5ET8A

Human muscle fructose-1,6-bisphosphatase in active r-state in complex with fructose-6-phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
287
Chain Sequence
DMLTLTRYVMGELTQLLNSMLTAIKAISSAVRKAVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGASIGTIFAIYRKPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-to-R switch of muscle FBPase involves extreme changes of secondary and quaternary structure
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
total genus 88
structure length 287
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et8A02
2P3VA 1NI9A 2Q74A 2CZIA 3LUZA 4GWUA 1IMBA 1IMDA 1RDZA 2R8TA 2WEFA 4GWWA 2BJIA 3RYDA 2CZKA 5LDZA 4HE2A 1FTAA 1NV0A 1VDWA 4GX6A 2HHMA 3D1RA 2P3NA 1DK4A 3BIGA 4PTKA 5ET8A 5J16A 5IZ3A 5EQAA 1AWBA 1NV7A 2F3BA 4GWZA 1D9QA 5EYGA 1KZ8A 3KBZA 5ET5A 1NV1A 1YZ0A 5ET6A 4GBWA 2FHYA 2Y5LA 1QGXA 2WBBA 2QVRA 3KC1A 1NV6A 1FPKA 1Q9DA 1FPEA 2DDKA 1IMCA 4GX4A 4MJOA 1FBPA 4GX3A 3BIHA 1FPFA 1FRPA 3LV0A 2JJKA 2Y5KA 3ROJA 2F3DA 1G0IA 2OX3A 1K9ZA 4KXPA 3B8BA 4HXVA 4GWYA 5I3SA 1IMFA 1FPDA 1LBZA 5EQ7A 1FBHA 5IZ1A 4I3EA 1FJ9A 1NV2A 2QFLA 1FBGA 1FPJA 1NV4A 4AS5A 3A29A 4GBVA 1LBXA 1JP4A 1YXIA 1CNQA 2OWZA 5EQ9A 1BK4A 2GQ1A 5EQ8A 4GWSA 1LBVA 3FBPA 2Q8MA 5DW8A 1RDXA 1NUWA 5EYHA 1FSAA 1EYKA 5FBPA 4HE1A 1DCUA 2PCRA 4I40A 3T0JA 2FIEA 1IMAA 1FPGA 5IZ3B 1FBFA 4O7IA 1KA0A 1FPBA 4GWXA 5A5LA 1DBZA 3RPLA 1RDYA 1NUXA 1SPIA 2FIXA 1INPA 4H46A 1LBWA 1NUYA 1XI6A 2FVZA 2CZHA 1FBCA 1FBDA 1IMEA 2QVUA 3QMFA 4FBPA 4AS4A 1LBYA 1FPLA 4H45A 2QVVA 1NV5A 4IR8A 1NV3A 1LEVA 5T3JA 5ESYA 4I3YA 4N81A 5F24A 1NUZA 3IFCA 2WBDA 1EYIA 1FJ6A 2VT5A 3KC0A 1YYZA 1FPIA 1FBEA 3RPLB 1KA1A 1K9YA 1EYJA 1G0HA 4G61A 5ET7A 4HE0A 2FBPA 4QXDA 3IFAA
chains in the Genus database with same CATH superfamily
1SQYA 2OK2A 3LUZA 1IXGA 1IIWA 1LB9A 4EF1A 4FORA 1GGGA 2F5XA 3DP6A 5J16A 4X1BA 4O94A 2XXRA 2D21A 4RY1A 4YB5A 2XXWA 2ONKE 1A55A 1KZ8A 3GLBA 4MF3A 1A8FA 4GX3A 2ALUA 3PUVE 2CZLA 1DSNA 2AL5A 5I56A 2OX3A 1B3GA 4NWCA 5H8HA 2ANJA 1FQBA 3S9LC 5IZ1A 1SBPA 1B7UA 1MQIA 4ONYA 2GH9A 5FHOA 1JP4A 2CMOA 4YB7A 3ZSFA 2YJPA 4O3CA 5EYHA 2HAVA 2QL3A 3N6UA 4ELQA 4NF5B 3Q28A 1UQWA 1IMAA 2V3TA 2A5SA 4LQ2A 2GRVA 5AA2D 2FIXA 1GTKA 2NUVA 3OD7A 1XI6A 4IO3A 4KCCA 4FJPA 1DMBA 2UYEA 3FV1A 2CEYA 1FPLA 3FJ7A 4WKMA 4ND9A 2I48A 3CSGA 3OXNA 3LSLA 3RLFE 2RCBA 3H6VA 4ZE9A 1FPIA 4G8HA 5ET7A 1OQGA 4X48A 2Q89A 3ILUB 4F1UA 1A8EA 3U93A 4U4XA 4PF6A 4PF8A 1IMDA 3Q27A 3FV2A 2BJIA 4RK2A 4G68A 5ET8A 1VFDA 4NF6A 4TQUQ 4OFJA 1L5TA 5EYGA 4QRZA 3U1OA 2I49A 1FQCA 4ZEBA 3MAMA 1FCKA 3C31A 3C32A 4LA9A 4KI0E 4LUBA 4G68B 2ZYMA 3OELA 5FTHA 4FIMA 1PBPA 1HSEA 5TP9B 4P11A 5EHMA 3PGFA 4IO6A 3CG1A 1FBGA 2Q8JA 3MP8A 3IB0A 3IL1B 4PGPA 4JWYA 3S9EA 2GQ1A 3FBPA 1SDXA 4PFTA 4KYDA 5DTBA 2UYFA 4P3LA 3G3GA 1JEUA 4N13A 3M3KA 2F6GA 3R26A 3PMXA 3VVEA 1AH5A 1NUYA 5I58A 4PFRA 2OPDA 1FBDA 2V93A 1O64A 2WYPA 4H5FA 2I3VA 2QVVA 4XKQA 4X04A 1LEVA 3EPEA 4XKNA 2HCAA 3OO7A 2RC7A 1FQEA 3MVWA 4DI3D 1PB9A 3SZPA 2RINA 1XC1A 2HPGA 5I59B 3IFAA 4GD5A 3TKDA 5H8FB 1ZU0A 4JXIA 4XKPA 3B6WA 1GVCA 2F7AA 1QVSA 4HW8A 4YU0A 2F3BA 3I3VA 1Y1ZA 1JW4A 4PC9A 4LN5A 3U94A 1NV6A 2DDKA 4MJOA 1B4ZA 2Y7KA 1LSTA 3GBBA 2H98A 5L9SA 3MP6A 1ANFA 1H43A 1O7TA 1LBZA 5EQ7A 4BDNA 3C36A 3JV9A 4C1TA 1BKAA 4ZE8A 3K6VA 4YKKA 3MVYA 4KCDA 2W7YA 2XXQA 2OWZA 4BDLA 1EU8A 3PUYE 4OEVA 2OWTA 2DE4A 1WODA 4X1DA 3KJ7A 1QUJA 1B40A 4R9FA 3K2DA 5A5LA 4DXBA 1H3DA 3QUJA 2B3BA 3W9WA 1T0KA 3USDA 1FBCA 1VE4A 2QVUA 5CMBA 1MY1A 4BDQA 4YKIA 3MYUA 3T22A 3TZAA 2HFBA 4F1YA 3N5LA 3MUQA 3N26A 1KA1A 1MDP1 3RT6B 3BKIB 1Y9UA 1LAGE 5KCJB 5JEIA 3RPWA 3TTRA 1XOCA 2HZLA 1N76A 3IB2A 3GYYA 4P1LA 1OMPA 1AWBA 1KWHA 1SYHA 4OERA 5DVJA 4DLDA 3K1NA 4OVQA 5B70A 3KG2A 1YZ0A 3HPIA 1Z7NE 5I2KA 4ECFA 5AA4A 1NNTA 2HAUA 1FTLA 1BP5A 4GQOA 4Q0CA 1LCFA 2QS3A 5J1DA 4HXVA 4ESXA 4EUOA 3BFTA 3O6HA 4EDPA 1XVYA 1EZOA 3CVGA 2RC9A 4IY6A 4OVRA 5BUUA 1UTBB 5DT6A 3TQLA 1MDQA 4H67A 1YPNA 3OEKA 2MKZA 5KZTA 1R9LA 1LAHE 2REGA 2ZNUA 2FIEA 1D9VA 3SEWA 1DBZA 2XX8A 2WKYA 1LBWA 4NF8B 3W9VA 5H8QA 2ZNTA 4FBPA 4R74A 3QK6A 4XIGQ 3B7DA 4FAJA 3ECRA 3PTYA 3CSBA 5AA4B 1QUIA 3MJNA 2D3IA 3OO6A 2A5TA 3K6WA 5LTCA 3P7IA 1IEJA 1R9QA 3GZGA 4QFOA 5CBRA 3UK4A 1CE2A 4HE2A 1VDWA 4YKJA 1NV7A 3IB1A 1FQAA 1SI1A 1N04A 2UVIA 4E0XA 3PMVA 1M5BA 3C35A 4QSEA 1N7XA 4ZEKA 2DQVA 4GX4A 4PAFA 3HCQA 4OVJA 4OZ9A 3K6UA 1URSA 3TYHA 1F9BA 4EXLA 2UVGA 3V5AA 4KXPA 3PPPA 2PMSA 2KR0A 3S9MC 3KBRA 4RNSA 2GHAA 5TPAA 4FATA 4GFRA 2ZZXA 1IZ1A 4C0RA 4RPOA 2GHBA 3D4GA 1MXVA 3OEMA 2KQZA 5TPAB 4YB6A 1JW5A 1DTGA 4DIGA 2HZKA 4DCYA 4RA1A 1AMFA 4QFKA 1FPBA 1MQHA 3UN6A 1SPIA 4P9KA 3T66A 3HHGA 4OVPA 3PV0E 3QMFA 3CFZA 2QS4A 4JSDA 2XWVA 4PFIA 3O6IA 4H8IA 5CRYA 2DWHA 2GFEA 2REJA 2O1LA 3OO8A 1R6ZA 3OMBA 2HXWA 2YPNA 4BDOA 3RPLB 3S2VA 3CIJA 4G4PA 2PVUA 3A3UA 3UORA 2CZIA 4NF0A 5F1QA 3CFLA 5I59A 5ICQA 1NV0A 2THIA 4HCWA 3N6TA 2UVJA 4PCDA 3O2AA 4NGUA 4OTEA 3TDJA 5ET6A 4XFEA 3B6QA 3EHUA 4YKPA 1D4NA 1FW0A 2XWIA 3TUSA 4PETA 1EZ9A 2F36A 2DS9A 2H5YA 1MY4A 1AIVA 3O28A 4MBPA 3E79A 4MMPA 3RNNA 1LB8A 1URDA 1O63A 2VD2A 1SW5A 3U65A 1FBHA 4POWA 4JB7A 3RGYA 1NV4A 4OXVA 2HXRA 4U22A 2QRYA 3IORA 3UGWA 3TPAA 4GWSA 2X26A 4TLMB 3A09A 2Q8MA 2OLBA 1B9JA 2H25A 4ELOA 4JDFA 2OZZA 1FPGA 1Y4TA 1MQGA 1KA0A 1JQFA 4Z0IA 1IXIA 1INPA 1B46A 4ZDMA 3FGSA 2WYKA 4PFWA 1N0TA 2XD2A 3IOUA 3MC2A 3H6UA 5H8HB 1LBYA 5FTIA 2E0SA 2WX9A 2XHDA 3OOAA 5EHSA 1USYE 3EKIA 1US5A 4N81A 1FJ6A 2XD3A 4UACA 1SI0A 2Q88A 3QIMA 4I9DA 5CM6A 1PEBA 3E9XA 4O8MA 1S9TA 3FXQA 2XXYA 4FE8A 1FTOA 4QFNA 2R6GE 1PC3A 3MQ9A 1B7ZA 2RC8A 3K1PA 3G3KA 4PAIA 3FVKA 4YICA 3RT8A 3IAZA 1FTMA 4XTCQ 1P1WA 3GXAA 1OVBA 2AIXA 1D9QA 1LFIA 3FIRA 5CBSA 4JSOA 1MH4A 3HHFA 1LCTA 1GV8A 5L9MA 2VGQA 5BWJA 1FQDA 2PX1A 4OENA 3BIHA 1Y20A 5AA3A 2VD3A 4ZEDA 2NXOA 1MY0A 3TCHA 2KLFA 3IR1A 3KEIA 1Y4CA 1VR5A 1A7LA 4RYAA 3TTKA 2I0CA 4DCXA 4PP0A 4NTLA 3ONMA 4N6DA 4N4UA 4OETA 3IK6B 4P0IA 2F35A 4F22A 3L6HA 4NX1A 4LATA 3C9HA 3LSFB 5I57B 3MP1A 1ZKBA 1POTA 1B2HA 3FXBA 5I84A 3MVXA 3PUZE 1JW1A 2O7UA 2O68A 3U8QA 4OEUA 3IOTA 3RPLA 4UA8A 1NKXA 1NNPA 1S7YA 3FD3A 2R71A 2YLNA 3EHSA 1EZPA 5ITOA 3GBAA 4F3BA 4H1XA 1I6BA 3H06B 4R75A 4KYSA 3TTMA 4N6PA 1B7HA 2DXYA 1TFAA 4QXDA 2O69A 3FJGA 3E78A 1SD3A 4YMBA 1IMBA 3R6UA 1RDZA 3PD9A 3SEUA 1MM6A 4N17A 3BIGA 4PTKA 3M3FA 1JNFA 3H4ZA 4GWOA 5CMKA 4XKRA 4DDDA 4R6KA 1B1HA 2ABHA 2Y5LA 3KC1A 1Q9DA 1GR2A 3E4RA 5HPQA 1MPDA 2H4IA 1NFTA 4MLVA 2V3QA 4NMYA 3SDFA 4WXJA 1P99A 3VLVA 2LAOA 4POXA 2XXKA 4GWYA 5I3SA 2VHAA 3EF7A 1AOVA 3PU5A 1NV2A 2B65A 3IO4A 2ZZWA 1MXZA 3PMWA 5FHMA 4PBHA 2DP8A 4H0WA 1MXUA 1B5IA 4I40A 3EQ1A 2FA7A 4PFUA 3ILTB 4OA4A 3IJOB 1PB8A 2X7PA 4GL0A 5I2NA 4AB5A 4NF6B 3VLUA 3KFMA 2ONRA 1M5CA 1QUKA 4WEDA 3T1BA 3S9NC 2DWJA 1S50A 1N7WA 1K9YA 5A5XA 1M5DA 4ZEFA 3AXFA 5HBCA 1M5EA 4PQJA 3KOTA 2DWAA 5JK4A 1LFHA 2Z8FA 1FTAA 2V84A 2B3FA 4LP2B 4P47A 4PE5B 5IZ3A 3DP8A 4LZ7A 1US4A 2ZYOA 2Z8DA 2Y84A 2NWJA 4GBWA 4IO4A 4H5GA 1Y3PA 3L6GA 1FPEA 4MNPA 3O9PA 4QSCA 1DPEA 4R73A 3LV0A 5DYHA 1I69A 3T9UA 3VV5A 1MG1A 4KR5A 4N15A 5ITPA 3O66A 2BJJX 3S4UA 3PPRA 2R9JA 1FJ9A 4Q8RA 2XX7A 4DXCA 1WDNA 2AL4A 1NNKA 4ELPA 3FXRA 5IAIA 5ISUA 1A54A 1Y1MA 1B05A 3OENA 5B7DA 5I56B 1XT8A 1UTHA 4QFLA 2O84X 1FSAA 1EYKA 1RYXA 1H44A 3KJTA 3ISPA 4MEVA 4F19A 4QSDA 3H3GA 3SEXA 3OO9A 3QSLA 4GWXA 5HM4B 3K00A 1NUXA 4U21A 4F3GA 2FVZA 4F2QA 4OANA 1ZBMA 3LBSA 3ODBA 4MX6A 1B3LA 4OQOA 1NV3A 4JVDA 2DYXA 2Z22A 5ESYA 3EHTA 5F24A 2VT5A 5ICTA 3KSJA 3KN3A 4R72A 4YMAA 2O7IA 5A5XB 2NVUB 4NF4A 4QFPA 2R8TA 3OSRA 4GWWA 2CZKA 1DK4A 2RKMA 1II5A 4LQ5A 2G93A 1TXFA 3VXBA 3FJMA 1RYOA 2XXTA 3R7XA 1CB6A 1I6QA 3VVDA 1LFGA 1OIBA 1ELJA 2QVRA 2ESNA 5M2VA 4OHNA 5IZZA 1B3FA 1B5JA 3C34A 2F7CA 3FVOA 2I6EA 4IGTA 2I58A 3TTLA 1OLCA 3QYTA 3PUWE 3FVNA 4U2RA 5I2KB 1TFDA 5F7VA 2ZYKA 3T96B 4U23A 1POY1 4KYEA 2Q2AA 1BK4A 3FATA 4EQBA 4MNIA 4P1EA 3MPKA 3MZ1A 5JTYB 4Q30B 1URGA 4BDMA 2RF1A 1WVJA 3VLWA 1JVXA 2F34A 1ZJLA 2ZXTA 5AA2A 1B1XA 4AS4A 3FUZA 5L8DA 4IR8A 2IA4A 5AA2B 2VP1A 1BLFA 3IFCA 4XF5A 2HEUA 1XS5A 4GVOA 4X8RA 3K4UA 2XXUA 4GOTA 3T9HB 4BDRA 3TELA 2Q74A 4M1VA 2PT2A 4PAKA 3SETA 2UXAA 3H6TA 1R1NA 4LVQA 4ISUA 4U1OA 4GX6A 2OJTA 4IO7A 2F7BA 4I62A 3UP9A 3PD8A 4GXAA 3I6VA 4K3FA 1HSJA 3QUFA 5DVFA 5ET5A 1EH3A 1B4HA 2I0BA 4PDDA 3T93B 4O7MA 1B6HA 4G8NA 4MNCA 5I58B 4RXLA 3LC8A 4LZ5A 4QF9A 3K1MA 4AQ4A 3SERA 2Y7IA 3K02A 4OFLA 3KOSA 4P56A 1UIUA 4TOZA 1JETA 3TTNA 3K0VA 1OLAA 5IM2A 1VSOA 4F39A 1SW2A 2B4LA 4I1DA 2FNCA 3TAJA 3FXUA 1RDXA 2HQ0A 1IQ7A 2Z8EA 4C1UA 1USYH 4QHQA 1LBBA 2XX9A 4YZZA 1ZMGA 3EN3A 1IMEA 2DWIA 3CFXA 2AYSA 3IX1A 4KPTA 1YCJA 1NH8A 1P1NA 4QBAA 2QS1A 3QAXA 4IO5A 1EYIA 3U92A 4GLIA 1DPPA 1FBEA 4PGNA 1MQJA 4N8GA 4R2FA 4MHFA 2ZNSA 4ESWA 1QW0A 3HFUA 5CI5A 1MH3A 3H03A 5JTYA 3D1RA 4LZ8A 3HN0A 1UTHB 2I4CA 4PFYA 2DSFA 1YTVA 3ZS6A 3PPQA 2OWSA 5I5PA 4XXUA 1QGXA 4IGRA 4MIJA 3SESA 3JZJA 3RN8A 3G3IA 3O6GA 5CMCA 2F97A 1FRPA 3F11A 2D5WA 3QXMA 3TMGA 3MSTA 4AB6A 4RJZA 1P1UA 3I5OA 1K9ZA 5IKBA 3VE1B 1FPDA 1Y3QA 4MLQA 1IUDA 4Q5TA 3BFUA 3LSWA 1B5HA 3TQWA 2L5VA 4GIZA 4MCOA 4F3SA 1M5FA 4PDHA 4ZZAA 4G8MA 3JYRA 1MXXA 3E13X 3O29A 4DE8A 2DVZA 3Q26A 1SVXB 3H6WA 1P1OA 3RY3A 2QMWA 4N91A 1QJMA 2ZMBA 4JVIA 2QSXA 3IOVA 4NWDA 3VVFA 5I7IA 4GRKA 4GF8A 3IJXB 2F78A 3N94A 3THIA 4NN3A 4I3YA 2DVCA 3KZGA 1SYIA 4Z7EA 1YYZA 4F1VA 4IY5A 4G2ZA 1EYJA 1G0HA 1B0LA 4HE0A 5H8SA 2FBPA 2DOJA 1VFEA 1NI9A 3LR1A 3HV1A 5KDTA 5FHNA 1YAEA 3RYDA 2I3WA 1XHYA 2B4MA 5H8NB 2PFYA 2P0SA 2O6AA 2Y7PA 4ELRA 2VOZA 4KD5A 2Y7RA 4O3BA 2VPOA 2XXVA 1NV1A 3KN8A 1Q35A 4I8CA 4THIA 1PDAA 1MY2A 1BIYA 3VFJA 3RTFB 3K01A 1FBPA 2ONSA 2F6PA 5I57A 3WAFA 4EQ7A 4UABA 1QKBA 1NMUA 4P8BA 4FEDA 4IO2A 1OQHA 4GL8A 3PPOA 2OPEA 3MVZA 4H8JA 4OYVA 5DEXA 1LBXA 2H9BA 3ZKLA 1LAXA 5AE4A 4RPNA 5EQ8A 1LBVA 1XVXA 4G68C 5DW8A 1QKAA 2E1SA 3M3LA 4M4GA 3DM0A 4IB2A 3MBPA 5KDTB 4OMBA 3T0JA 5IZ3B 4N6KA 4ZECA 2IEEA 1FTKA 3B6TA 1NL5A 1LAFE 1B51A 2CZHA 2XXHA 4GXSB 3MZ9A 1MS7A 4FEBA 4OWDA 4NQ8A 3WAEA 1UIVA 4H45A 1B52A 1HSLA 4FECA 3TFLA 5CC2A 2PT1A 4KHZE 1IXCA 1RKMA 2XXXA 3RQTA 1OVTA 2DE3A 5ELVA 2P3VA 1TWYA 4MFIA 2QJEA 4JWXA 2WEFA 4OVTA 1DOTA 4NF8A 2HHMA 3D4CA 4E0WA 3DLNA 4GWZA 2M8CA 3V8XB 4P0GA 4F18A 3SEVA 3LUYA 3KBZA 3MW0A 1ZIUA 1MPCA 1FPKA 1IMCA 2VPNA 3FASA 1LGBC 4MAGA 2JJKA 2FYIA 2Y5KA 2X7QA 4H65A 2RCAA 1D3KA 3CHGA 3TODA 2V4CA 3C4MA 5H8FA 4X9TA 4EF2A 5H8QB 3CR9A 3CG3A 5EQ9A 1LLSA 4JWOA 4NAPA 4NF4B 4NG7A 3K6XA 4XEQA 3KN7A 2NOOA 3G3FA 3HO7A 4U4SA 3Q25A 1DCUA 2PCRA 3H7MA 3UA8A 4R6YA 4R9GA 4HS7A 3FZVA 4F3PA 1RDYA 2PFZA 2PBWA 1B3HA 3IOWA 1UTBA 3TEPA 5EYFA 4DZ1A 1NV5A 1Z7ME 1ATGA 2V3UA 3IO6A 3KGCA 4HCYA 3RTWB 5DEXB 1I6AA 4DXUA 4EQ9A 3KSXA 3W15C 3TCGA 1A40A 3V83A 5I2NB 1AL3A 1N3WA 4HTGA 3MWBA 1BTJA 5EQAA 1N84A 4NHBA 1LBCA 4OVSA 4N8YA 2A5TB 2FHYA 4O3AA 3G3HA 4DI4B 2WBBA 4BLAA 1B3EA 3FVGA 1IITA 4F31B 4RK9A 3TCFA 1A99A 2F3DA 1G0IA 5TP9A 1TT1A 3B8BA 5KCJA 3RUMA 4LONB 3ZKKA 4F2OA 4I3EA 1N3XA 2QPQA 3NOHA 5IGAA 2O51A 4AS5A 2UVHA 4G77A 2CEXA 3CI8A 5TU0A 4U1ZA 1SW1A 4EXKA 4F29A 3V89B 1NUWA 3E3KA 2Q9TA 1B0HA 1B58A 3OSQA 4HE1A 4PFBA 3A3CA 1MPBA 4O7IA 2XXIA 2P1SA 1PBQA 1MM7A 2H99A 4H46A 2XA5A 3DP4A 3VDFA 2ZYNA 1JEVA 4NEDA 4PE3A 2QMXA 3BBRA 3UIFA 4NF5A 3T9XB 2WBDA 1Q1KA 4MH5A 3KC0A 1MRPA 5DVIA 1Y3NA 3VXCA 4GWUA 2I4BA 4ZZEA 1MXWA 1B32A 5LDZA 1SW4A 2P3NA 3Q29A 2DXRA 4ZS9A 3MZBA 4KFQA 3LSXA 3SKPA 1D9YA 5K2YA 1H76A 3B50A 2XXPA 4JVCA 4TLLB 4ZEIA 3PUXE 1IXHA 1FPFA 1MXYA 1FQFA 5K2XA 1MQDA 2OBGA 2P2AA 4R2BA 3ROJA 1DTZA 2QS2A 3SEYA 2O1MA 4L17A 3M8UA 1FTJA 2Y7WA 3CRBA 1ZLQA 2XWKA 1H45A 1QULA 1IMFA 3G7WA 3O97A 4OFOA 1NH7A 3PPNA 4JBZA 2QFLA 2Q2CA 1FPJA 1ZTYA 4N07A 3A29A 4OESA 4GBVA 2OCUA 2XWOA 1YXIA 2F8DA 1CNQA 4H6DA 3HSTA 4WEPA 5L9OA 2ZZVA 1P1QA 4R6HA 5FBPA 4YAHX 5LOMA 3C33A 2G29A 4PBQA 1FBFA 5CMMA 1PB7A 3G3JA 4KQPA 3MPLA 3U72A 3T9VA 1J1NA 1MY3A 5T3JA 3DELB 1NNFA 1NUZA 1JVYA 2PYYA 5H8NA 2DE2A 4G61A 2Z23A 5AA1A 4NE4A 2V25A
chains in the Genus database with same CATH topology
2DE3A 2P3VA 1NI9A 2Q74A 4M1VA 2CZIA 3LUZA 4NF0A 3HFUA 4GWUA 4PF6A 5JK4A 1IMBA 4PF8A 1IMDA 4PAKA 1RDZA 2R8TA 2WEFA 4GWWA 4OVTA 2BJIA 3RYDA 2F5XA 2CZKA 5LDZA 2HZLA 4HE2A 1FTAA 1NV0A 1VDWA 4GX6A 4HCWA 2HHMA 3D1RA 2P3NA 1DK4A 3BIGA 4PTKA 5ET8A 5J16A 2B4MA 3GYYA 2PFYA 4P47A 4PAIA 5IZ3A 4P1LA 5EQAA 4O94A 4YICA 1AWBA 1NV7A 2F3BA 4PCDA 4GWZA 4NGUA 4F18A 5I5PA 4OVQA 4NHBA 1D9QA 5EYGA 2VPOA 3B50A 1KZ8A 3KBZA 5ET5A 1NV1A 4OVSA 3E78A 1YZ0A 5ET6A 4N8YA 4PC9A 4XFEA 4GBWA 2FHYA 4LN5A 4PDDA 2Y5LA 1QGXA 4O7MA 4JVCA 4MIJA 2WBBA 4DI4B 2QVRA 3KC1A 1NV6A 1FPKA 1Q9DA 1FPEA 2DDKA 1IMCA 4GX4A 4MJOA 4MNCA 1FBPA 4GX3A 2VPNA 2XWIA 4MNPA 4PETA 3BIHA 5IZZA 1FPFA 1FRPA 3LV0A 2V3QA 4MAGA 2JJKA 3MSTA 2Y5KA 4UABA 3ROJA 2F3DA 1G0IA 2OX3A 3E79A 4N15A 3CHGA 4MMPA 1K9ZA 4P8BA 2V4CA 4KXPA 2XWKA 3B8BA 2XXKA 5J1DA 4HXVA 2KR0A 4GWYA 5I3SA 1IMFA 1FPDA 1LBZA 3U65A 5EQ7A 1FBHA 5IZ1A 2ZZXA 4I3EA 1FJ9A 1NV2A 2QFLA 1FBGA 1FPJA 2QPQA 3NOHA 5IGAA 1NV4A 4P56A 4AS5A 4X9TA 3A29A 2HXRA 4N6DA 4N4UA 2ZZWA 4OVRA 4GBVA 2CEXA 5IM2A 4YZZA 1LBXA 1JP4A 2KQZA 1YXIA 2B4LA 2XWOA 2L5VA 4PGPA 1CNQA 2OWZA 5EQ9A 4MCOA 4NX1A 4PDHA 4X8RA 1BK4A 2GQ1A 5EQ8A 4GWSA 4NAPA 1LBVA 3FBPA 2Q8MA 2ZZVA 5DW8A 1RDXA 4NG7A 4MNIA 1NUWA 4XEQA 4P1EA 5EYHA 2MKZA 4PBHA 2Q9TA 3FXBA 1FSAA 4P3LA 2DE4A 1EYKA 5FBPA 2HZKA 4HE1A 1DCUA 2PCRA 4I40A 3T0JA 3ISPA 4PBQA 2FIEA 4MEVA 4PFBA 2DVZA 1IMAA 1FPGA 5IZ3B 4F19A 1FBFA 4O7IA 4N17A 1KA0A 1FPBA 4N6KA 4GWXA 5A5LA 1DBZA 3RPLA 1RDYA 1NUXA 1SPIA 2FIXA 2PFZA 4P9KA 3W9WA 1INPA 4H46A 1LBWA 2XA5A 1NUYA 1XI6A 2FVZA 2CZHA 4N91A 4OA4A 4OVPA 2WYKA 4PFRA 1FBCA 4JVIA 1FBDA 1IMEA 4OANA 4PE3A 2QVUA 3W9VA 3QMFA 4FBPA 5I7IA 4AS4A 2WYPA 4NQ8A 4MX6A 1LBYA 2CEYA 1FPLA 2XWVA 2WX9A 4PFIA 4H45A 2QVVA 1NV5A 4IR8A 4X04A 1NV3A 1LEVA 3PTYA 5T3JA 5ESYA 4JVDA 3MYUA 3T1BA 3EKIA 4NN3A 4I3YA 4N81A 5F24A 4QBAA 1NUZA 3IFCA 4XF5A 2WBDA 1EYIA 1FJ6A 2VT5A 3KC0A 1YYZA 1FPIA 4DI3D 1FBEA 4F1VA 3RPLB 3SZPA 5LTCA 1KA1A 1K9YA 2DE2A 4PGNA 4HCYA 1EYJA 1G0HA 4G61A 5ET7A 4N8GA 4O8MA 4PAFA 5CM6A 4HE0A 2FBPA 4QXDA 4F1UA 4MHFA 2HPGA 3IFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3V A;  1NI9 A;  2Q74 A;  2CZI A;  3LUZ A;  4GWU A;  1IMB A;  1IMD A;  1RDZ A;  2R8T A;  2WEF A;  4GWW A;  2BJI A;  3RYD A;  2CZK A;  5LDZ A;  4HE2 A;  1FTA A;  1NV0 A;  1VDW A;  4GX6 A;  2HHM A;  3D1R A;  2P3N A;  1DK4 A;  3BIG A;  4PTK A;  5ET8 A;  5J16 A;  5IZ3 A;  5EQA A;  1AWB A;  1NV7 A;  2F3B A;  4GWZ A;  1D9Q A;  5EYG A;  1KZ8 A;  3KBZ A;  5ET5 A;  1NV1 A;  1YZ0 A;  5ET6 A;  4GBW A;  2FHY A;  2Y5L A;  1QGX A;  2WBB A;  2QVR A;  3KC1 A;  1NV6 A;  1FPK A;  1Q9D A;  1FPE A;  2DDK A;  1IMC A;  4GX4 A;  4MJO A;  1FBP A;  4GX3 A;  3BIH A;  1FPF A;  1FRP A;  3LV0 A;  2JJK A;  2Y5K A;  3ROJ A;  2F3D A;  1G0I A;  2OX3 A;  1K9Z A;  4KXP A;  3B8B A;  4HXV A;  4GWY A;  5I3S A;  1IMF A;  1FPD A;  1LBZ A;  5EQ7 A;  1FBH A;  5IZ1 A;  4I3E A;  1FJ9 A;  1NV2 A;  2QFL A;  1FBG A;  1FPJ A;  1NV4 A;  4AS5 A;  3A29 A;  4GBV A;  1LBX A;  1JP4 A;  1YXI A;  1CNQ A;  2OWZ A;  5EQ9 A;  1BK4 A;  2GQ1 A;  5EQ8 A;  4GWS A;  1LBV A;  3FBP A;  2Q8M A;  5DW8 A;  1RDX A;  1NUW A;  5EYH A;  1FSA A;  1EYK A;  5FBP A;  4HE1 A;  1DCU A;  2PCR A;  4I40 A;  3T0J A;  2FIE A;  1IMA A;  1FPG A;  5IZ3 B;  1FBF A;  4O7I A;  1KA0 A;  1FPB A;  4GWX A;  5A5L A;  1DBZ A;  3RPL A;  1RDY A;  1NUX A;  1SPI A;  2FIX A;  1INP A;  4H46 A;  1LBW A;  1NUY A;  1XI6 A;  2FVZ A;  2CZH A;  1FBC A;  1FBD A;  1IME A;  2QVU A;  3QMF A;  4FBP A;  4AS4 A;  1LBY A;  1FPL A;  4H45 A;  2QVV A;  1NV5 A;  4IR8 A;  1NV3 A;  1LEV A;  5T3J A;  5ESY A;  4I3Y A;  4N81 A;  5F24 A;  1NUZ A;  3IFC A;  2WBD A;  1EYI A;  1FJ6 A;  2VT5 A;  3KC0 A;  1YYZ A;  1FPI A;  1FBE A;  3RPL B;  1KA1 A;  1K9Y A;  1EYJ A;  1G0H A;  4G61 A;  5ET7 A;  4HE0 A;  2FBP A;  4QXD A;  3IFA A; 
#chains in the Genus database with same CATH topology
 1SQY A;  2OK2 A;  3LUZ A;  1IXG A;  1IIW A;  1LB9 A;  4EF1 A;  4FOR A;  1GGG A;  2F5X A;  3DP6 A;  5J16 A;  4X1B A;  4O94 A;  2XXR A;  2D21 A;  4RY1 A;  4YB5 A;  2XXW A;  2ONK E;  1A55 A;  1KZ8 A;  3GLB A;  4MF3 A;  1A8F A;  4GX3 A;  2ALU A;  3PUV E;  2CZL A;  1DSN A;  2AL5 A;  5I56 A;  2OX3 A;  1B3G A;  4NWC A;  5H8H A;  2ANJ A;  1FQB A;  3S9L C;  5IZ1 A;  1SBP A;  1B7U A;  1MQI A;  4ONY A;  2GH9 A;  5FHO A;  1JP4 A;  2CMO A;  4YB7 A;  3ZSF A;  2YJP A;  4O3C A;  5EYH A;  2HAV A;  2QL3 A;  3N6U A;  4ELQ A;  4NF5 B;  3Q28 A;  1UQW A;  1IMA A;  2V3T A;  2A5S A;  4LQ2 A;  2GRV A;  5AA2 D;  2FIX A;  1GTK A;  2NUV A;  3OD7 A;  1XI6 A;  4IO3 A;  4KCC A;  4FJP A;  1DMB A;  2UYE A;  3FV1 A;  2CEY A;  1FPL A;  3FJ7 A;  4WKM A;  4ND9 A;  2I48 A;  3CSG A;  3OXN A;  3LSL A;  3RLF E;  2RCB A;  3H6V A;  4ZE9 A;  1FPI A;  4G8H A;  5ET7 A;  1OQG A;  4X48 A;  2Q89 A;  3ILU B;  4F1U A;  1A8E A;  3U93 A;  4U4X A;  4PF6 A;  4PF8 A;  1IMD A;  3Q27 A;  3FV2 A;  2BJI A;  4RK2 A;  4G68 A;  5ET8 A;  1VFD A;  4NF6 A;  4TQU Q;  4OFJ A;  1L5T A;  5EYG A;  4QRZ A;  3U1O A;  2I49 A;  1FQC A;  4ZEB A;  3MAM A;  1FCK A;  3C31 A;  3C32 A;  4LA9 A;  4KI0 E;  4LUB A;  4G68 B;  2ZYM A;  3OEL A;  5FTH A;  4FIM A;  1PBP A;  1HSE A;  5TP9 B;  4P11 A;  5EHM A;  3PGF A;  4IO6 A;  3CG1 A;  1FBG A;  2Q8J A;  3MP8 A;  3IB0 A;  3IL1 B;  4PGP A;  4JWY A;  3S9E A;  2GQ1 A;  3FBP A;  1SDX A;  4PFT A;  4KYD A;  5DTB A;  2UYF A;  4P3L A;  3G3G A;  1JEU A;  4N13 A;  3M3K A;  2F6G A;  3R26 A;  3PMX A;  3VVE A;  1AH5 A;  1NUY A;  5I58 A;  4PFR A;  2OPD A;  1FBD A;  2V93 A;  1O64 A;  2WYP A;  4H5F A;  2I3V A;  2QVV A;  4XKQ A;  4X04 A;  1LEV A;  3EPE A;  4XKN A;  2HCA A;  3OO7 A;  2RC7 A;  1FQE A;  3MVW A;  4DI3 D;  1PB9 A;  3SZP A;  2RIN A;  1XC1 A;  2HPG A;  5I59 B;  3IFA A;  4GD5 A;  3TKD A;  5H8F B;  1ZU0 A;  4JXI A;  4XKP A;  3B6W A;  1GVC A;  2F7A A;  1QVS A;  4HW8 A;  4YU0 A;  2F3B A;  3I3V A;  1Y1Z A;  1JW4 A;  4PC9 A;  4LN5 A;  3U94 A;  1NV6 A;  2DDK A;  4MJO A;  1B4Z A;  2Y7K A;  1LST A;  3GBB A;  2H98 A;  5L9S A;  3MP6 A;  1ANF A;  1H43 A;  1O7T A;  1LBZ A;  5EQ7 A;  4BDN A;  3C36 A;  3JV9 A;  4C1T A;  1BKA A;  4ZE8 A;  3K6V A;  4YKK A;  3MVY A;  4KCD A;  2W7Y A;  2XXQ A;  2OWZ A;  4BDL A;  1EU8 A;  3PUY E;  4OEV A;  2OWT A;  2DE4 A;  1WOD A;  4X1D A;  3KJ7 A;  1QUJ A;  1B40 A;  4R9F A;  3K2D A;  5A5L A;  4DXB A;  1H3D A;  3QUJ A;  2B3B A;  3W9W A;  1T0K A;  3USD A;  1FBC A;  1VE4 A;  2QVU A;  5CMB A;  1MY1 A;  4BDQ A;  4YKI A;  3MYU A;  3T22 A;  3TZA A;  2HFB A;  4F1Y A;  3N5L A;  3MUQ A;  3N26 A;  1KA1 A;  1MDP 1;  3RT6 B;  3BKI B;  1Y9U A;  1LAG E;  5KCJ B;  5JEI A;  3RPW A;  3TTR A;  1XOC A;  2HZL A;  1N76 A;  3IB2 A;  3GYY A;  4P1L A;  1OMP A;  1AWB A;  1KWH A;  1SYH A;  4OER A;  5DVJ A;  4DLD A;  3K1N A;  4OVQ A;  5B70 A;  3KG2 A;  1YZ0 A;  3HPI A;  1Z7N E;  5I2K A;  4ECF A;  5AA4 A;  1NNT A;  2HAU A;  1FTL A;  1BP5 A;  4GQO A;  4Q0C A;  1LCF A;  2QS3 A;  5J1D A;  4HXV A;  4ESX A;  4EUO A;  3BFT A;  3O6H A;  4EDP A;  1XVY A;  1EZO A;  3CVG A;  2RC9 A;  4IY6 A;  4OVR A;  5BUU A;  1UTB B;  5DT6 A;  3TQL A;  1MDQ A;  4H67 A;  1YPN A;  3OEK A;  2MKZ A;  5KZT A;  1R9L A;  1LAH E;  2REG A;  2ZNU A;  2FIE A;  1D9V A;  3SEW A;  1DBZ A;  2XX8 A;  2WKY A;  1LBW A;  4NF8 B;  3W9V A;  5H8Q A;  2ZNT A;  4FBP A;  4R74 A;  3QK6 A;  4XIG Q;  3B7D A;  4FAJ A;  3ECR A;  3PTY A;  3CSB A;  5AA4 B;  1QUI A;  3MJN A;  2D3I A;  3OO6 A;  2A5T A;  3K6W A;  5LTC A;  3P7I A;  1IEJ A;  1R9Q A;  3GZG A;  4QFO A;  5CBR A;  3UK4 A;  1CE2 A;  4HE2 A;  1VDW A;  4YKJ A;  1NV7 A;  3IB1 A;  1FQA A;  1SI1 A;  1N04 A;  2UVI A;  4E0X A;  3PMV A;  1M5B A;  3C35 A;  4QSE A;  1N7X A;  4ZEK A;  2DQV A;  4GX4 A;  4PAF A;  3HCQ A;  4OVJ A;  4OZ9 A;  3K6U A;  1URS A;  3TYH A;  1F9B A;  4EXL A;  2UVG A;  3V5A A;  4KXP A;  3PPP A;  2PMS A;  2KR0 A;  3S9M C;  3KBR A;  4RNS A;  2GHA A;  5TPA A;  4FAT A;  4GFR A;  2ZZX A;  1IZ1 A;  4C0R A;  4RPO A;  2GHB A;  3D4G A;  1MXV A;  3OEM A;  2KQZ A;  5TPA B;  4YB6 A;  1JW5 A;  1DTG A;  4DIG A;  2HZK A;  4DCY A;  4RA1 A;  1AMF A;  4QFK A;  1FPB A;  1MQH A;  3UN6 A;  1SPI A;  4P9K A;  3T66 A;  3HHG A;  4OVP A;  3PV0 E;  3QMF A;  3CFZ A;  2QS4 A;  4JSD A;  2XWV A;  4PFI A;  3O6I A;  4H8I A;  5CRY A;  2DWH A;  2GFE A;  2REJ A;  2O1L A;  3OO8 A;  1R6Z A;  3OMB A;  2HXW A;  2YPN A;  4BDO A;  3RPL B;  3S2V A;  3CIJ A;  4G4P A;  2PVU A;  3A3U A;  3UOR A;  2CZI A;  4NF0 A;  5F1Q A;  3CFL A;  5I59 A;  5ICQ A;  1NV0 A;  2THI A;  4HCW A;  3N6T A;  2UVJ A;  4PCD A;  3O2A A;  4NGU A;  4OTE A;  3TDJ A;  5ET6 A;  4XFE A;  3B6Q A;  3EHU A;  4YKP A;  1D4N A;  1FW0 A;  2XWI A;  3TUS A;  4PET A;  1EZ9 A;  2F36 A;  2DS9 A;  2H5Y A;  1MY4 A;  1AIV A;  3O28 A;  4MBP A;  3E79 A;  4MMP A;  3RNN A;  1LB8 A;  1URD A;  1O63 A;  2VD2 A;  1SW5 A;  3U65 A;  1FBH A;  4POW A;  4JB7 A;  3RGY A;  1NV4 A;  4OXV A;  2HXR A;  4U22 A;  2QRY A;  3IOR A;  3UGW A;  3TPA A;  4GWS A;  2X26 A;  4TLM B;  3A09 A;  2Q8M A;  2OLB A;  1B9J A;  2H25 A;  4ELO A;  4JDF A;  2OZZ A;  1FPG A;  1Y4T A;  1MQG A;  1KA0 A;  1JQF A;  4Z0I A;  1IXI A;  1INP A;  1B46 A;  4ZDM A;  3FGS A;  2WYK A;  4PFW A;  1N0T A;  2XD2 A;  3IOU A;  3MC2 A;  3H6U A;  5H8H B;  1LBY A;  5FTI A;  2E0S A;  2WX9 A;  2XHD A;  3OOA A;  5EHS A;  1USY E;  3EKI A;  1US5 A;  4N81 A;  1FJ6 A;  2XD3 A;  4UAC A;  1SI0 A;  2Q88 A;  3QIM A;  4I9D A;  5CM6 A;  1PEB A;  3E9X A;  4O8M A;  1S9T A;  3FXQ A;  2XXY A;  4FE8 A;  1FTO A;  4QFN A;  2R6G E;  1PC3 A;  3MQ9 A;  1B7Z A;  2RC8 A;  3K1P A;  3G3K A;  4PAI A;  3FVK A;  4YIC A;  3RT8 A;  3IAZ A;  1FTM A;  4XTC Q;  1P1W A;  3GXA A;  1OVB A;  2AIX A;  1D9Q A;  1LFI A;  3FIR A;  5CBS A;  4JSO A;  1MH4 A;  3HHF A;  1LCT A;  1GV8 A;  5L9M A;  2VGQ A;  5BWJ A;  1FQD A;  2PX1 A;  4OEN A;  3BIH A;  1Y20 A;  5AA3 A;  2VD3 A;  4ZED A;  2NXO A;  1MY0 A;  3TCH A;  2KLF A;  3IR1 A;  3KEI A;  1Y4C A;  1VR5 A;  1A7L A;  4RYA A;  3TTK A;  2I0C A;  4DCX A;  4PP0 A;  4NTL A;  3ONM A;  4N6D A;  4N4U A;  4OET A;  3IK6 B;  4P0I A;  2F35 A;  4F22 A;  3L6H A;  4NX1 A;  4LAT A;  3C9H A;  3LSF B;  5I57 B;  3MP1 A;  1ZKB A;  1POT A;  1B2H A;  3FXB A;  5I84 A;  3MVX A;  3PUZ E;  1JW1 A;  2O7U A;  2O68 A;  3U8Q A;  4OEU A;  3IOT A;  3RPL A;  4UA8 A;  1NKX A;  1NNP A;  1S7Y A;  3FD3 A;  2R71 A;  2YLN A;  3EHS A;  1EZP A;  5ITO A;  3GBA A;  4F3B A;  4H1X A;  1I6B A;  3H06 B;  4R75 A;  4KYS A;  3TTM A;  4N6P A;  1B7H A;  2DXY A;  1TFA A;  4QXD A;  2O69 A;  3FJG A;  3E78 A;  1SD3 A;  4YMB A;  1IMB A;  3R6U A;  1RDZ A;  3PD9 A;  3SEU A;  1MM6 A;  4N17 A;  3BIG A;  4PTK A;  3M3F A;  1JNF A;  3H4Z A;  4GWO A;  5CMK A;  4XKR A;  4DDD A;  4R6K A;  1B1H A;  2ABH A;  2Y5L A;  3KC1 A;  1Q9D A;  1GR2 A;  3E4R A;  5HPQ A;  1MPD A;  2H4I A;  1NFT A;  4MLV A;  2V3Q A;  4NMY A;  3SDF A;  4WXJ A;  1P99 A;  3VLV A;  2LAO A;  4POX A;  2XXK A;  4GWY A;  5I3S A;  2VHA A;  3EF7 A;  1AOV A;  3PU5 A;  1NV2 A;  2B65 A;  3IO4 A;  2ZZW A;  1MXZ A;  3PMW A;  5FHM A;  4PBH A;  2DP8 A;  4H0W A;  1MXU A;  1B5I A;  4I40 A;  3EQ1 A;  2FA7 A;  4PFU A;  3ILT B;  4OA4 A;  3IJO B;  1PB8 A;  2X7P A;  4GL0 A;  5I2N A;  4AB5 A;  4NF6 B;  3VLU A;  3KFM A;  2ONR A;  1M5C A;  1QUK A;  4WED A;  3T1B A;  3S9N C;  2DWJ A;  1S50 A;  1N7W A;  1K9Y A;  5A5X A;  1M5D A;  4ZEF A;  3AXF A;  5HBC A;  1M5E A;  4PQJ A;  3KOT A;  2DWA A;  5JK4 A;  1LFH A;  2Z8F A;  1FTA A;  2V84 A;  2B3F A;  4LP2 B;  4P47 A;  4PE5 B;  5IZ3 A;  3DP8 A;  4LZ7 A;  1US4 A;  2ZYO A;  2Z8D A;  2Y84 A;  2NWJ A;  4GBW A;  4IO4 A;  4H5G A;  1Y3P A;  3L6G A;  1FPE A;  4MNP A;  3O9P A;  4QSC A;  1DPE A;  4R73 A;  3LV0 A;  5DYH A;  1I69 A;  3T9U A;  3VV5 A;  1MG1 A;  4KR5 A;  4N15 A;  5ITP A;  3O66 A;  2BJJ X;  3S4U A;  3PPR A;  2R9J A;  1FJ9 A;  4Q8R A;  2XX7 A;  4DXC A;  1WDN A;  2AL4 A;  1NNK A;  4ELP A;  3FXR A;  5IAI A;  5ISU A;  1A54 A;  1Y1M A;  1B05 A;  3OEN A;  5B7D A;  5I56 B;  1XT8 A;  1UTH A;  4QFL A;  2O84 X;  1FSA A;  1EYK A;  1RYX A;  1H44 A;  3KJT A;  3ISP A;  4MEV A;  4F19 A;  4QSD A;  3H3G A;  3SEX A;  3OO9 A;  3QSL A;  4GWX A;  5HM4 B;  3K00 A;  1NUX A;  4U21 A;  4F3G A;  2FVZ A;  4F2Q A;  4OAN A;  1ZBM A;  3LBS A;  3ODB A;  4MX6 A;  1B3L A;  4OQO A;  1NV3 A;  4JVD A;  2DYX A;  2Z22 A;  5ESY A;  3EHT A;  5F24 A;  2VT5 A;  5ICT A;  3KSJ A;  3KN3 A;  4R72 A;  4YMA A;  2O7I A;  5A5X B;  2NVU B;  4NF4 A;  4QFP A;  2R8T A;  3OSR A;  4GWW A;  2CZK A;  1DK4 A;  2RKM A;  1II5 A;  4LQ5 A;  2G93 A;  1TXF A;  3VXB A;  3FJM A;  1RYO A;  2XXT A;  3R7X A;  1CB6 A;  1I6Q A;  3VVD A;  1LFG A;  1OIB A;  1ELJ A;  2QVR A;  2ESN A;  5M2V A;  4OHN A;  5IZZ A;  1B3F A;  1B5J A;  3C34 A;  2F7C A;  3FVO A;  2I6E A;  4IGT A;  2I58 A;  3TTL A;  1OLC A;  3QYT A;  3PUW E;  3FVN A;  4U2R A;  5I2K B;  1TFD A;  5F7V A;  2ZYK A;  3T96 B;  4U23 A;  1POY 1;  4KYE A;  2Q2A A;  1BK4 A;  3FAT A;  4EQB A;  4MNI A;  4P1E A;  3MPK A;  3MZ1 A;  5JTY B;  4Q30 B;  1URG A;  4BDM A;  2RF1 A;  1WVJ A;  3VLW A;  1JVX A;  2F34 A;  1ZJL A;  2ZXT A;  5AA2 A;  1B1X A;  4AS4 A;  3FUZ A;  5L8D A;  4IR8 A;  2IA4 A;  5AA2 B;  2VP1 A;  1BLF A;  3IFC A;  4XF5 A;  2HEU A;  1XS5 A;  4GVO A;  4X8R A;  3K4U A;  2XXU A;  4GOT A;  3T9H B;  4BDR A;  3TEL A;  2Q74 A;  4M1V A;  2PT2 A;  4PAK A;  3SET A;  2UXA A;  3H6T A;  1R1N A;  4LVQ A;  4ISU A;  4U1O A;  4GX6 A;  2OJT A;  4IO7 A;  2F7B A;  4I62 A;  3UP9 A;  3PD8 A;  4GXA A;  3I6V A;  4K3F A;  1HSJ A;  3QUF A;  5DVF A;  5ET5 A;  1EH3 A;  1B4H A;  2I0B A;  4PDD A;  3T93 B;  4O7M A;  1B6H A;  4G8N A;  4MNC A;  5I58 B;  4RXL A;  3LC8 A;  4LZ5 A;  4QF9 A;  3K1M A;  4AQ4 A;  3SER A;  2Y7I A;  3K02 A;  4OFL A;  3KOS A;  4P56 A;  1UIU A;  4TOZ A;  1JET A;  3TTN A;  3K0V A;  1OLA A;  5IM2 A;  1VSO A;  4F39 A;  1SW2 A;  2B4L A;  4I1D A;  2FNC A;  3TAJ A;  3FXU A;  1RDX A;  2HQ0 A;  1IQ7 A;  2Z8E A;  4C1U A;  1USY H;  4QHQ A;  1LBB A;  2XX9 A;  4YZZ A;  1ZMG A;  3EN3 A;  1IME A;  2DWI A;  3CFX A;  2AYS A;  3IX1 A;  4KPT A;  1YCJ A;  1NH8 A;  1P1N A;  4QBA A;  2QS1 A;  3QAX A;  4IO5 A;  1EYI A;  3U92 A;  4GLI A;  1DPP A;  1FBE A;  4PGN A;  1MQJ A;  4N8G A;  4R2F A;  4MHF A;  2ZNS A;  4ESW A;  1QW0 A;  3HFU A;  5CI5 A;  1MH3 A;  3H03 A;  5JTY A;  3D1R A;  4LZ8 A;  3HN0 A;  1UTH B;  2I4C A;  4PFY A;  2DSF A;  1YTV A;  3ZS6 A;  3PPQ A;  2OWS A;  5I5P A;  4XXU A;  1QGX A;  4IGR A;  4MIJ A;  3SES A;  3JZJ A;  3RN8 A;  3G3I A;  3O6G A;  5CMC A;  2F97 A;  1FRP A;  3F11 A;  2D5W A;  3QXM A;  3TMG A;  3MST A;  4AB6 A;  4RJZ A;  1P1U A;  3I5O A;  1K9Z A;  5IKB A;  3VE1 B;  1FPD A;  1Y3Q A;  4MLQ A;  1IUD A;  4Q5T A;  3BFU A;  3LSW A;  1B5H A;  3TQW A;  2L5V A;  4GIZ A;  4MCO A;  4F3S A;  1M5F A;  4PDH A;  4ZZA A;  4G8M A;  3JYR A;  1MXX A;  3E13 X;  3O29 A;  4DE8 A;  2DVZ A;  3Q26 A;  1SVX B;  3H6W A;  1P1O A;  3RY3 A;  2QMW A;  4N91 A;  1QJM A;  2ZMB A;  4JVI A;  2QSX A;  3IOV A;  4NWD A;  3VVF A;  5I7I A;  4GRK A;  4GF8 A;  3IJX B;  2F78 A;  3N94 A;  3THI A;  4NN3 A;  4I3Y A;  2DVC A;  3KZG A;  1SYI A;  4Z7E A;  1YYZ A;  4F1V A;  4IY5 A;  4G2Z A;  1EYJ A;  1G0H A;  1B0L A;  4HE0 A;  5H8S A;  2FBP A;  2DOJ A;  1VFE A;  1NI9 A;  3LR1 A;  3HV1 A;  5KDT A;  5FHN A;  1YAE A;  3RYD A;  2I3W A;  1XHY A;  2B4M A;  5H8N B;  2PFY A;  2P0S A;  2O6A A;  2Y7P A;  4ELR A;  2VOZ A;  4KD5 A;  2Y7R A;  4O3B A;  2VPO A;  2XXV A;  1NV1 A;  3KN8 A;  1Q35 A;  4I8C A;  4THI A;  1PDA A;  1MY2 A;  1BIY A;  3VFJ A;  3RTF B;  3K01 A;  1FBP A;  2ONS A;  2F6P A;  5I57 A;  3WAF A;  4EQ7 A;  4UAB A;  1QKB A;  1NMU A;  4P8B A;  4FED A;  4IO2 A;  1OQH A;  4GL8 A;  3PPO A;  2OPE A;  3MVZ A;  4H8J A;  4OYV A;  5DEX A;  1LBX A;  2H9B A;  3ZKL A;  1LAX A;  5AE4 A;  4RPN A;  5EQ8 A;  1LBV A;  1XVX A;  4G68 C;  5DW8 A;  1QKA A;  2E1S A;  3M3L A;  4M4G A;  3DM0 A;  4IB2 A;  3MBP A;  5KDT B;  4OMB A;  3T0J A;  5IZ3 B;  4N6K A;  4ZEC A;  2IEE A;  1FTK A;  3B6T A;  1NL5 A;  1LAF E;  1B51 A;  2CZH A;  2XXH A;  4GXS B;  3MZ9 A;  1MS7 A;  4FEB A;  4OWD A;  4NQ8 A;  3WAE A;  1UIV A;  4H45 A;  1B52 A;  1HSL A;  4FEC A;  3TFL A;  5CC2 A;  2PT1 A;  4KHZ E;  1IXC A;  1RKM A;  2XXX A;  3RQT A;  1OVT A;  2DE3 A;  5ELV A;  2P3V A;  1TWY A;  4MFI A;  2QJE A;  4JWX A;  2WEF A;  4OVT A;  1DOT A;  4NF8 A;  2HHM A;  3D4C A;  4E0W A;  3DLN A;  4GWZ A;  2M8C A;  3V8X B;  4P0G A;  4F18 A;  3SEV A;  3LUY A;  3KBZ A;  3MW0 A;  1ZIU A;  1MPC A;  1FPK A;  1IMC A;  2VPN A;  3FAS A;  1LGB C;  4MAG A;  2JJK A;  2FYI A;  2Y5K A;  2X7Q A;  4H65 A;  2RCA A;  1D3K A;  3CHG A;  3TOD A;  2V4C A;  3C4M A;  5H8F A;  4X9T A;  4EF2 A;  5H8Q B;  3CR9 A;  3CG3 A;  5EQ9 A;  1LLS A;  4JWO A;  4NAP A;  4NF4 B;  4NG7 A;  3K6X A;  4XEQ A;  3KN7 A;  2NOO A;  3G3F A;  3HO7 A;  4U4S A;  3Q25 A;  1DCU A;  2PCR A;  3H7M A;  3UA8 A;  4R6Y A;  4R9G A;  4HS7 A;  3FZV A;  4F3P A;  1RDY A;  2PFZ A;  2PBW A;  1B3H A;  3IOW A;  1UTB A;  3TEP A;  5EYF A;  4DZ1 A;  1NV5 A;  1Z7M E;  1ATG A;  2V3U A;  3IO6 A;  3KGC A;  4HCY A;  3RTW B;  5DEX B;  1I6A A;  4DXU A;  4EQ9 A;  3KSX A;  3W15 C;  3TCG A;  1A40 A;  3V83 A;  5I2N B;  1AL3 A;  1N3W A;  4HTG A;  3MWB A;  1BTJ A;  5EQA A;  1N84 A;  4NHB A;  1LBC A;  4OVS A;  4N8Y A;  2A5T B;  2FHY A;  4O3A A;  3G3H A;  4DI4 B;  2WBB A;  4BLA A;  1B3E A;  3FVG A;  1IIT A;  4F31 B;  4RK9 A;  3TCF A;  1A99 A;  2F3D A;  1G0I A;  5TP9 A;  1TT1 A;  3B8B A;  5KCJ A;  3RUM A;  4LON B;  3ZKK A;  4F2O A;  4I3E A;  1N3X A;  2QPQ A;  3NOH A;  5IGA A;  2O51 A;  4AS5 A;  2UVH A;  4G77 A;  2CEX A;  3CI8 A;  5TU0 A;  4U1Z A;  1SW1 A;  4EXK A;  4F29 A;  3V89 B;  1NUW A;  3E3K A;  2Q9T A;  1B0H A;  1B58 A;  3OSQ A;  4HE1 A;  4PFB A;  3A3C A;  1MPB A;  4O7I A;  2XXI A;  2P1S A;  1PBQ A;  1MM7 A;  2H99 A;  4H46 A;  2XA5 A;  3DP4 A;  3VDF A;  2ZYN A;  1JEV A;  4NED A;  4PE3 A;  2QMX A;  3BBR A;  3UIF A;  4NF5 A;  3T9X B;  2WBD A;  1Q1K A;  4MH5 A;  3KC0 A;  1MRP A;  5DVI A;  1Y3N A;  3VXC A;  4GWU A;  2I4B A;  4ZZE A;  1MXW A;  1B32 A;  5LDZ A;  1SW4 A;  2P3N A;  3Q29 A;  2DXR A;  4ZS9 A;  3MZB A;  4KFQ A;  3LSX A;  3SKP A;  1D9Y A;  5K2Y A;  1H76 A;  3B50 A;  2XXP A;  4JVC A;  4TLL B;  4ZEI A;  3PUX E;  1IXH A;  1FPF A;  1MXY A;  1FQF A;  5K2X A;  1MQD A;  2OBG A;  2P2A A;  4R2B A;  3ROJ A;  1DTZ A;  2QS2 A;  3SEY A;  2O1M A;  4L17 A;  3M8U A;  1FTJ A;  2Y7W A;  3CRB A;  1ZLQ A;  2XWK A;  1H45 A;  1QUL A;  1IMF A;  3G7W A;  3O97 A;  4OFO A;  1NH7 A;  3PPN A;  4JBZ A;  2QFL A;  2Q2C A;  1FPJ A;  1ZTY A;  4N07 A;  3A29 A;  4OES A;  4GBV A;  2OCU A;  2XWO A;  1YXI A;  2F8D A;  1CNQ A;  4H6D A;  3HST A;  4WEP A;  5L9O A;  2ZZV A;  1P1Q A;  4R6H A;  5FBP A;  4YAH X;  5LOM A;  3C33 A;  2G29 A;  4PBQ A;  1FBF A;  5CMM A;  1PB7 A;  3G3J A;  4KQP A;  3MPL A;  3U72 A;  3T9V A;  1J1N A;  1MY3 A;  5T3J A;  3DEL B;  1NNF A;  1NUZ A;  1JVY A;  2PYY A;  5H8N A;  2DE2 A;  4G61 A;  2Z23 A;  5AA1 A;  4NE4 A;  2V25 A; 
#chains in the Genus database with same CATH homology
 2DE3 A;  2P3V A;  1NI9 A;  2Q74 A;  4M1V A;  2CZI A;  3LUZ A;  4NF0 A;  3HFU A;  4GWU A;  4PF6 A;  5JK4 A;  1IMB A;  4PF8 A;  1IMD A;  4PAK A;  1RDZ A;  2R8T A;  2WEF A;  4GWW A;  4OVT A;  2BJI A;  3RYD A;  2F5X A;  2CZK A;  5LDZ A;  2HZL A;  4HE2 A;  1FTA A;  1NV0 A;  1VDW A;  4GX6 A;  4HCW A;  2HHM A;  3D1R A;  2P3N A;  1DK4 A;  3BIG A;  4PTK A;  5ET8 A;  5J16 A;  2B4M A;  3GYY A;  2PFY A;  4P47 A;  4PAI A;  5IZ3 A;  4P1L A;  5EQA A;  4O94 A;  4YIC A;  1AWB A;  1NV7 A;  2F3B A;  4PCD A;  4GWZ A;  4NGU A;  4F18 A;  5I5P A;  4OVQ A;  4NHB A;  1D9Q A;  5EYG A;  2VPO A;  3B50 A;  1KZ8 A;  3KBZ A;  5ET5 A;  1NV1 A;  4OVS A;  3E78 A;  1YZ0 A;  5ET6 A;  4N8Y A;  4PC9 A;  4XFE A;  4GBW A;  2FHY A;  4LN5 A;  4PDD A;  2Y5L A;  1QGX A;  4O7M A;  4JVC A;  4MIJ A;  2WBB A;  4DI4 B;  2QVR A;  3KC1 A;  1NV6 A;  1FPK A;  1Q9D A;  1FPE A;  2DDK A;  1IMC A;  4GX4 A;  4MJO A;  4MNC A;  1FBP A;  4GX3 A;  2VPN A;  2XWI A;  4MNP A;  4PET A;  3BIH A;  5IZZ A;  1FPF A;  1FRP A;  3LV0 A;  2V3Q A;  4MAG A;  2JJK A;  3MST A;  2Y5K A;  4UAB A;  3ROJ A;  2F3D A;  1G0I A;  2OX3 A;  3E79 A;  4N15 A;  3CHG A;  4MMP A;  1K9Z A;  4P8B A;  2V4C A;  4KXP A;  2XWK A;  3B8B A;  2XXK A;  5J1D A;  4HXV A;  2KR0 A;  4GWY A;  5I3S A;  1IMF A;  1FPD A;  1LBZ A;  3U65 A;  5EQ7 A;  1FBH A;  5IZ1 A;  2ZZX A;  4I3E A;  1FJ9 A;  1NV2 A;  2QFL A;  1FBG A;  1FPJ A;  2QPQ A;  3NOH A;  5IGA A;  1NV4 A;  4P56 A;  4AS5 A;  4X9T A;  3A29 A;  2HXR A;  4N6D A;  4N4U A;  2ZZW A;  4OVR A;  4GBV A;  2CEX A;  5IM2 A;  4YZZ A;  1LBX A;  1JP4 A;  2KQZ A;  1YXI A;  2B4L A;  2XWO A;  2L5V A;  4PGP A;  1CNQ A;  2OWZ A;  5EQ9 A;  4MCO A;  4NX1 A;  4PDH A;  4X8R A;  1BK4 A;  2GQ1 A;  5EQ8 A;  4GWS A;  4NAP A;  1LBV A;  3FBP A;  2Q8M A;  2ZZV A;  5DW8 A;  1RDX A;  4NG7 A;  4MNI A;  1NUW A;  4XEQ A;  4P1E A;  5EYH A;  2MKZ A;  4PBH A;  2Q9T A;  3FXB A;  1FSA A;  4P3L A;  2DE4 A;  1EYK A;  5FBP A;  2HZK A;  4HE1 A;  1DCU A;  2PCR A;  4I40 A;  3T0J A;  3ISP A;  4PBQ A;  2FIE A;  4MEV A;  4PFB A;  2DVZ A;  1IMA A;  1FPG A;  5IZ3 B;  4F19 A;  1FBF A;  4O7I A;  4N17 A;  1KA0 A;  1FPB A;  4N6K A;  4GWX A;  5A5L A;  1DBZ A;  3RPL A;  1RDY A;  1NUX A;  1SPI A;  2FIX A;  2PFZ A;  4P9K A;  3W9W A;  1INP A;  4H46 A;  1LBW A;  2XA5 A;  1NUY A;  1XI6 A;  2FVZ A;  2CZH A;  4N91 A;  4OA4 A;  4OVP A;  2WYK A;  4PFR A;  1FBC A;  4JVI A;  1FBD A;  1IME A;  4OAN A;  4PE3 A;  2QVU A;  3W9V A;  3QMF A;  4FBP A;  5I7I A;  4AS4 A;  2WYP A;  4NQ8 A;  4MX6 A;  1LBY A;  2CEY A;  1FPL A;  2XWV A;  2WX9 A;  4PFI A;  4H45 A;  2QVV A;  1NV5 A;  4IR8 A;  4X04 A;  1NV3 A;  1LEV A;  3PTY A;  5T3J A;  5ESY A;  4JVD A;  3MYU A;  3T1B A;  3EKI A;  4NN3 A;  4I3Y A;  4N81 A;  5F24 A;  4QBA A;  1NUZ A;  3IFC A;  4XF5 A;  2WBD A;  1EYI A;  1FJ6 A;  2VT5 A;  3KC0 A;  1YYZ A;  1FPI A;  4DI3 D;  1FBE A;  4F1V A;  3RPL B;  3SZP A;  5LTC A;  1KA1 A;  1K9Y A;  2DE2 A;  4PGN A;  4HCY A;  1EYJ A;  1G0H A;  4G61 A;  5ET7 A;  4N8G A;  4O8M A;  4PAF A;  5CM6 A;  4HE0 A;  2FBP A;  4QXD A;  4F1U A;  4MHF A;  2HPG A;  3IFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...