5ET8A

Human muscle fructose-1,6-bisphosphatase in active r-state in complex with fructose-6-phosphate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
287
Chain Sequence
DMLTLTRYVMGELTQLLNSMLTAIKAISSAVRKAVKKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGASIGTIFAIYRKPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title T-to-R switch of muscle FBPase involves extreme changes of secondary and quaternary structure
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 88
structure length 287
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2015-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5et8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5et8A02
2OX3A 4HE1A 2WBDA 2R8TA 1FBHA 3D1RA 2PCRA 5IZ3A 2QVUA 3FBPA 2FHYA 1FPJA 1IMAA 1LBWA 3ROJA 4H46A 1K9YA 2Y5LA 1FPFA 1NV2A 1FPLA 3IFCA 4HE2A 5I3SA 4I40A 1IMCA 4O7IA 2FIXA 2F3BA 1DCUA 1LBZA 1NV4A 2CZIA 4G61A 1FBDA 2DDKA 2Y5KA 2BJIA 2HHMA 5EYGA 1XI6A 5A5LA 1DBZA 2CZHA 1FRPA 2OWZA 4GX3A 1FPDA 1YZ0A 1FTAA 4H45A 1CNQA 2FVZA 1FBGA 4AS4A 1NI9A 1KA1A 1DK4A 3KBZA 4I3EA 1D9QA 1FPGA 1FPKA 4GWZA 1RDXA 1FPEA 5EQAA 1JP4A 2QFLA 1NUYA 1RDZA 1VDWA 1FPBA 5T3JA 3BIHA 5EYHA 3RPLA 4GWUA 5LDZA 5ET8A 4KXPA 1EYJA 4HXVA 2QVRA 1K9ZA 1LBXA 1FBFA 1KA0A 1QGXA 2Q74A 3A29A 4HE0A 4GX4A 5ET5A 5IZ3B 1FSAA 4GBWA 1FJ6A 4QXDA 3KC0A 2QVVA 4GWSA 3BIGA 1G0HA 1NV6A 1AWBA 3RPLB 5F24A 5IZ1A 1Q9DA 3LUZA 1NUXA 2WEFA 4GWWA 1IMEA 2JJKA 1KZ8A 1IMBA 2P3NA 5EQ7A 1G0IA 2FIEA 2FBPA 2P3VA 4GX6A 5DW8A 1FBEA 4AS5A 1LBYA 1RDYA 1NV1A 3LV0A 2Q8MA 1IMFA 4GWYA 5ET7A 4N81A 1NUWA 3KC1A 2CZKA 5J16A 1NV5A 1FPIA 1NV0A 1YYZA 2GQ1A 1BK4A 3T0JA 1INPA 1YXIA 4GBVA 4GWXA 1FJ9A 1NUZA 3RYDA 2WBBA 4IR8A 5ET6A 4FBPA 3B8BA 2VT5A 1NV3A 3IFAA 1SPIA 5EQ9A 1FBCA 1FBPA 1EYKA 3QMFA 5FBPA 5ESYA 4I3YA 4MJOA 1LEVA 4PTKA 1IMDA 5EQ8A 1EYIA 1NV7A 2F3DA 1LBVA
chains in the Genus database with same CATH superfamily
3TYHA 4F22A 3PMWA 3PPQA 2R8TA 3PPOA 4Q5TA 3K1PA 4PGNA 1YAEA 3O2AA 4BDRA 1OLAA 3T9VA 1B9JA 3UGWA 3FUZA 3IAZA 2F3BA 1DCUA 3E4RA 1FQCA 4ZEIA 2F7BA 3Q29A 2HHMA 5A5LA 1B2HA 1EU8A 3H7MA 3C36A 3C4MA 5LTCA 1JW1A 3TKDA 4P1EA 3P7IA 2QPQA 3OXNA 4KYEA 2PVUA 3IB1A 1B5HA 4MAGA 1FQFA 3RQTA 4JVIA 5A5XB 2VOZA 1YPNA 4YMAA 3R6UA 4GX4A 4QBAA 2D21A 2X7PA 1MY3A 3SEUA 1FTLA 4OVTA 5AA2B 1ZJLA 2DE4A 3SETA 3Q25A 2WEFA 1A99A 2WKYA 4F18A 2F7AA 4H8JA 1USYE 1MQHA 4GWOA 4PBHA 1TFAA 3CFZA 3FD3A 4OERA 2OPEA 2D3IA 2XX8A 2Q8MA 4N81A 2QL3A 2O51A 4R6YA 4G8NA 4XTCQ 1FJ9A 2A5TB 1B46A 1B5JA 3T96B 1JQFA 4BDQA 4IO5A 1SI1A 4NTLA 5F1QA 5KCJB 2O84X 2I4BA 5TP9B 3HSTA 3M3FA 3KEIA 2XXPA 3G7WA 2XWOA 1US5A 4XFEA 4X48A 2XXTA 3O6GA 4KD5A 3DP8A 3CI8A 1FTOA 4H5GA 1NI9A 4IO6A 2HAVA 2QS2A 1T0KA 1LB8A 2XWKA 1R9QA 4HS7A 1DPEA 4XKRA 4GWUA 1N7WA 1N7XA 5H8FA 4N6PA 4ONYA 5EHSA 5IZ3B 3T9HB 2XXHA 4KCCA 5L9OA 3OENA 2HPGA 4C1TA 3OOAA 4NF6B 5ICTA 1FTMA 1VE4A 4WXJA 2B3BA 1SI0A 4C0RA 2QS4A 4OFJA 2VGQA 2P0SA 4BDNA 2HXWA 5J16A 1NV0A 2WYPA 4FECA 1OIBA 1NUZA 4ZEKA 2FNCA 3WAEA 1N84A 1IEJA 3QK6A 4PETA 3CR9A 1P1OA 4P3LA 5DVFA 2QMXA 3QUFA 2ZXTA 2OX3A 3UORA 1NNFA 2MKZA 4EF2A 3EQ1A 2FHYA 2F6PA 4IO3A 4GXSB 4GD5A 4BDLA 3IFCA 2I4CA 5I56A 4HCWA 2F36A 1LBZA 4YKKA 4F2OA 2QS3A 4NN3A 1H76A 3GZGA 2W7YA 4PCDA 4K3FA 3USDA 2B65A 4H45A 4AS4A 5H8HB 3MWBA 4PFRA 3GBBA 2Q2CA 3N94A 4QFLA 1VR5A 4ELOA 1UQWA 3MSTA 2Q89A 1LBXA 2REGA 1B51A 4MEVA 4OZ9A 1FJ6A 5FHOA 4LZ7A 3IX1A 5F7VA 4MNPA 1Y20A 4R2FA 4ND9A 4R72A 3QIMA 3I3VA 3K6UA 4JWXA 2XWVA 4QFNA 3VVDA 3KN3A 4YZZA 3IB0A 3U94A 3PPNA 1SW2A 3ILTB 2PFYA 4F1UA 1A7LA 1PEBA 3HCQA 1P1UA 1HSEA 1XVXA 3O28A 1SDXA 1I6BA 1US4A 3ZKKA 4IR8A 1IXIA 1NH8A 3EKIA 1SPIA 5EQ9A 4ZECA 4EF1A 5BWJA 4MF3A 4KYSA 3CFLA 4NF8B 4H5FA 1JVYA 1S9TA 3DP6A 1B3LA 1MY4A 2OCUA 4G2ZA 4I8CA 5AA2A 3KGCA 2CMOA 1LCTA 2FIXA 2RF1A 3TDJA 3MZBA 2Y5KA 1L5TA 2QRYA 4MNIA 1FQEA 1SW1A 4MX6A 3MZ9A 2RCAA 3LSLA 3E78A 3AXFA 1P99A 4PFYA 1LSTA 1D9VA 1CB6A 4QFKA 2ABHA 4OVSA 1PC3A 5HM4B 3K6XA 3MAMA 1B3FA 4OWDA 3SZPA 4N15A 2A5TA 1O64A 4ELQA 4FIMA 4R73A 1B4HA 2Y7WA 3A29A 4GBWA 2UYEA 5DTBA 1IZ1A 5KCJA 1ZU0A 4TQUQ 4OESA 1TFDA 4YB6A 2NWJA 4XXUA 2XX7A 2H5YA 1LAHE 4P0IA 3KOTA 5CMBA 2ZNUA 3ZKLA 5IKBA 1SBPA 3TQWA 4IO4A 4X1BA 2V84A 2XD3A 4JSDA 3ILUB 1DOTA 4I1DA 1MXWA 3O6IA 3KG2A 4N8GA 4PAKA 3O9PA 4PTKA 2RINA 3TUSA 3N6TA 3THIA 3M8UA 5EQ8A 1LAXA 2V3UA 3OO6A 1LBWA 2ONRA 3VLVA 2B4MA 3VVFA 5IZ3A 3FVOA 2NXOA 3R7XA 3T93B 4LZ5A 3S9EA 2XXIA 2DXYA 3ONMA 3EHSA 3UK4A 2OBGA 1IUDA 1NV2A 4DCYA 1B1HA 4NF6A 3SKPA 1LFIA 2RKMA 3RT6B 1UTHB 3I5OA 4KR5A 3WAFA 4GL8A 2ESNA 3RN8A 2BJIA 3CSBA 3CSGA 1FRPA 2IEEA 1D9YA 4H67A 3F11A 4R6KA 3GBAA 2DE2A 5ISUA 1D4NA 5DT6A 1H44A 5CM6A 4WEPA 1KA0A 1MQDA 4ELPA 1A40A 1URDA 1MXXA 1B4ZA 4IY5A 4EQBA 2QJEA 3BIGA 1G0HA 1AWBA 1MXVA 2XXUA 1QUIA 3HHFA 2F7CA 3V89B 4PE3A 2F5XA 4X1DA 2FIEA 1B3HA 1S7YA 3PGFA 4NF4B 1UIUA 5H8NB 2P1SA 4RA1A 4AQ4A 4OXVA 3FVNA 4LUBA 5FTIA 1YXIA 3SERA 2DP8A 1QKBA 3K6VA 4DIGA 5H8HA 1PB8A 1URSA 2H99A 4NAPA 5CBSA 4XKPA 1VFEA 1NMUA 3V8XB 4LZ8A 1I69A 5I5PA 1XHYA 4JWYA 5DYHA 1J1NA 4G8HA 2GFEA 3VXCA 3H6UA 4OVPA 4X9TA 4DZ1A 4RY1A 3CRBA 1IMCA 4YICA 1RYOA 5ITOA 4TLLB 1MY0A 3ODBA 4G68A 4E0WA 4EQ9A 3FVGA 5EYGA 4O3BA 4N13A 2I58A 3IOVA 3OO9A 1O63A 1FPDA 4OYVA 1FTAA 4XKNA 3FZVA 4RJZA 2DE3A 3JZJA 2RC8A 1MM6A 1R9LA 3FJ7A 3W15C 1HSJA 4NF5B 3TTNA 2XD2A 4U1ZA 3C33A 2DWHA 2BJJX 2LAOA 4MH5A 4EDPA 5ET5A 2AIXA 4FJPA 5TPAA 5K2XA 5L9MA 3A09A 5LOMA 3PD9A 2HFBA 4RYAA 2XX9A 3CVGA 2RC9A 1IMEA 2JJKA 5HBCA 2OPDA 2UVGA 4R2BA 3KOSA 2P3VA 1MY2A 4AS5A 2ONKE 4IO7A 3Q26A 3HFUA 3QUJA 2CZKA 4QRZA 4PAIA 1QUKA 1SW5A 1QULA 3HN0A 4BDMA 3KN8A 3G3FA 2E1SA 3DP4A 3Q27A 4OQOA 3IJXB 4I3YA 2QSXA 2V4CA 3PPRA 4LATA 3TFLA 1Q35A 1IQ7A 3PUYE 2R71A 3ECRA 1IMAA 3H03A 1FTJA 4JWOA 5AA4B 3FIRA 3OD7A 4U1OA 1P1NA 2DWAA 3H4ZA 2L5VA 4NWDA 2I48A 2F8DA 5JTYA 3FASA 4Q8RA 3MYUA 3KBZA 1SVXB 2DVZA 3U8QA 4ZZEA 1FPBA 2ZZXA 4RPOA 2WYKA 4ELRA 5LDZA 4YU0A 3FV1A 3O29A 3S9LC 1MDQA 3K02A 3G3IA 1USYH 3OO7A 5H8SA 2ZYKA 1GTKA 3R26A 2F97A 3RPLB 1ZLQA 3W9WA 3LUZA 2XXXA 4ECFA 5I58B 1KWHA 2FBPA 3IL1B 4OANA 1P1WA 1OVBA 4PGPA 3LR1A 2FA7A 1UTHA 5IGAA 2NVUB 3TCGA 4OTEA 2O7UA 3SDFA 1CE2A 4C1UA 4FBPA 2Z8EA 2Q9TA 1I6AA 4RK9A 3MBPA 1Y1ZA 5CMKA 4XEQA 4KQPA 3IO6A 1WVJA 3V83A 3OEMA 4L17A 2PCRA 1M5EA 2NUVA 3O97A 2O68A 4LVQA 1H43A 4DXCA 4PFTA 1NL5A 3U93A 1MXUA 4KHZE 2VD3A 4H8IA 4ZS9A 4ESXA 2H4IA 3PMVA 5IAIA 1B3GA 1MQIA 3L6HA 3K01A 1XT8A 2OWZA 4NF4A 2CEYA 1NNKA 1FPGA 5H8NA 4GWZA 1MQGA 3BFTA 3M3KA 4QFPA 1Y1MA 3HV1A 4JVDA 4JB7A 2REJA 5AA2D 4R6HA 2FYIA 3B50A 3MVWA 4U22A 2QS1A 1IIWA 2UVJA 3N5LA 1EYJA 1B7HA 1EZOA 1FSAA 3OO8A 4DXBA 5I59A 5H8QB 2QVVA 3C9HA 3EPEA 2I3VA 5HPQA 4YKPA 3DM0A 3B7DA 2I6EA 2ZNSA 3OSRA 2HEUA 3K4UA 1Y3PA 2Z23A 1NV1A 3N6UA 5ELVA 2Q88A 1BLFA 4PQJA 3BFUA 1FPIA 3TTRA 4F19A 3GXAA 3H06B 3T0JA 3G3HA 2OLBA 4PFBA 3G3GA 3VVEA 3H6TA 3ZSFA 1TXFA 1NH7A 3QMFA 3SEWA 2Y7RA 5FBPA 1GR2A 1MRPA 4FEDA 4DE8A 1Z7ME 3FJMA 1LBBA 4GX6A 1QW0A 1LBVA 2O1LA 2F3DA 2OWSA 4M4GA 3RPWA 2WBDA 1Y3NA 1D3KA 1M5FA 4KFQA 3PUZE 4LQ2A 5EYFA 4PE5B 2GHAA 4PP0A 1B6HA 4TLMB 5I3SA 4O7IA 1JEUA 4M1VA 4OVRA 5J1DA 2UYFA 1PB7A 4EXLA 3A3UA 3S9NC 1FTKA 5A5XA 4GX3A 1ELJA 1AOVA 4R9GA 3MPKA 4P56A 1VDWA 4MNCA 3BIHA 4OFLA 4E0XA 2UXAA 2ZZVA 1FQBA 1MDP1 4O3CA 2XHDA 4JXIA 3VDFA 3MVZA 4QFOA 1OQHA 2CEXA 4OA4A 4GWWA 1N3WA 2O1MA 3K1NA 3K6WA 1KZ8A 3EHTA 1YCJA 2I0CA 3KSJA 1Y3QA 5DVIA 3TTKA 1VFDA 1FBEA 1XC1A 2OJTA 3TELA 1LFHA 5AA4A 1NFTA 2KR0A 2PFZA 5BUUA 2F35A 5B7DA 3KSXA 2G93A 3I6VA 2HQ0A 4LQ5A 4GBVA 4H65A 2YJPA 5TP9A 2YPNA 4GLIA 3B8BA 1H45A 1LGBC 3K2DA 4IO2A 1EYKA 3UIFA 2QMWA 4DI3D 3G3KA 1FW0A 3S4UA 3EN3A 3ISPA 4OMBA 4WEDA 3VXBA 1ZIUA 2AL4A 1POY1 2O6AA 4KPTA 1K9YA 2GRVA 1H3DA 3TTLA 3CFXA 1F9BA 1LBCA 3U1OA 2XA5A 3O66A 3TCFA 2ZZWA 5I58A 1DBZA 3SEYA 1VSOA 5B70A 1YZ0A 3OEKA 4PFWA 4QSDA 4ISUA 1DK4A 3IOTA 4I3EA 4JBZA 3BKIB 3LSXA 5EQAA 1MH3A 4P9KA 3FJGA 5ET8A 2DWIA 1K9ZA 1FBFA 4ZE9A 4XKQA 2Q74A 2RCBA 2VD2A 2DXRA 2O69A 4YB5A 2KQZA 3EHUA 4FEBA 4BLAA 3MZ1A 4P1LA 3TEPA 2X7QA 5H8FB 1B7UA 4R74A 2HZLA 5KDTB 2ZYNA 4OVJA 5ITPA 3IR1A 1WODA 1B0LA 1AL3A 4HTGA 5TU0A 4GWYA 3FXBA 1FQDA 3S9MC 4P0GA 3KC1A 1DMBA 5FTHA 3Q28A 1YYZA 3FVKA 4IGRA 3CG1A 4GWXA 4F3GA 1N76A 1LB9A 2VT5A 1UTBB 4NX1A 2UVHA 5CMMA 4ZZAA 1FQAA 3B6QA 1IMDA 1EYIA 2CZHA 4HE1A 4HW8A 3VV5A 4NE4A 1RYXA 4ZEBA 4AB6A 2QVUA 1SQYA 5H8QA 1FPJA 4H46A 3FGSA 5JK4A 4UA8A 1FPFA 2THIA 3SEXA 2P2AA 3D4GA 4NQ8A 3S2VA 1EZPA 1FBDA 2DDKA 5DEXB 3SEVA 5CMCA 2GH9A 2I3WA 4U4SA 3T9UA 4ZEFA 4POWA 1ZTYA 3B6WA 5I56B 1EZ9A 1RDXA 1JP4A 2DWJA 1BP5A 2Y7PA 2XXKA 4OFOA 2Q8JA 2AL5A 1QKAA 5EYHA 4O7MA 3VLUA 4LP2B 1QVSA 4H6DA 4GFRA 1MPBA 2KLFA 4MBPA 4LA9A 5CRYA 4XIGQ 4U21A 4P47A 4RPNA 3UA8A 3GYYA 3IOWA 3U92A 4OVQA 4DLDA 2GQ1A 1Y4TA 1PDAA 4NF8A 3LBSA 2V25A 3H6WA 1FBCA 4BDOA 1URGA 5JEIA 2DYXA 4ESWA 5I7IA 2H98A 1PBPA 1S50A 3K0VA 4RNSA 4OEVA 5EHMA 2ZNTA 1MH4A 3ZS6A 2XXQA 4I40A 5I2NB 1OVTA 4I9DA 1XS5A 3PU5A 3FATA 2OWTA 1SYHA 3KN7A 1B40A 5I2KB 1LCFA 2Y84A 4P11A 3GLBA 2OK2A 1A54A 3C31A 3IOUA 1M5CA 4UABA 4P8BA 4NGUA 1TWYA 1BTJA 3RTWB 3PTYA 1MPDA 1MG1A 1QJMA 2V3TA 3LSFB 3RGYA 4GQOA 2XXYA 1JVXA 3C32A 3MW0A 2H9BA 4YKIA 1NV6A 4N07A 1ZBMA 2R9JA 5AA1A 2CZLA 3UP9A 1JETA 1NNTA 1IMBA 4NF0A 1G0IA 4YAHX 3RLFE 3TZAA 2ONSA 5I57B 1RDYA 4F1VA 1IMFA 1B7ZA 3VLWA 3QSLA 1N3XA 4X8RA 2B3FA 2D5WA 1ANFA 4DDDA 4FE8A 3JV9A 1PB9A 4PF6A 4Z7EA 3CG3A 5K2YA 1B32A 1NV3A 4HCYA 5ESYA 3OELA 1LEVA 4NG7A 1DPPA 3H6VA 4MLQA 3E9XA 4MMPA 2HAUA 1MXYA 2PX1A 3FXQA 1HSLA 2AYSA 3MC2A 4MFIA 1MQJA 3MP8A 3T1BA 2PMSA 3IO4A 3KFMA 2XWIA 2ANJA 4G8MA 2O7IA 1XOCA 2CZIA 5KDTA 1DSNA 4QSCA 1XI6A 4F3BA 2Y7KA 4LN5A 3VFJA 3PV0E 4YB7A 2FVZA 1FBGA 1BIYA 3FV2A 4KI0E 2I49A 1JW4A 4EQ7A 3RTFB 1B0HA 4U23A 4IY6A 4KCDA 4KXPA 4RK2A 4NEDA 4THIA 3L6GA 2I0BA 5L8DA 3W9VA 1UTBA 1IXHA 4QXDA 1JEVA 3KC0A 3H3GA 4GWSA 1GVCA 2Z8FA 3C35A 5F24A 3M3LA 4YMBA 3QAXA 3VE1B 4JVCA 3KJ7A 3MVYA 1YTVA 4F3PA 4ZEDA 5EQ7A 3HO7A 1Q1KA 3FXRA 3U72A 3IB2A 5DW8A 2F6GA 4EUOA 5DVJA 1R1NA 4OENA 5AA3A 1N04A 2Q2AA 3CIJA 5DEXA 4F31B 4JSOA 3U65A 1OQGA 3RYDA 3K1MA 5CBRA 3RT8A 5ET6A 5CI5A 3A3CA 3E79A 4GXAA 3PPPA 5CC2A 4F39A 2XXWA 1JW5A 4FAJA 2OZZA 1Y9UA 2GHBA 3QYTA 3FBPA 1NNPA 1B52A 1LAGE 4GVOA 4FATA 2V93A 3KZGA 4N4UA 3FXUA 3JYRA 4GOTA 5ICQA 1O7TA 3MPLA 4O3AA 1OLCA 4I62A 4DXUA 4EXKA 4NF5A 4QSEA 4UACA 4H0WA 1A8EA 4N6DA 3TMGA 3MJNA 1AIVA 1SD3A 1ATGA 4Z0IA 2ALUA 4G68B 4PAFA 5T3JA 4F1YA 4N91A 4R9FA 3TAJA 1GV8A 4MIJA 1A55A 3MUQA 1EH3A 3KBRA 1M5BA 3TODA 1DTZA 1MXZA 3N26A 4QHQA 2DSFA 2UVIA 1Q9DA 1BKAA 4QF9A 2P3NA 3DLNA 5TPAB 1LLSA 3E13X 3NOHA 4Q30B 4O94A 3HHGA 3LV0A 1I6QA 5I2NA 4Q0CA 1NV5A 1IXGA 5I2KA 2RC7A 4O8MA 1XVYA 4PC9A 1QUJA 1DTGA 2WBBA 4IB2A 2DQVA 1IITA 3IFAA 3DELB 1Z7NE 4N8YA 4N6KA 3LC8A 4OHNA 4DCXA 4PFUA 3IJOB 3PD8A 1SW4A 1OMPA 1Y4CA 1FBHA 3D1RA 5IM2A 4PDDA 2G29A 2IA4A 4NWCA 1FPLA 4HE2A 1II5A 2HXRA 3IK6B 4MCOA 1M5DA 4F29A 1NV4A 4RXLA 3LUYA 1B1XA 4N17A 5I57A 1POTA 4TOZA 1CNQA 4OEUA 3PUWE 2VPNA 1D9QA 1R6ZA 1FPEA 2QFLA 4U2RA 2DS9A 4YKJA 3MQ9A 2R6GE 2VHAA 4NMYA 3T22A 3RPLA 4OETA 5JTYB 5FHMA 4GIZA 3V5AA 1ZMGA 5KZTA 2QVRA 1QGXA 4HE0A 2Z8DA 3BBRA 1MPCA 1B58A 3TQLA 5IZZA 4R75A 5IZ1A 2F34A 2H25A 4XF5A 3PUVE 2Y7IA 3SESA 3UN6A 5M2VA 2PT2A 1MS7A 1LBYA 3E3KA 1B5IA 2HZKA 2M8CA 3QXMA 4GL0A 1NUWA 1AMFA 2A5SA 1PBQA 1AH5A 4DI4B 4AB5A 3TCHA 1BK4A 1A8FA 2F78A 2Z22A 2DVCA 1TT1A 1FBPA 4PF8A 3O6HA 4MJOA 4GF8A 2XXVA 1MY1A 3D4CA 1ZKBA 3C34A 4FORA 1B05A 4F2QA 2ZMBA 2XXRA 4NHBA 3ROJA 4G77A 2Y5LA 1MM7A 3PUXE 4POXA 1NKXA 1SYIA 4F3SA 3MP1A 1FCKA 1P1QA 4LONB 4G61A 3B6TA 2VPOA 3OSQA 5L9SA 2VP1A 3K00A 2PYYA 1UIVA 1KA1A 4JDFA 1FPKA 4PDHA 3TTMA 1LAFE 1NUYA 1RDZA 3T9XB 5FHNA 2PBWA 4G4PA 4U4XA 2WX9A 1LFGA 4MHFA 4HXVA 2ZYMA 3PMXA 1B3EA 3OMBA 5AE4A 3TPAA 2B4LA 2ZYOA 3IORA 3RY3A 2NOOA 3MVXA 4ZE8A 1NUXA 1WDNA 2X26A 3EF7A 4ZDMA 4PBQA 5I84A 4G68C 5I59B 4IGTA 4MLVA 1N0TA 1JNFA 1RKMA 4X04A 5ET7A 4WKMA 1IXCA 3RNNA 1GGGA 2V3QA 3HPIA 3MP6A 3RUMA 4PFIA 3KJTA 1INPA 3CHGA 4GRKA 3T66A 3G3JA 2DOJA 2PT1A 4KYDA 2YLNA 3LSWA 4H1XA 2E0SA 2HCAA 1NV7A
chains in the Genus database with same CATH topology
4MMPA 2WBDA 2R8TA 2B4MA 5IZ3A 4PGNA 1NV2A 3T1BA 5I3SA 4O7IA 4M1VA 4OVRA 5J1DA 2F3BA 2XWIA 1DCUA 2CZIA 1LBVA 2BJIA 2HHMA 1XI6A 5A5LA 4LN5A 1FRPA 5LTCA 4GX3A 2FVZA 1FBGA 4P1EA 2QPQA 4P56A 1VDWA 4MAGA 4MNCA 3BIHA 4JVIA 2DE2A 4KXPA 5CM6A 2ZZVA 3W9VA 1KA0A 4GX4A 4QBAA 4QXDA 3KC0A 4GWSA 3BIGA 2CEXA 1G0HA 1AWBA 4OVTA 4OA4A 5F24A 2DE4A 2WEFA 4GWWA 4JVCA 4F18A 1KZ8A 2F5XA 5EQ7A 4PE3A 4PBHA 2FIEA 5DW8A 1FBEA 2Q8MA 4N81A 2KR0A 2PFZA 3U65A 1YXIA 4GBVA 1FJ9A 3RYDA 5ET6A 3B8BA 3E79A 1EYKA 4DI3D 4NAPA 5I5PA 3ISPA 2XWOA 4XFEA 3FBPA 4N4UA 4OVPA 1K9YA 4X9TA 1IMCA 4YICA 2XA5A 2ZZWA 5EYGA 1DBZA 1FPDA 1YZ0A 1FTAA 1NI9A 4N6DA 1DK4A 2DE3A 4I3EA 5EQAA 2XWKA 4PAFA 4P9KA 5T3JA 4N91A 4GWUA 5ET8A 4MIJA 1K9ZA 1FBFA 2Q74A 5ET5A 5IZ3B 2KQZA 2HPGA 1Q9DA 4P1LA 1IMEA 2JJKA 2P3NA 2HZLA 2P3VA 3NOHA 4O94A 4AS5A 3LV0A 4GWYA 3FXBA 3HFUA 3KC1A 2CZKA 5J16A 1NV5A 4PAIA 1NV0A 2WYPA 1YYZA 4PC9A 4O8MA 4GWXA 1NUZA 2WBBA 2VT5A 3IFAA 4PETA 4NX1A 4N8YA 4N6KA 4I3YA 4P3LA 2V4CA 1IMDA 1EYIA 2CZHA 2OX3A 4HE1A 1FBHA 3D1RA 5IM2A 2MKZA 4PDDA 2QVUA 2FHYA 1FPJA 1IMAA 4H46A 5JK4A 1FPFA 1FPLA 3IFCA 4HE2A 4HCWA 2HXRA 4NQ8A 4MCOA 1LBZA 1NV4A 1FBDA 2DDKA 4NN3A 2L5VA 4PCDA 4N17A 4H45A 1CNQA 4AS4A 2VPNA 3MYUA 3KBZA 1D9QA 1RDXA 1FPEA 1JP4A 2QFLA 2DVZA 4PFRA 2XXKA 1FPBA 2ZZXA 5EYHA 4O7MA 2WYKA 3RPLA 5LDZA 1NV7A 3MSTA 2QVRA 1LBXA 1QGXA 4MEVA 4HE0A 1FJ6A 4MNPA 5IZZA 3RPLB 5IZ1A 3W9WA 3LUZA 2XWVA 4XF5A 4YZZA 4P47A 2FBPA 4OANA 3GYYA 2PFYA 4F1UA 1LBYA 2HZKA 4PGPA 1NUWA 5IGAA 4OVQA 4DI4B 2GQ1A 1BK4A 4IR8A 4FBPA 3EKIA 2Q9TA 1SPIA 5EQ9A 1FBCA 1FBPA 4PF8A 4MJOA 4XEQA 5I7IA 2PCRA 4NHBA 3ROJA 2Y5LA 4I40A 2FIXA 4G61A 2Y5KA 2VPOA 4MNIA 2OWZA 4MX6A 2CEYA 1KA1A 4UABA 1FPGA 1FPKA 4GWZA 4P8BA 4PDHA 3E78A 4NGUA 1NUYA 1RDZA 4JVDA 3PTYA 3B50A 4OVSA 2WX9A 3SZPA 4N15A 4MHFA 1EYJA 4HXVA 3A29A 1FSAA 4GBWA 2QVVA 2B4LA 1NV6A 1NUXA 1IMBA 4NF0A 4PBQA 1G0IA 1RDYA 1NV1A 4F1VA 4X04A 1IMFA 5ET7A 4X8RA 2V3QA 1FPIA 4F19A 3T0JA 4PFIA 1INPA 4PFBA 4N8GA 3CHGA 4PF6A 4PAKA 1NV3A 4HCYA 3QMFA 5FBPA 5ESYA 1LEVA 4NG7A 4PTKA 5EQ8A 4GX6A 2F3DA 1LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OX3 A;  4HE1 A;  2WBD A;  2R8T A;  1FBH A;  3D1R A;  2PCR A;  5IZ3 A;  2QVU A;  3FBP A;  2FHY A;  1FPJ A;  1IMA A;  1LBW A;  3ROJ A;  4H46 A;  1K9Y A;  2Y5L A;  1FPF A;  1NV2 A;  1FPL A;  3IFC A;  4HE2 A;  5I3S A;  4I40 A;  1IMC A;  4O7I A;  2FIX A;  2F3B A;  1DCU A;  1LBZ A;  1NV4 A;  2CZI A;  4G61 A;  1FBD A;  2DDK A;  2Y5K A;  2BJI A;  2HHM A;  5EYG A;  1XI6 A;  5A5L A;  1DBZ A;  2CZH A;  1FRP A;  2OWZ A;  4GX3 A;  1FPD A;  1YZ0 A;  1FTA A;  4H45 A;  1CNQ A;  2FVZ A;  1FBG A;  4AS4 A;  1NI9 A;  1KA1 A;  1DK4 A;  3KBZ A;  4I3E A;  1D9Q A;  1FPG A;  1FPK A;  4GWZ A;  1RDX A;  1FPE A;  5EQA A;  1JP4 A;  2QFL A;  1NUY A;  1RDZ A;  1VDW A;  1FPB A;  5T3J A;  3BIH A;  5EYH A;  3RPL A;  4GWU A;  5LDZ A;  5ET8 A;  4KXP A;  1EYJ A;  4HXV A;  2QVR A;  1K9Z A;  1LBX A;  1FBF A;  1KA0 A;  1QGX A;  2Q74 A;  3A29 A;  4HE0 A;  4GX4 A;  5ET5 A;  5IZ3 B;  1FSA A;  4GBW A;  1FJ6 A;  4QXD A;  3KC0 A;  2QVV A;  4GWS A;  3BIG A;  1G0H A;  1NV6 A;  1AWB A;  3RPL B;  5F24 A;  5IZ1 A;  1Q9D A;  3LUZ A;  1NUX A;  2WEF A;  4GWW A;  1IME A;  2JJK A;  1KZ8 A;  1IMB A;  2P3N A;  5EQ7 A;  1G0I A;  2FIE A;  2FBP A;  2P3V A;  4GX6 A;  5DW8 A;  1FBE A;  4AS5 A;  1LBY A;  1RDY A;  1NV1 A;  3LV0 A;  2Q8M A;  1IMF A;  4GWY A;  5ET7 A;  4N81 A;  1NUW A;  3KC1 A;  2CZK A;  5J16 A;  1NV5 A;  1FPI A;  1NV0 A;  1YYZ A;  2GQ1 A;  1BK4 A;  3T0J A;  1INP A;  1YXI A;  4GBV A;  4GWX A;  1FJ9 A;  1NUZ A;  3RYD A;  2WBB A;  4IR8 A;  5ET6 A;  4FBP A;  3B8B A;  2VT5 A;  1NV3 A;  3IFA A;  1SPI A;  5EQ9 A;  1FBC A;  1FBP A;  1EYK A;  3QMF A;  5FBP A;  5ESY A;  4I3Y A;  4MJO A;  1LEV A;  4PTK A;  1IMD A;  5EQ8 A;  1EYI A;  1NV7 A;  2F3D A;  1LBV A; 
#chains in the Genus database with same CATH topology
 3TYH A;  4F22 A;  3PMW A;  3PPQ A;  2R8T A;  3PPO A;  4Q5T A;  3K1P A;  4PGN A;  1YAE A;  3O2A A;  4BDR A;  1OLA A;  3T9V A;  1B9J A;  3UGW A;  3FUZ A;  3IAZ A;  2F3B A;  1DCU A;  3E4R A;  1FQC A;  4ZEI A;  2F7B A;  3Q29 A;  2HHM A;  5A5L A;  1B2H A;  1EU8 A;  3H7M A;  3C36 A;  3C4M A;  5LTC A;  1JW1 A;  3TKD A;  4P1E A;  3P7I A;  2QPQ A;  3OXN A;  4KYE A;  2PVU A;  3IB1 A;  1B5H A;  4MAG A;  1FQF A;  3RQT A;  4JVI A;  5A5X B;  2VOZ A;  1YPN A;  4YMA A;  3R6U A;  4GX4 A;  4QBA A;  2D21 A;  2X7P A;  1MY3 A;  3SEU A;  1FTL A;  4OVT A;  5AA2 B;  1ZJL A;  2DE4 A;  3SET A;  3Q25 A;  2WEF A;  1A99 A;  2WKY A;  4F18 A;  2F7A A;  4H8J A;  1USY E;  1MQH A;  4GWO A;  4PBH A;  1TFA A;  3CFZ A;  3FD3 A;  4OER A;  2OPE A;  2D3I A;  2XX8 A;  2Q8M A;  4N81 A;  2QL3 A;  2O51 A;  4R6Y A;  4G8N A;  4XTC Q;  1FJ9 A;  2A5T B;  1B46 A;  1B5J A;  3T96 B;  1JQF A;  4BDQ A;  4IO5 A;  1SI1 A;  4NTL A;  5F1Q A;  5KCJ B;  2O84 X;  2I4B A;  5TP9 B;  3HST A;  3M3F A;  3KEI A;  2XXP A;  3G7W A;  2XWO A;  1US5 A;  4XFE A;  4X48 A;  2XXT A;  3O6G A;  4KD5 A;  3DP8 A;  3CI8 A;  1FTO A;  4H5G A;  1NI9 A;  4IO6 A;  2HAV A;  2QS2 A;  1T0K A;  1LB8 A;  2XWK A;  1R9Q A;  4HS7 A;  1DPE A;  4XKR A;  4GWU A;  1N7W A;  1N7X A;  5H8F A;  4N6P A;  4ONY A;  5EHS A;  5IZ3 B;  3T9H B;  2XXH A;  4KCC A;  5L9O A;  3OEN A;  2HPG A;  4C1T A;  3OOA A;  4NF6 B;  5ICT A;  1FTM A;  1VE4 A;  4WXJ A;  2B3B A;  1SI0 A;  4C0R A;  2QS4 A;  4OFJ A;  2VGQ A;  2P0S A;  4BDN A;  2HXW A;  5J16 A;  1NV0 A;  2WYP A;  4FEC A;  1OIB A;  1NUZ A;  4ZEK A;  2FNC A;  3WAE A;  1N84 A;  1IEJ A;  3QK6 A;  4PET A;  3CR9 A;  1P1O A;  4P3L A;  5DVF A;  2QMX A;  3QUF A;  2ZXT A;  2OX3 A;  3UOR A;  1NNF A;  2MKZ A;  4EF2 A;  3EQ1 A;  2FHY A;  2F6P A;  4IO3 A;  4GXS B;  4GD5 A;  4BDL A;  3IFC A;  2I4C A;  5I56 A;  4HCW A;  2F36 A;  1LBZ A;  4YKK A;  4F2O A;  2QS3 A;  4NN3 A;  1H76 A;  3GZG A;  2W7Y A;  4PCD A;  4K3F A;  3USD A;  2B65 A;  4H45 A;  4AS4 A;  5H8H B;  3MWB A;  4PFR A;  3GBB A;  2Q2C A;  3N94 A;  4QFL A;  1VR5 A;  4ELO A;  1UQW A;  3MST A;  2Q89 A;  1LBX A;  2REG A;  1B51 A;  4MEV A;  4OZ9 A;  1FJ6 A;  5FHO A;  4LZ7 A;  3IX1 A;  5F7V A;  4MNP A;  1Y20 A;  4R2F A;  4ND9 A;  4R72 A;  3QIM A;  3I3V A;  3K6U A;  4JWX A;  2XWV A;  4QFN A;  3VVD A;  3KN3 A;  4YZZ A;  3IB0 A;  3U94 A;  3PPN A;  1SW2 A;  3ILT B;  2PFY A;  4F1U A;  1A7L A;  1PEB A;  3HCQ A;  1P1U A;  1HSE A;  1XVX A;  3O28 A;  1SDX A;  1I6B A;  1US4 A;  3ZKK A;  4IR8 A;  1IXI A;  1NH8 A;  3EKI A;  1SPI A;  5EQ9 A;  4ZEC A;  4EF1 A;  5BWJ A;  4MF3 A;  4KYS A;  3CFL A;  4NF8 B;  4H5F A;  1JVY A;  1S9T A;  3DP6 A;  1B3L A;  1MY4 A;  2OCU A;  4G2Z A;  4I8C A;  5AA2 A;  3KGC A;  2CMO A;  1LCT A;  2FIX A;  2RF1 A;  3TDJ A;  3MZB A;  2Y5K A;  1L5T A;  2QRY A;  4MNI A;  1FQE A;  1SW1 A;  4MX6 A;  3MZ9 A;  2RCA A;  3LSL A;  3E78 A;  3AXF A;  1P99 A;  4PFY A;  1LST A;  1D9V A;  1CB6 A;  4QFK A;  2ABH A;  4OVS A;  1PC3 A;  5HM4 B;  3K6X A;  3MAM A;  1B3F A;  4OWD A;  3SZP A;  4N15 A;  2A5T A;  1O64 A;  4ELQ A;  4FIM A;  4R73 A;  1B4H A;  2Y7W A;  3A29 A;  4GBW A;  2UYE A;  5DTB A;  1IZ1 A;  5KCJ A;  1ZU0 A;  4TQU Q;  4OES A;  1TFD A;  4YB6 A;  2NWJ A;  4XXU A;  2XX7 A;  2H5Y A;  1LAH E;  4P0I A;  3KOT A;  5CMB A;  2ZNU A;  3ZKL A;  5IKB A;  1SBP A;  3TQW A;  4IO4 A;  4X1B A;  2V84 A;  2XD3 A;  4JSD A;  3ILU B;  1DOT A;  4I1D A;  1MXW A;  3O6I A;  3KG2 A;  4N8G A;  4PAK A;  3O9P A;  4PTK A;  2RIN A;  3TUS A;  3N6T A;  3THI A;  3M8U A;  5EQ8 A;  1LAX A;  2V3U A;  3OO6 A;  1LBW A;  2ONR A;  3VLV A;  2B4M A;  3VVF A;  5IZ3 A;  3FVO A;  2NXO A;  3R7X A;  3T93 B;  4LZ5 A;  3S9E A;  2XXI A;  2DXY A;  3ONM A;  3EHS A;  3UK4 A;  2OBG A;  1IUD A;  1NV2 A;  4DCY A;  1B1H A;  4NF6 A;  3SKP A;  1LFI A;  2RKM A;  3RT6 B;  1UTH B;  3I5O A;  4KR5 A;  3WAF A;  4GL8 A;  2ESN A;  3RN8 A;  2BJI A;  3CSB A;  3CSG A;  1FRP A;  2IEE A;  1D9Y A;  4H67 A;  3F11 A;  4R6K A;  3GBA A;  2DE2 A;  5ISU A;  1D4N A;  5DT6 A;  1H44 A;  5CM6 A;  4WEP A;  1KA0 A;  1MQD A;  4ELP A;  1A40 A;  1URD A;  1MXX A;  1B4Z A;  4IY5 A;  4EQB A;  2QJE A;  3BIG A;  1G0H A;  1AWB A;  1MXV A;  2XXU A;  1QUI A;  3HHF A;  2F7C A;  3V89 B;  4PE3 A;  2F5X A;  4X1D A;  2FIE A;  1B3H A;  1S7Y A;  3PGF A;  4NF4 B;  1UIU A;  5H8N B;  2P1S A;  4RA1 A;  4AQ4 A;  4OXV A;  3FVN A;  4LUB A;  5FTI A;  1YXI A;  3SER A;  2DP8 A;  1QKB A;  3K6V A;  4DIG A;  5H8H A;  1PB8 A;  1URS A;  2H99 A;  4NAP A;  5CBS A;  4XKP A;  1VFE A;  1NMU A;  3V8X B;  4LZ8 A;  1I69 A;  5I5P A;  1XHY A;  4JWY A;  5DYH A;  1J1N A;  4G8H A;  2GFE A;  3VXC A;  3H6U A;  4OVP A;  4X9T A;  4DZ1 A;  4RY1 A;  3CRB A;  1IMC A;  4YIC A;  1RYO A;  5ITO A;  4TLL B;  1MY0 A;  3ODB A;  4G68 A;  4E0W A;  4EQ9 A;  3FVG A;  5EYG A;  4O3B A;  4N13 A;  2I58 A;  3IOV A;  3OO9 A;  1O63 A;  1FPD A;  4OYV A;  1FTA A;  4XKN A;  3FZV A;  4RJZ A;  2DE3 A;  3JZJ A;  2RC8 A;  1MM6 A;  1R9L A;  3FJ7 A;  3W15 C;  1HSJ A;  4NF5 B;  3TTN A;  2XD2 A;  4U1Z A;  3C33 A;  2DWH A;  2BJJ X;  2LAO A;  4MH5 A;  4EDP A;  5ET5 A;  2AIX A;  4FJP A;  5TPA A;  5K2X A;  5L9M A;  3A09 A;  5LOM A;  3PD9 A;  2HFB A;  4RYA A;  2XX9 A;  3CVG A;  2RC9 A;  1IME A;  2JJK A;  5HBC A;  2OPD A;  2UVG A;  4R2B A;  3KOS A;  2P3V A;  1MY2 A;  4AS5 A;  2ONK E;  4IO7 A;  3Q26 A;  3HFU A;  3QUJ A;  2CZK A;  4QRZ A;  4PAI A;  1QUK A;  1SW5 A;  1QUL A;  3HN0 A;  4BDM A;  3KN8 A;  3G3F A;  2E1S A;  3DP4 A;  3Q27 A;  4OQO A;  3IJX B;  4I3Y A;  2QSX A;  2V4C A;  3PPR A;  4LAT A;  3TFL A;  1Q35 A;  1IQ7 A;  3PUY E;  2R71 A;  3ECR A;  1IMA A;  3H03 A;  1FTJ A;  4JWO A;  5AA4 B;  3FIR A;  3OD7 A;  4U1O A;  1P1N A;  2DWA A;  3H4Z A;  2L5V A;  4NWD A;  2I48 A;  2F8D A;  5JTY A;  3FAS A;  4Q8R A;  3MYU A;  3KBZ A;  1SVX B;  2DVZ A;  3U8Q A;  4ZZE A;  1FPB A;  2ZZX A;  4RPO A;  2WYK A;  4ELR A;  5LDZ A;  4YU0 A;  3FV1 A;  3O29 A;  3S9L C;  1MDQ A;  3K02 A;  3G3I A;  1USY H;  3OO7 A;  5H8S A;  2ZYK A;  1GTK A;  3R26 A;  2F97 A;  3RPL B;  1ZLQ A;  3W9W A;  3LUZ A;  2XXX A;  4ECF A;  5I58 B;  1KWH A;  2FBP A;  3IL1 B;  4OAN A;  1P1W A;  1OVB A;  4PGP A;  3LR1 A;  2FA7 A;  1UTH A;  5IGA A;  2NVU B;  3TCG A;  4OTE A;  2O7U A;  3SDF A;  1CE2 A;  4C1U A;  4FBP A;  2Z8E A;  2Q9T A;  1I6A A;  4RK9 A;  3MBP A;  1Y1Z A;  5CMK A;  4XEQ A;  4KQP A;  3IO6 A;  1WVJ A;  3V83 A;  3OEM A;  4L17 A;  2PCR A;  1M5E A;  2NUV A;  3O97 A;  2O68 A;  4LVQ A;  1H43 A;  4DXC A;  4PFT A;  1NL5 A;  3U93 A;  1MXU A;  4KHZ E;  2VD3 A;  4H8I A;  4ZS9 A;  4ESX A;  2H4I A;  3PMV A;  5IAI A;  1B3G A;  1MQI A;  3L6H A;  3K01 A;  1XT8 A;  2OWZ A;  4NF4 A;  2CEY A;  1NNK A;  1FPG A;  5H8N A;  4GWZ A;  1MQG A;  3BFT A;  3M3K A;  4QFP A;  1Y1M A;  3HV1 A;  4JVD A;  4JB7 A;  2REJ A;  5AA2 D;  4R6H A;  2FYI A;  3B50 A;  3MVW A;  4U22 A;  2QS1 A;  1IIW A;  2UVJ A;  3N5L A;  1EYJ A;  1B7H A;  1EZO A;  1FSA A;  3OO8 A;  4DXB A;  5I59 A;  5H8Q B;  2QVV A;  3C9H A;  3EPE A;  2I3V A;  5HPQ A;  4YKP A;  3DM0 A;  3B7D A;  2I6E A;  2ZNS A;  3OSR A;  2HEU A;  3K4U A;  1Y3P A;  2Z23 A;  1NV1 A;  3N6U A;  5ELV A;  2Q88 A;  1BLF A;  4PQJ A;  3BFU A;  1FPI A;  3TTR A;  4F19 A;  3GXA A;  3H06 B;  3T0J A;  3G3H A;  2OLB A;  4PFB A;  3G3G A;  3VVE A;  3H6T A;  3ZSF A;  1TXF A;  1NH7 A;  3QMF A;  3SEW A;  2Y7R A;  5FBP A;  1GR2 A;  1MRP A;  4FED A;  4DE8 A;  1Z7M E;  3FJM A;  1LBB A;  4GX6 A;  1QW0 A;  1LBV A;  2O1L A;  2F3D A;  2OWS A;  4M4G A;  3RPW A;  2WBD A;  1Y3N A;  1D3K A;  1M5F A;  4KFQ A;  3PUZ E;  4LQ2 A;  5EYF A;  4PE5 B;  2GHA A;  4PP0 A;  1B6H A;  4TLM B;  5I3S A;  4O7I A;  1JEU A;  4M1V A;  4OVR A;  5J1D A;  2UYF A;  1PB7 A;  4EXL A;  3A3U A;  3S9N C;  1FTK A;  5A5X A;  4GX3 A;  1ELJ A;  1AOV A;  4R9G A;  3MPK A;  4P56 A;  1VDW A;  4MNC A;  3BIH A;  4OFL A;  4E0X A;  2UXA A;  2ZZV A;  1FQB A;  1MDP 1;  4O3C A;  2XHD A;  4JXI A;  3VDF A;  3MVZ A;  4QFO A;  1OQH A;  2CEX A;  4OA4 A;  4GWW A;  1N3W A;  2O1M A;  3K1N A;  3K6W A;  1KZ8 A;  3EHT A;  1YCJ A;  2I0C A;  3KSJ A;  1Y3Q A;  5DVI A;  3TTK A;  1VFD A;  1FBE A;  1XC1 A;  2OJT A;  3TEL A;  1LFH A;  5AA4 A;  1NFT A;  2KR0 A;  2PFZ A;  5BUU A;  2F35 A;  5B7D A;  3KSX A;  2G93 A;  3I6V A;  2HQ0 A;  4LQ5 A;  4GBV A;  4H65 A;  2YJP A;  5TP9 A;  2YPN A;  4GLI A;  3B8B A;  1H45 A;  1LGB C;  3K2D A;  4IO2 A;  1EYK A;  3UIF A;  2QMW A;  4DI3 D;  3G3K A;  1FW0 A;  3S4U A;  3EN3 A;  3ISP A;  4OMB A;  4WED A;  3VXB A;  1ZIU A;  2AL4 A;  1POY 1;  2O6A A;  4KPT A;  1K9Y A;  2GRV A;  1H3D A;  3TTL A;  3CFX A;  1F9B A;  1LBC A;  3U1O A;  2XA5 A;  3O66 A;  3TCF A;  2ZZW A;  5I58 A;  1DBZ A;  3SEY A;  1VSO A;  5B70 A;  1YZ0 A;  3OEK A;  4PFW A;  4QSD A;  4ISU A;  1DK4 A;  3IOT A;  4I3E A;  4JBZ A;  3BKI B;  3LSX A;  5EQA A;  1MH3 A;  4P9K A;  3FJG A;  5ET8 A;  2DWI A;  1K9Z A;  1FBF A;  4ZE9 A;  4XKQ A;  2Q74 A;  2RCB A;  2VD2 A;  2DXR A;  2O69 A;  4YB5 A;  2KQZ A;  3EHU A;  4FEB A;  4BLA A;  3MZ1 A;  4P1L A;  3TEP A;  2X7Q A;  5H8F B;  1B7U A;  4R74 A;  2HZL A;  5KDT B;  2ZYN A;  4OVJ A;  5ITP A;  3IR1 A;  1WOD A;  1B0L A;  1AL3 A;  4HTG A;  5TU0 A;  4GWY A;  3FXB A;  1FQD A;  3S9M C;  4P0G A;  3KC1 A;  1DMB A;  5FTH A;  3Q28 A;  1YYZ A;  3FVK A;  4IGR A;  3CG1 A;  4GWX A;  4F3G A;  1N76 A;  1LB9 A;  2VT5 A;  1UTB B;  4NX1 A;  2UVH A;  5CMM A;  4ZZA A;  1FQA A;  3B6Q A;  1IMD A;  1EYI A;  2CZH A;  4HE1 A;  4HW8 A;  3VV5 A;  4NE4 A;  1RYX A;  4ZEB A;  4AB6 A;  2QVU A;  1SQY A;  5H8Q A;  1FPJ A;  4H46 A;  3FGS A;  5JK4 A;  4UA8 A;  1FPF A;  2THI A;  3SEX A;  2P2A A;  3D4G A;  4NQ8 A;  3S2V A;  1EZP A;  1FBD A;  2DDK A;  5DEX B;  3SEV A;  5CMC A;  2GH9 A;  2I3W A;  4U4S A;  3T9U A;  4ZEF A;  4POW A;  1ZTY A;  3B6W A;  5I56 B;  1EZ9 A;  1RDX A;  1JP4 A;  2DWJ A;  1BP5 A;  2Y7P A;  2XXK A;  4OFO A;  2Q8J A;  2AL5 A;  1QKA A;  5EYH A;  4O7M A;  3VLU A;  4LP2 B;  1QVS A;  4H6D A;  4GFR A;  1MPB A;  2KLF A;  4MBP A;  4LA9 A;  5CRY A;  4XIG Q;  4U21 A;  4P47 A;  4RPN A;  3UA8 A;  3GYY A;  3IOW A;  3U92 A;  4OVQ A;  4DLD A;  2GQ1 A;  1Y4T A;  1PDA A;  4NF8 A;  3LBS A;  2V25 A;  3H6W A;  1FBC A;  4BDO A;  1URG A;  5JEI A;  2DYX A;  4ESW A;  5I7I A;  2H98 A;  1PBP A;  1S50 A;  3K0V A;  4RNS A;  4OEV A;  5EHM A;  2ZNT A;  1MH4 A;  3ZS6 A;  2XXQ A;  4I40 A;  5I2N B;  1OVT A;  4I9D A;  1XS5 A;  3PU5 A;  3FAT A;  2OWT A;  1SYH A;  3KN7 A;  1B40 A;  5I2K B;  1LCF A;  2Y84 A;  4P11 A;  3GLB A;  2OK2 A;  1A54 A;  3C31 A;  3IOU A;  1M5C A;  4UAB A;  4P8B A;  4NGU A;  1TWY A;  1BTJ A;  3RTW B;  3PTY A;  1MPD A;  1MG1 A;  1QJM A;  2V3T A;  3LSF B;  3RGY A;  4GQO A;  2XXY A;  1JVX A;  3C32 A;  3MW0 A;  2H9B A;  4YKI A;  1NV6 A;  4N07 A;  1ZBM A;  2R9J A;  5AA1 A;  2CZL A;  3UP9 A;  1JET A;  1NNT A;  1IMB A;  4NF0 A;  1G0I A;  4YAH X;  3RLF E;  3TZA A;  2ONS A;  5I57 B;  1RDY A;  4F1V A;  1IMF A;  1B7Z A;  3VLW A;  3QSL A;  1N3X A;  4X8R A;  2B3F A;  2D5W A;  1ANF A;  4DDD A;  4FE8 A;  3JV9 A;  1PB9 A;  4PF6 A;  4Z7E A;  3CG3 A;  5K2Y A;  1B32 A;  1NV3 A;  4HCY A;  5ESY A;  3OEL A;  1LEV A;  4NG7 A;  1DPP A;  3H6V A;  4MLQ A;  3E9X A;  4MMP A;  2HAU A;  1MXY A;  2PX1 A;  3FXQ A;  1HSL A;  2AYS A;  3MC2 A;  4MFI A;  1MQJ A;  3MP8 A;  3T1B A;  2PMS A;  3IO4 A;  3KFM A;  2XWI A;  2ANJ A;  4G8M A;  2O7I A;  1XOC A;  2CZI A;  5KDT A;  1DSN A;  4QSC A;  1XI6 A;  4F3B A;  2Y7K A;  4LN5 A;  3VFJ A;  3PV0 E;  4YB7 A;  2FVZ A;  1FBG A;  1BIY A;  3FV2 A;  4KI0 E;  2I49 A;  1JW4 A;  4EQ7 A;  3RTF B;  1B0H A;  4U23 A;  4IY6 A;  4KCD A;  4KXP A;  4RK2 A;  4NED A;  4THI A;  3L6G A;  2I0B A;  5L8D A;  3W9V A;  1UTB A;  1IXH A;  4QXD A;  1JEV A;  3KC0 A;  3H3G A;  4GWS A;  1GVC A;  2Z8F A;  3C35 A;  5F24 A;  3M3L A;  4YMB A;  3QAX A;  3VE1 B;  4JVC A;  3KJ7 A;  3MVY A;  1YTV A;  4F3P A;  4ZED A;  5EQ7 A;  3HO7 A;  1Q1K A;  3FXR A;  3U72 A;  3IB2 A;  5DW8 A;  2F6G A;  4EUO A;  5DVJ A;  1R1N A;  4OEN A;  5AA3 A;  1N04 A;  2Q2A A;  3CIJ A;  5DEX A;  4F31 B;  4JSO A;  3U65 A;  1OQG A;  3RYD A;  3K1M A;  5CBR A;  3RT8 A;  5ET6 A;  5CI5 A;  3A3C A;  3E79 A;  4GXA A;  3PPP A;  5CC2 A;  4F39 A;  2XXW A;  1JW5 A;  4FAJ A;  2OZZ A;  1Y9U A;  2GHB A;  3QYT A;  3FBP A;  1NNP A;  1B52 A;  1LAG E;  4GVO A;  4FAT A;  2V93 A;  3KZG A;  4N4U A;  3FXU A;  3JYR A;  4GOT A;  5ICQ A;  1O7T A;  3MPL A;  4O3A A;  1OLC A;  4I62 A;  4DXU A;  4EXK A;  4NF5 A;  4QSE A;  4UAC A;  4H0W A;  1A8E A;  4N6D A;  3TMG A;  3MJN A;  1AIV A;  1SD3 A;  1ATG A;  4Z0I A;  2ALU A;  4G68 B;  4PAF A;  5T3J A;  4F1Y A;  4N91 A;  4R9F A;  3TAJ A;  1GV8 A;  4MIJ A;  1A55 A;  3MUQ A;  1EH3 A;  3KBR A;  1M5B A;  3TOD A;  1DTZ A;  1MXZ A;  3N26 A;  4QHQ A;  2DSF A;  2UVI A;  1Q9D A;  1BKA A;  4QF9 A;  2P3N A;  3DLN A;  5TPA B;  1LLS A;  3E13 X;  3NOH A;  4Q30 B;  4O94 A;  3HHG A;  3LV0 A;  1I6Q A;  5I2N A;  4Q0C A;  1NV5 A;  1IXG A;  5I2K A;  2RC7 A;  4O8M A;  1XVY A;  4PC9 A;  1QUJ A;  1DTG A;  2WBB A;  4IB2 A;  2DQV A;  1IIT A;  3IFA A;  3DEL B;  1Z7N E;  4N8Y A;  4N6K A;  3LC8 A;  4OHN A;  4DCX A;  4PFU A;  3IJO B;  3PD8 A;  1SW4 A;  1OMP A;  1Y4C A;  1FBH A;  3D1R A;  5IM2 A;  4PDD A;  2G29 A;  2IA4 A;  4NWC A;  1FPL A;  4HE2 A;  1II5 A;  2HXR A;  3IK6 B;  4MCO A;  1M5D A;  4F29 A;  1NV4 A;  4RXL A;  3LUY A;  1B1X A;  4N17 A;  5I57 A;  1POT A;  4TOZ A;  1CNQ A;  4OEU A;  3PUW E;  2VPN A;  1D9Q A;  1R6Z A;  1FPE A;  2QFL A;  4U2R A;  2DS9 A;  4YKJ A;  3MQ9 A;  2R6G E;  2VHA A;  4NMY A;  3T22 A;  3RPL A;  4OET A;  5JTY B;  5FHM A;  4GIZ A;  3V5A A;  1ZMG A;  5KZT A;  2QVR A;  1QGX A;  4HE0 A;  2Z8D A;  3BBR A;  1MPC A;  1B58 A;  3TQL A;  5IZZ A;  4R75 A;  5IZ1 A;  2F34 A;  2H25 A;  4XF5 A;  3PUV E;  2Y7I A;  3SES A;  3UN6 A;  5M2V A;  2PT2 A;  1MS7 A;  1LBY A;  3E3K A;  1B5I A;  2HZK A;  2M8C A;  3QXM A;  4GL0 A;  1NUW A;  1AMF A;  2A5S A;  1PBQ A;  1AH5 A;  4DI4 B;  4AB5 A;  3TCH A;  1BK4 A;  1A8F A;  2F78 A;  2Z22 A;  2DVC A;  1TT1 A;  1FBP A;  4PF8 A;  3O6H A;  4MJO A;  4GF8 A;  2XXV A;  1MY1 A;  3D4C A;  1ZKB A;  3C34 A;  4FOR A;  1B05 A;  4F2Q A;  2ZMB A;  2XXR A;  4NHB A;  3ROJ A;  4G77 A;  2Y5L A;  1MM7 A;  3PUX E;  4POX A;  1NKX A;  1SYI A;  4F3S A;  3MP1 A;  1FCK A;  1P1Q A;  4LON B;  4G61 A;  3B6T A;  2VPO A;  3OSQ A;  5L9S A;  2VP1 A;  3K00 A;  2PYY A;  1UIV A;  1KA1 A;  4JDF A;  1FPK A;  4PDH A;  3TTM A;  1LAF E;  1NUY A;  1RDZ A;  3T9X B;  5FHN A;  2PBW A;  4G4P A;  4U4X A;  2WX9 A;  1LFG A;  4MHF A;  4HXV A;  2ZYM A;  3PMX A;  1B3E A;  3OMB A;  5AE4 A;  3TPA A;  2B4L A;  2ZYO A;  3IOR A;  3RY3 A;  2NOO A;  3MVX A;  4ZE8 A;  1NUX A;  1WDN A;  2X26 A;  3EF7 A;  4ZDM A;  4PBQ A;  5I84 A;  4G68 C;  5I59 B;  4IGT A;  4MLV A;  1N0T A;  1JNF A;  1RKM A;  4X04 A;  5ET7 A;  4WKM A;  1IXC A;  3RNN A;  1GGG A;  2V3Q A;  3HPI A;  3MP6 A;  3RUM A;  4PFI A;  3KJT A;  1INP A;  3CHG A;  4GRK A;  3T66 A;  3G3J A;  2DOJ A;  2PT1 A;  4KYD A;  2YLN A;  3LSW A;  4H1X A;  2E0S A;  2HCA A;  1NV7 A; 
#chains in the Genus database with same CATH homology
 4MMP A;  2WBD A;  2R8T A;  2B4M A;  5IZ3 A;  4PGN A;  1NV2 A;  3T1B A;  5I3S A;  4O7I A;  4M1V A;  4OVR A;  5J1D A;  2F3B A;  2XWI A;  1DCU A;  2CZI A;  1LBV A;  2BJI A;  2HHM A;  1XI6 A;  5A5L A;  4LN5 A;  1FRP A;  5LTC A;  4GX3 A;  2FVZ A;  1FBG A;  4P1E A;  2QPQ A;  4P56 A;  1VDW A;  4MAG A;  4MNC A;  3BIH A;  4JVI A;  2DE2 A;  4KXP A;  5CM6 A;  2ZZV A;  3W9V A;  1KA0 A;  4GX4 A;  4QBA A;  4QXD A;  3KC0 A;  4GWS A;  3BIG A;  2CEX A;  1G0H A;  1AWB A;  4OVT A;  4OA4 A;  5F24 A;  2DE4 A;  2WEF A;  4GWW A;  4JVC A;  4F18 A;  1KZ8 A;  2F5X A;  5EQ7 A;  4PE3 A;  4PBH A;  2FIE A;  5DW8 A;  1FBE A;  2Q8M A;  4N81 A;  2KR0 A;  2PFZ A;  3U65 A;  1YXI A;  4GBV A;  1FJ9 A;  3RYD A;  5ET6 A;  3B8B A;  3E79 A;  1EYK A;  4DI3 D;  4NAP A;  5I5P A;  3ISP A;  2XWO A;  4XFE A;  3FBP A;  4N4U A;  4OVP A;  1K9Y A;  4X9T A;  1IMC A;  4YIC A;  2XA5 A;  2ZZW A;  5EYG A;  1DBZ A;  1FPD A;  1YZ0 A;  1FTA A;  1NI9 A;  4N6D A;  1DK4 A;  2DE3 A;  4I3E A;  5EQA A;  2XWK A;  4PAF A;  4P9K A;  5T3J A;  4N91 A;  4GWU A;  5ET8 A;  4MIJ A;  1K9Z A;  1FBF A;  2Q74 A;  5ET5 A;  5IZ3 B;  2KQZ A;  2HPG A;  1Q9D A;  4P1L A;  1IME A;  2JJK A;  2P3N A;  2HZL A;  2P3V A;  3NOH A;  4O94 A;  4AS5 A;  3LV0 A;  4GWY A;  3FXB A;  3HFU A;  3KC1 A;  2CZK A;  5J16 A;  1NV5 A;  4PAI A;  1NV0 A;  2WYP A;  1YYZ A;  4PC9 A;  4O8M A;  4GWX A;  1NUZ A;  2WBB A;  2VT5 A;  3IFA A;  4PET A;  4NX1 A;  4N8Y A;  4N6K A;  4I3Y A;  4P3L A;  2V4C A;  1IMD A;  1EYI A;  2CZH A;  2OX3 A;  4HE1 A;  1FBH A;  3D1R A;  5IM2 A;  2MKZ A;  4PDD A;  2QVU A;  2FHY A;  1FPJ A;  1IMA A;  4H46 A;  5JK4 A;  1FPF A;  1FPL A;  3IFC A;  4HE2 A;  4HCW A;  2HXR A;  4NQ8 A;  4MCO A;  1LBZ A;  1NV4 A;  1FBD A;  2DDK A;  4NN3 A;  2L5V A;  4PCD A;  4N17 A;  4H45 A;  1CNQ A;  4AS4 A;  2VPN A;  3MYU A;  3KBZ A;  1D9Q A;  1RDX A;  1FPE A;  1JP4 A;  2QFL A;  2DVZ A;  4PFR A;  2XXK A;  1FPB A;  2ZZX A;  5EYH A;  4O7M A;  2WYK A;  3RPL A;  5LDZ A;  1NV7 A;  3MST A;  2QVR A;  1LBX A;  1QGX A;  4MEV A;  4HE0 A;  1FJ6 A;  4MNP A;  5IZZ A;  3RPL B;  5IZ1 A;  3W9W A;  3LUZ A;  2XWV A;  4XF5 A;  4YZZ A;  4P47 A;  2FBP A;  4OAN A;  3GYY A;  2PFY A;  4F1U A;  1LBY A;  2HZK A;  4PGP A;  1NUW A;  5IGA A;  4OVQ A;  4DI4 B;  2GQ1 A;  1BK4 A;  4IR8 A;  4FBP A;  3EKI A;  2Q9T A;  1SPI A;  5EQ9 A;  1FBC A;  1FBP A;  4PF8 A;  4MJO A;  4XEQ A;  5I7I A;  2PCR A;  4NHB A;  3ROJ A;  2Y5L A;  4I40 A;  2FIX A;  4G61 A;  2Y5K A;  2VPO A;  4MNI A;  2OWZ A;  4MX6 A;  2CEY A;  1KA1 A;  4UAB A;  1FPG A;  1FPK A;  4GWZ A;  4P8B A;  4PDH A;  3E78 A;  4NGU A;  1NUY A;  1RDZ A;  4JVD A;  3PTY A;  3B50 A;  4OVS A;  2WX9 A;  3SZP A;  4N15 A;  4MHF A;  1EYJ A;  4HXV A;  3A29 A;  1FSA A;  4GBW A;  2QVV A;  2B4L A;  1NV6 A;  1NUX A;  1IMB A;  4NF0 A;  4PBQ A;  1G0I A;  1RDY A;  1NV1 A;  4F1V A;  4X04 A;  1IMF A;  5ET7 A;  4X8R A;  2V3Q A;  1FPI A;  4F19 A;  3T0J A;  4PFI A;  1INP A;  4PFB A;  4N8G A;  3CHG A;  4PF6 A;  4PAK A;  1NV3 A;  4HCY A;  3QMF A;  5FBP A;  5ESY A;  1LEV A;  4NG7 A;  4PTK A;  5EQ8 A;  4GX6 A;  2F3D A;  1LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...