFH A;  2QJE A;  2B3B A;  1DCU A;  1LAG E;  4N8Y A;  3T1B A;  2Y5L A;  1HSJ A;  3H4Z A;  3PPN A;  1Y3Q A;  1XC1 A;  4QHQ A;  4GFR A;  1PBP A;  1UTH B;  4MJO A;  4X48 A;  1D4N A;  4OEV A;  3M3F A;  2ZZV A;  1B7Z A;  5I2N B;  4QFK A;  3E79 A;  1A7L A;  1RDX A;  3U65 A;  4GVO A;  2MKZ A;  4FAJ A;  4ZEC A;  5AA4 A;  1Q9D A;  2RC7 A;  3VVF A;  4LA9 A;  1TWY A;  1ZU0 A;  4GF8 A;  2XWI A;  4FBP A;  4P8B A;  1B5H A;  1FPD A;  3KN3 A;  4KYS A;  1J1N A;  4IO3 A;  4PE3 A;  3GXA A;  4ZEF A;  3K4U A;  4K3F A;  4JSO A;  4HXV A;  4G2Z A;  2V3U A;  1LEV A;  3T9X B;  1O64 A;  1ZBM A;  2HXW A;  3B7D A;  1ANF A;  3A3C A;  2DXY A;  2GFE A;  3QXM A;  4N4U A;  3V89 B;  4POX A;  4EXL A;  2FIE A;  4ZEK A;  1YZ0 A;  4F1Y A;  3SKP A;  2QS1 A;  4YKP A;  5EQ9 A;  2ONK E;  2XXX A;  5I2N A;  4NN3 A;  2I49 A;  5EHM A;  4I9D A;  5IAI A;  4OHN A;  2XA5 A;  3N6U A;  3TEP A;  2X26 A;  3W9W A;  3HO7 A;  4H6D A;  2R71 A;  1YYZ A;  5CRY A;  3CFX A;  1S50 A;  1MXU A;  1LBC A;  1MS7 A;  2V4C A;  1A99 A;  4DE8 A;  4ELQ A;  1DPE A;  2HXR A;  3LV0 A;  4ZED A;  3O66 A;  4GRK A;  1RYX A;  3T9U A;  1D9Y A;  3RN8 A;  2DWI A;  1XVY A;  2NXO A;  1MY1 A;  2OCU A;  4HE2 A;  4ISU A;  1SDX A;  3KBZ A;  3T9H B;  3VVD A;  1FTA A;  1GVC A;  1JET A;  4GX6 A;  5I58 A;  4X8R A;  1ZJL A;  1MY4 A;  3LBS A;  2HHM A;  4O7I A;  2Y7K A;  3OSR A;  4GBW A;  1NNK A;  4OYV A;  1EZP A;  4O8M A;  1FTJ A;  1B1X A;  4MBP A;  2H25 A;  1FPK A;  1BKA A;  3K1M A;  2HZL A;  4R74 A;  2UVJ A;  1B4H A;  3CRB A;  3IOW A;  2Y7W A;  4POW A;  1MY2 A;  3RY3 A;  1Y3N A;  5CI5 A;  1H3D A;  1RDY A;  1MM6 A;  1M5B A;  4WED A;  1NUX A;  3ILT B;  4U2R A;  2UYF A;  5DYH A;  3UIF A;  4NAP A;  1JW1 A;  1LCT A;  4HTG A;  1FBE A;  3EKI A;  5F1Q A;  4Q8R A;  1FCK A;  1QKA A;  1FBF A;  2GH9 A;  4JSD A;  1DTZ A;  4F19 A;  1OIB A;  2VPO A;  4OET A;  2Q8J A;  2F5X A;  3LSL A;  4G68 B;  1ATG A;  4XKR A;  4MX6 A;  4MF3 A;  5FBP A;  1Y3P A;  1XT8 A;  3MZ1 A;  4ELP A;  4HW8 A;  3CFZ A;  2Y84 A;  5T3J A;  1S7Y A;  1GR2 A;  1P1Q A;  1ZIU A;  3HFU A;  1IMA A;  2HPG A;  4PC9 A;  4QSE A;  1QUK A;  1BLF A;  3KGC A;  5ET6 A;  3RUM A;  4PET A;  4I40 A;  2FYI A;  2OZZ A;  1B51 A;  1M5E A;  2R9J A;  3ILU B;  1Y9U A;  3TTL A;  4NG7 A;  5H8Q B;  5FHM A;  5AA3 A;  3PUW E;  3DP4 A;  1B5I A;  2DSF A;  2O7I A;  3FVG A;  2XXY A;  4NF6 B;  4H45 A;  3A3U A;  1SI1 A;  4U4X A;  4AS5 A;  3CR9 A;  2F3B A;  3H6W A;  4MLQ A;  3TCH A;  5DTB A;  1EH3 A;  5FHN A;  1NFT A;  4TQU Q;  1B05 A;  4E0X A;  2PT1 A;  3BIG A;  5CMC A;  3QAX A;  1IXC A;  2RCB A;  2PX1 A;  4GL8 A;  1SD3 A;  2A5T B;  2DVC A;  1FBP A;  4GBV A;  4Q30 B;  1P1O A;  1ZKB A;  3RGY A;  2P3V A;  3GLB A;  2M8C A;  1QJM A;  1NV6 A;  1URG A;  2PFY A;  3L6H A;  1JEU A;  5HPQ A;  4LQ2 A;  1R9L A;  3IFC A;  3W9V A;  3FXR A;  1INP A;  3E4R A;  2CMO A;  1Q1K A;  2V93 A;  5F24 A;  4TLM B;  4RNS A;  2VD3 A;  5IM2 A;  5CM6 A;  1FJ9 A;  2DE3 A;  4RPN A;  1A40 A;  3MBP A;  3VLU A;  3VLV A;  4MNC A;  3IOT A;  1H43 A;  3USD A;  2XX7 A;  2ZYN A;  1JNF A;  4XKP A;  1XHY A;  2PBW A;  3CVG A;  4P0G A;  3O6H A;  2QPQ A;  1VR5 A;  5ET7 A;  3VXB A;  3TFL A;  3KFM A;  4TLL B;  4H46 A;  1MG1 A;  5KZT A;  3HCQ A;  3ISP A;  3B6Q A;  2HCA A;  1NNP A;  2XD3 A;  1JW4 A;  1B46 A;  4PAK A;  1R9Q A;  3IJO B;  1NV0 A;  4EDP A;  4KYE A;  4UA8 A;  3C33 A;  4XF5 A;  1MPB A;  2WKY A;  3ZKL A;  1UTB B;  1MH3 A;  1QUJ A;  3PPP A;  4Q5T A;  4UAB A;  1YAE A;  1LST A;  2DWA A;  1MQD A;  1IEJ A;  4XKQ A;  3C32 A;  4YIC A;  2QSX A;  3R26 A;  3OEM A;  4NF5 B;  2H99 A;  3PTY A;  4F18 A;  3I3V A;  1NV4 A;  2QRY A;  3H7M A;  5DVJ A;  4JVC A;  2P2A A;  2Z8D A;  1DBZ A;  4IO6 A;  4PFU A;  4P56 A;  2YLN A;  4NWD A;  5H8H A;  1URS A;  1N0T A;  3IOV A;  4G61 A;  4R6H A;  1EZ9 A;  4H0W A;  2NWJ A;  1P1W A;  1US4 A;  3DP8 A;  2NUV A;  4LVQ A;  1I6Q A;  4P47 A;  5KCJ B;  1OQH A;  2XWK A;  1UTB A;  1OVB A;  4MCO A;  3HST A;  1D9V A;  4WKM A;  2RIN A;  3S9E A;  2YJP A;  2CZH A;  3T93 B;  1ZMG A;  2Y5K A;  4GL0 A;  1FPJ A;  1LCF A;  5AE4 A;  4YMA A;  1Z7N E;  3KJ7 A;  1DMB A;  2O7U A;  4G8N A;  4P3L A;  4H5G A;  2CZK A;  3R7X A;  3BIH A;  1PDA A;  2F6G A;  1URD A;  2Z22 A;  3D4C A;  4OMB A;  2Q89 A;  1CNQ A;  1SPI A;  3P7I A;  4KD5 A;  4AS4 A;  4ZDM A;  2XWV A;  2OX3 A;  4F2O A;  4JWX A;  4N15 A;  2B4L A;  3B8B A;  1SVX B;  3H6T A;  3TYH A;  2O68 A;  3TTM A;  2XXH A;  4NF8 A;  4ND9 A;  2D3I A;  5ESY A;  2QS2 A;  1RKM A;  2QMW A;  4C0R A;  3CI8 A;  3WAE A;  4F31 B;  3A09 A;  4AB5 A;  1IMD A;  4NGU A;  1OMP A;  2Q8M A;  1SW2 A;  2I0B A;  1OLC A;  3T66 A;  2XD2 A;  1YPN A;  1AOV A;  1D3K A;  2O1M A;  2ZNT A;  4R6K A;  1FJ6 A;  4PE5 B;  2DYX A;  2XXP A;  4XTC Q;  3G7W A;  1NL5 A;  1IQ7 A;  4F2Q A;  1R1N A;  3IO4 A;  1B58 A;  4PF6 A;  3SEW A;  5I2K A;  1QW0 A;  3BFU A;  5K2Y A;  1FPL A;  4JXI A;  2DVZ A;  4GX4 A;  4KYD A;  3WAF A;  3IJX B;  4MFI A;  4I8C A;  1JQF A;  2DDK A;  3CSB A;  1MXV A;  4PF8 A;  4H1X A;  1H45 A;  4QSD A;  4RA1 A;  1KA1 A;  4KR5 A;  1QVS A;  3FBP A;  2GHA A;  1LB8 A;  3H6V A;  3F11 A;  1D9Q A;  4HCY A;  4OFO A;  2FBP A;  4QFO A;  2Q88 A;  4QRZ A;  3PPO A;  1FQD A;  3JV9 A;  4NTL A;  4R6Y A;  1FBC A;  1SYI A;  4LZ8 A;  1RDZ A;  3LUZ A;  5ICT A;  4ELR A;  2RF1 A;  1ELJ A;  4RY1 A;  4FEB A;  3V8X B;  2OWS A;  4RK9 A;  5L9M A;  1N7W A;  3ZKK A;  5I59 A;  2ESN A;  4X04 A;  4BDR A;  1SQY A;  2F6P A;  2DE2 A;  2XXQ A;  3PU5 A;  1NUZ A;  4OA4 A;  3FV2 A;  1AIV A;  1MXY A;  4OVT A;  1TFD A;  1IZ1 A;  4LQ5 A;  1FPE A;  1LBW A;  3K6W A;  5J1D A;  5IZ3 A;  4IGT A;  3CIJ A;  5I56 A;  2XHD A;  3KN7 A;  3RPL B;  3HHG A;  2FVZ A;  1AWB A;  3MAM A;  1FBD A;  1B6H A;  3O2A A;  5F7V A;  1A55 A;  2X7Q A;  1L5T A;  2CZL A;  4OEU A;  1MPD A;  1IMB A;  4U4S A;  3ONM A;  4C1U A;  3K6X A;  4QF9 A;  1Y1M A;  2KQZ A;  1UTH A;  2Y7I A;  1XVX A;  5ITO A;  2R6G E;  4PBH A;  3V83 A;  1MY3 A;  4PDH A;  2JJK A;  1VFD A;  2BJJ X;  3JYR A;  1US5 A;  1PB9 A;  3PMW A;  1NUW A;  1LAH E;  1LFI A;  2OJT A;  2A5S A;  5DEX B;  5ISU A;  5TP9 B;  2XXR A;  2F78 A;  2Z8E A;  2OWT A;  4N6P A;  4KCD A;  1LBY A;  4BDO A;  3FVN A;  4PAI A;  4H8I A;  3Q25 A;  2DE4 A;  4BDQ A;  1GTK A;  3KC0 A;  2GQ1 A;  5AA2 B;  4QSC A;  4XKN A;  4Z7E A;  1IME A;  2Z23 A;  4EQB A;  4P0I A;  5LDZ A;  1KA0 A;  4R75 A;  3M8U A;  2H9B A;  3VE1 B;  1FQF A;  4OVJ A;  3BBR A;  3D4G A;  4FE8 A;  5LOM A;  1A8F A;  1XS5 A;  4G8M A;  1FRP A;  4IO2 A;  2WYP A;  4ECF A;  2F35 A;  4MEV A;  4LN5 A;  3IR1 A;  2ZNS A;  3V5A A;  1I69 A;  4JWO A;  3OXN A;  3U72 A;  2G93 A;  4LON B;  4M4G A;  1B3F A;  5EQ8 A;  2CZI A;  2RC8 A;  1N76 A;  5EQA A;  1MQI A;  3MJN A;  1B3G A;  3MW0 A;  4OER A;  2F97 A;  1I6A A;  2D5W A;  1B0L A;  4DLD A;  3UP9 A;  1BIY A;  1NH7 A;  4O3A A;  4DZ1 A;  4JVI A;  5AA1 A;  4I3E A;  1FSA A;  3VLW A;  3FD3 A;  3N26 A;  3JZJ A;  1N3X A;  5I84 A;  2I6E A;  3U94 A;  3PGF A;  2I4C A;  2Q2A A;  4DDD A;  5M2V A;  3SET A;  3EN3 A;  4R73 A;  2I3W A;  4ESX A;  1UIV A;  1NNT A;  1FPG A;  4RYA A;  4GWU A;  4R2B A;  3RLF E;  3H6U A;  1NH8 A;  3VDF A;  1LBZ A;  4OXV A;  1SW5 A;  4G77 A;  1LBX A;  2H98 A;  4OES A;  3QSL A;  1AMF A;  1NV7 A;  2PCR A;  1RYO A;  4RPO A;  1B32 A;  1YCJ A;  4EXK A;  2DOJ A;  4OTE A;  3S9N C;  1SBP A;  3MPK A;  3ZSF A;  1OVT A;  3S4U A;  4IO5 A;  3TAJ A;  4GWW A;  4HE1 A;  4YB7 A;  1Y4T A;  1OQG A;  2HAU A;  4G68 A;  1WVJ A;  4GQO A;  2OLB A;  1JVY A;  2VHA A;  1Z7M E;  4I62 A;  5ITP A;  5ET5 A;  4N07 A;  1DTG A;  3MP6 A;  3EHT A;  1PEB A;  2QVR A;  4G8H A;  5CBS A;  4PCD A;  2ZNU A;  4YZZ A;  4OVR A;  3RNN A;  1G0H A;  3C9H A;  4ZE8 A;  4YKJ A;  2IEE A;  3RTF B;  1QUI A;  4HCW A;  4N13 A;  5TPA B;  1Q35 A;  2B3F A;  3OD7 A;  4ZZA A;  5H8Q A; 
#chains in the Genus database with same CATH homology
 2Y5K A;  4MJO A;  1FPJ A;  4MNP A;  2R8T A;  4GX3 A;  4P3L A;  2ZZV A;  2CZK A;  4N6D A;  1EYI A;  3BIH A;  3E79 A;  3U65 A;  1RDX A;  2MKZ A;  1Q9D A;  1CNQ A;  5IGA A;  5DW8 A;  1SPI A;  4MAG A;  2XWI A;  4FBP A;  4P8B A;  4AS4 A;  2XWV A;  2OX3 A;  1FPD A;  4N15 A;  2B4L A;  4PE3 A;  3B8B A;  1FPB A;  4HXV A;  1LEV A;  4PFB A;  5ESY A;  4P1E A;  4MNI A;  1FPF A;  5EQ7 A;  2OWZ A;  4N4U A;  4JVD A;  1IMD A;  4NGU A;  2FIE A;  1YZ0 A;  2Q8M A;  2ZZX A;  5EQ9 A;  4GWS A;  1NV5 A;  4NN3 A;  1FJ6 A;  2Q9T A;  4MIJ A;  2HZK A;  3KC1 A;  2XA5 A;  1NUY A;  3W9W A;  4PF6 A;  1FPL A;  1K9Y A;  2VT5 A;  2DVZ A;  4GX4 A;  1YYZ A;  1K9Z A;  3MST A;  4OAN A;  3A29 A;  4PGP A;  1FBH A;  2DDK A;  2V4C A;  4PF8 A;  2HXR A;  3LV0 A;  1G0I A;  1KA1 A;  2ZZW A;  3FBP A;  1D9Q A;  4HCY A;  2FBP A;  1KZ8 A;  5A5L A;  4HE2 A;  3GYY A;  4P1L A;  3KBZ A;  1FTA A;  4PTK A;  1FBC A;  4GX6 A;  4X8R A;  1YXI A;  1RDZ A;  2HHM A;  3LUZ A;  4O7I A;  4PBQ A;  4GBW A;  3IFA A;  4O8M A;  2CEY A;  2KR0 A;  1FPK A;  4X04 A;  2HZL A;  1BK4 A;  2DE2 A;  3E78 A;  1NUZ A;  4OA4 A;  2CEX A;  4OVP A;  4F1U A;  4PFR A;  4OVT A;  2BJI A;  1FPE A;  4PGN A;  1LBW A;  5J1D A;  4O94 A;  1RDY A;  4GWY A;  5IZ3 A;  1NUX A;  5J16 A;  1LBV A;  3RPL B;  2FVZ A;  1AWB A;  2WBD A;  1FBD A;  4N17 A;  2WBB A;  4NAP A;  1EYK A;  4MHF A;  2FHY A;  2B4M A;  1IMB A;  1QGX A;  1FBE A;  2VPN A;  3EKI A;  2KQZ A;  1FBF A;  2PFZ A;  4F19 A;  4PBH A;  4NQ8 A;  4MMP A;  1NV2 A;  2VPO A;  2F5X A;  4PDH A;  2JJK A;  4HE0 A;  1FBG A;  1NUW A;  4PDD A;  2P3N A;  4MX6 A;  5FBP A;  4QBA A;  5T3J A;  1LBY A;  1XI6 A;  4KXP A;  4PAI A;  3HFU A;  1IMA A;  2HPG A;  4PC9 A;  4NHB A;  3SZP A;  5I3S A;  1DK4 A;  4F1V A;  2DE4 A;  5ET6 A;  3MYU A;  4PET A;  4I40 A;  3KC0 A;  2GQ1 A;  4XEQ A;  4DI3 D;  2V3Q A;  3B50 A;  1IME A;  3D1R A;  4DI4 B;  4I3Y A;  5LDZ A;  4NG7 A;  5ET8 A;  3QMF A;  1KA0 A;  5JK4 A;  5EYG A;  4N8G A;  5EYH A;  4NF0 A;  1FRP A;  4H45 A;  4AS5 A;  2WYP A;  2F3B A;  3FXB A;  1NV1 A;  5IZ1 A;  4MEV A;  4LN5 A;  1IMF A;  3CHG A;  3BIG A;  5EQ8 A;  1FBP A;  4GBV A;  2CZI A;  2QVU A;  3T0J A;  5EQA A;  4GWX A;  2P3V A;  1VDW A;  1NV6 A;  2PFY A;  4GWZ A;  2L5V A;  3IFC A;  3W9V A;  4IR8 A;  1INP A;  4JVI A;  4I3E A;  1FSA A;  5F24 A;  4OVS A;  5IM2 A;  5CM6 A;  1FJ9 A;  2DE3 A;  2XXK A;  5I7I A;  4MNC A;  1IMC A;  1JP4 A;  1NV3 A;  1EYJ A;  4PAF A;  4N6K A;  4N81 A;  2QPQ A;  5ET7 A;  4X9T A;  4XFE A;  2F3D A;  2QFL A;  2Q74 A;  2FIX A;  1FPG A;  4GWU A;  2QVV A;  4H46 A;  5I5P A;  1LBZ A;  1LBX A;  3ISP A;  1NV7 A;  3RPL A;  4M1V A;  4PAK A;  2PCR A;  1NV0 A;  4XF5 A;  1FPI A;  3NOH A;  2WEF A;  4UAB A;  4GWW A;  4YIC A;  4HE1 A;  4O7M A;  2XWO A;  4QXD A;  3PTY A;  4NX1 A;  4N91 A;  4F18 A;  4OVQ A;  1NV4 A;  2WYK A;  4JVC A;  2WX9 A;  3ROJ A;  1DBZ A;  4P9K A;  4PFI A;  5LTC A;  4P56 A;  5ET5 A;  1NI9 A;  5IZ3 B;  2QVR A;  4G61 A;  4PCD A;  4YZZ A;  4OVR A;  3RYD A;  1G0H A;  4P47 A;  2XWK A;  5IZZ A;  1DCU A;  4N8Y A;  3T1B A;  4HCW A;  4MCO A;  2Y5L A;  2CZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...