5DW8A

Crystal structure of 2'amp bound saimpase-ii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
269
structure length
260
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Crystal structure of 2'AMP bound SaIMPase-II
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 76
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5dw8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5dw8A02
1FPJA 4HE2A 1NUZA 1FBCA 1NUXA 2Y5LA 1AWBA 1CNQA 1FPIA 1FPDA 3IFCA 2Q8MA 3RPLB 4HE0A 2VT5A 2F3BA 1FPFA 1FPLA 5IZ1A 1FPEA 3LUZA 2F3DA 3B8BA 1DBZA 2CZIA 2R8TA 4GX6A 1G0IA 3ROJA 1BK4A 1FJ6A 2CZHA 2FBPA 3RYDA 4O7IA 1LBZA 4GX4A 1KZ8A 1NV2A 1YYZA 3QMFA 4MJOA 5I3SA 1FPGA 1NV7A 1KA0A 1FTAA 4GX3A 5F24A 1VDWA 2QVUA 1FPBA 2HHMA 4AS4A 1G0HA 2PCRA 5ET5A 5ET6A 5A5LA 5IZ3B 2WBDA 1EYKA 5EQAA 1FBPA 2QFLA 4GWUA 1FPKA 2FIEA 5J16A 1NV3A 5EYGA 1JP4A 5EQ7A 2OX3A 1NV0A 2FHYA 1NI9A 1YXIA 1FJ9A 1KA1A 1IMFA 1FRPA 4GWXA 1NUYA 4HE1A 3FBPA 1NV1A 5FBPA 1FBHA 2OWZA 4GBWA 1NV5A 1FBGA 2CZKA 4QXDA 5DW8A 1LBVA 1FBFA 1EYJA 1K9YA 4GWWA 2WEFA 1LBYA 3RPLA 3KC0A 3KBZA 2BJIA 1INPA 1Q9DA 2Q74A 2QVRA 3LV0A 5EYHA 3A29A 1IMCA 2WBBA 1NUWA 5ESYA 1FBEA 4I3EA 1YZ0A 1IMDA 4FBPA 1XI6A 1NV6A 4PTKA 1RDXA 1IMBA 1FBDA 2FIXA 2GQ1A 5ET7A 1NV4A 5T3JA 3KC1A 2JJKA 4H46A 1RDYA 1EYIA 3BIHA 4H45A 5IZ3A 1SPIA 1K9ZA 1RDZA 1FSAA 2QVVA 5EQ8A 1QGXA 3IFAA 4N81A 4HXVA 4AS5A 4GBVA 2P3VA 4GWYA 4G61A 1LEVA 1D9QA 1LBXA 2FVZA 4IR8A 1DCUA 3D1RA 4GWSA 5ET8A 1IMEA 3BIGA 1LBWA 2P3NA 3T0JA 4I3YA 5LDZA 1DK4A 4I40A 4KXPA 2DDKA 1IMAA 4GWZA 5EQ9A 2Y5KA
chains in the Genus database with same CATH superfamily
2UVIA 5KDTB 1FPIA 5L9MA 3HV1A 4JVIA 1B7HA 3TTNA 2O7IA 4THIA 4Z0IA 2FBPA 1ZTYA 4YB5A 4OQOA 3UGWA 1FTOA 4EDPA 1ZBMA 5F24A 4UA8A 3U1OA 3UK4A 3N94A 5I2NB 1SW1A 5IZ3B 3K0VA 3JYRA 3ILUB 1QUJA 5J16A 2HAVA 2I48A 4NGUA 4NWCA 4MAGA 1KA1A 4OVRA 4OTEA 3O6HA 2I58A 1LGBC 5FTIA 2VPOA 3MP6A 2ZNUA 3UP9A 1TFAA 3RPWA 1IITA 2QVRA 4RY1A 3A29A 4H1XA 3VDFA 4PBHA 2XXYA 3TZAA 3VXBA 2M8CA 3MC2A 5J1DA 4OFJA 5EHSA 2I3WA 2O1LA 3CG3A 1OMPA 5KDTA 1B40A 3MUQA 1B0LA 3IFAA 4GWOA 5K2YA 5I5PA 4G61A 1D9QA 1B58A 1RYOA 3VE1B 4O3AA 4OVPA 3USDA 4E0WA 3RGYA 1JW4A 4I40A 2ZYOA 3FJGA 4XEQA 2F7BA 1TT1A 5B7DA 4OVTA 4PFUA 4G8HA 1I6QA 2XXIA 1FBCA 2HZLA 4E0XA 5I2NA 4C1TA 3L6GA 5I2KB 4OXVA 2PVUA 4R72A 1DTZA 1ELJA 4I62A 4EF2A 2OPDA 2MKZA 4GD5A 4OVQA 3CSBA 4QF9A 2THIA 3H4ZA 5AA3A 1R9QA 3TQLA 1LBCA 4AS4A 3KN3A 4OVSA 4KYDA 2QS1A 3MBPA 3PPPA 3TELA 4F1VA 4XXUA 3MSTA 2ZZVA 4GWXA 3U93A 4GBWA 4P47A 4I1DA 4ELOA 1P1WA 1K9YA 3HSTA 1Y1ZA 3C34A 4FAJA 3RPLA 4F3SA 2PMSA 1POTA 2BJIA 2CMOA 4PAFA 4MLVA 5TPAA 2DQVA 5CMMA 2A5SA 1A40A 1RDXA 4ZEFA 3ZS6A 3KSJA 2DWAA 2UYFA 2F6PA 4IO4A 2QVVA 1TWYA 2OZZA 3H6TA 4H65A 1B4ZA 4HXVA 1A8FA 3TTRA 1LEVA 5A5XA 1M5BA 3IB1A 2HXWA 2ONSA 3IO4A 5ITOA 1URDA 1Z7NE 4QRZA 3K6UA 5ET5A 4YKPA 3C32A 3BBRA 4HE2A 3TPAA 1N84A 4ZE9A 4PC9A 3K1MA 1YTVA 3H7MA 4G8NA 5LOMA 2RKMA 2RC9A 3OELA 4Q5TA 3N6TA 1VDWA 1PB7A 3FUZA 3F11A 2WBDA 3OOAA 3IOVA 5AA2B 3CVGA 3MW0A 3C33A 3H6UA 1MDQA 1DPPA 2FIEA 4F39A 5EYGA 5DT6A 1PDAA 5H8SA 1SVXB 4BDOA 4F3GA 4LP2B 1MY1A 4P11A 4GRKA 4QXDA 4GFRA 2P2AA 5H8HB 4U1ZA 3SKPA 3KC0A 5ISUA 1KWHA 5I59B 2I6EA 4I3EA 5IAIA 4EF1A 4PTKA 1SD3A 4F2QA 4PCDA 4GQOA 2ZYMA 2DSFA 3KC1A 4XKPA 2KLFA 4QFLA 3TODA 1QGXA 3IO6A 2DS9A 2DVCA 4U23A 4XTCQ 5I58A 4QFOA 3S4UA 1Y4TA 4IR8A 1NNFA 1IUDA 1LBWA 4MFIA 1OLAA 4FEDA 2GH9A 4YMAA 4ZS9A 3EF7A 4GWZA 4XKNA 1YCJA 3OD7A 2VT5A 3FXBA 5IZ1A 1MXVA 3PUXE 5AA2A 1OIBA 1SI1A 2XXUA 2HZKA 3OO8A 3CIJA 3HFUA 3KEIA 3G3KA 2FYIA 3ZSFA 5FHOA 1AMFA 1MXWA 3FV2A 2Q8JA 2XX8A 4G8MA 3K01A 2AL5A 4NF4B 4N15A 1P1QA 2VD2A 1CB6A 1DPEA 4JB7A 1MPBA 1N0TA 2R9JA 2XXWA 4MEVA 1B51A 3B6QA 4G77A 2OWZA 2OBGA 5K2XA 3IOUA 2UYEA 3PPRA 2F78A 1VR5A 1NKXA 2Q74A 4R2BA 4JWXA 3RTWB 1LFHA 1NUWA 1SQYA 4OEUA 3LSFB 3SDFA 1IMDA 1B1XA 4YAHX 3SETA 3D4CA 2QPQA 5EHMA 2RC8A 4U4XA 4WKMA 5L9SA 3BIHA 4P1EA 3K1NA 3H6VA 4PDHA 2OCUA 3FXQA 4ESWA 5H8QA 2Y7PA 5CC2A 3GBAA 4ELPA 2KQZA 1F9BA 1LAHE 3VXCA 3TCHA 3LUZA 1RKMA 2R8TA 3PTYA 3MZ9A 4EQ9A 1S9TA 5CMKA 1Y4CA 2VD3A 4NF6B 1NV2A 3E9XA 4PGPA 3KFMA 5TP9B 3TFLA 4OETA 1G0HA 2PCRA 1M5FA 3OSRA 3NOHA 2B65A 2Z22A 3IAZA 1FQBA 3O6GA 2WYPA 3SEWA 3M3FA 3JV9A 1FRPA 4H5FA 3FJMA 2B3BA 2P0SA 3H03A 3PV0E 3TTKA 4NN3A 3IL1B 3VLWA 2V84A 1B4HA 4POWA 3SEUA 1AL3A 4PF8A 2UXAA 2FNCA 3CI8A 3FVKA 3LV0A 2WBBA 1R9LA 2O51A 5CI5A 3CRBA 1XS5A 2P1SA 3EQ1A 4U1OA 3VV5A 2RCBA 3PPOA 2XXXA 1II5A 2F34A 4OFLA 2OWSA 5HM4B 1D9YA 3N6UA 5L9OA 2F35A 4Q0CA 4BDQA 1XVXA 2XWVA 2DVZA 1N04A 4TLLB 3BIGA 3QYTA 3K00A 1LAGE 3DP6A 4G68A 2DDKA 3OO6A 4NF6A 4XFEA 3VLVA 4YU0A 1FPJA 4MCOA 4DZ1A 4IGRA 4FORA 2R71A 2DOJA 3B50A 2F36A 2QS4A 1DOTA 2O84X 2QL3A 4HE0A 4M4GA 3M3LA 4R6KA 1MQJA 1VSOA 3RY3A 4O7IA 4I9DA 1OLCA 3E4RA 4LATA 3CHGA 1FCKA 1UIVA 3HN0A 2ZXTA 2GRVA 1A7LA 4X1BA 1POY1 3LSXA 4OFOA 4F3BA 1JNFA 1EYKA 1Q35A 4XKRA 2F7AA 1B9JA 4RXLA 4JSDA 2O7UA 1DMBA 4DIGA 3PPNA 4K3FA 1USYE 2PT2A 1O64A 3QXMA 1N3WA 1YXIA 4KYSA 4O7MA 4M1VA 4P0GA 4JDFA 5BWJA 3DELB 4UABA 2REGA 2GHBA 4EUOA 1XC1A 1HSEA 1Y20A 4TQUQ 2F6GA 5AA1A 3PUZE 1A99A 4LA9A 3RT8A 4P3LA 3OXNA 4ZEDA 4F29A 3OEMA 1PC3A 1MPCA 3O28A 3H06B 2E1SA 2FA7A 3Q26A 2QMXA 3RUMA 3S9LC 1SYIA 1Y3PA 2D5WA 5F1QA 1QUIA 2X26A 3K6WA 5EQ8A 4BLAA 3PPQA 3FD3A 2P3VA 1ATGA 3QAXA 4DDDA 1M5EA 2XA5A 4I3YA 3SERA 1EZOA 2Y5KA 4RPOA 1PEBA 4ECFA 1CNQA 3FVGA 4H0WA 3IFCA 3Q29A 3RPLB 3KZGA 1T0KA 3MZ1A 4ZZAA 3GZGA 5TPAB 2VGQA 4EXKA 3SEXA 4R6YA 3QMFA 3PMWA 4UACA 4GX3A 2QJEA 4O3BA 4TOZA 3TCGA 2XD3A 1ZLQA 4N07A 1FPBA 4GXSB 3SEYA 5ITPA 1P1UA 1TFDA 3MAMA 4H5GA 4IY5A 1FBPA 4MF3A 2DWIA 2RCAA 5A5XB 3EPEA 3Q25A 3O9PA 5CRYA 2F8DA 3RN8A 1NI9A 4ND9A 4OZ9A 5LTCA 3UA8A 3UN6A 3V83A 1I6BA 2XXTA 4KYEA 2PX1A 2XXPA 2WKYA 4GWWA 2V25A 3TYHA 1LLSA 5AA4A 1Q9DA 4ONYA 1URSA 1BIYA 4JXIA 3THIA 3QUFA 3MVZA 1LCTA 3CFLA 4QHQA 2ZMBA 2A5TA 1FBDA 3LR1A 4NE4A 2XXRA 1HSLA 2V3QA 1UTHA 2DXRA 1S7YA 3VVDA 4FECA 3KG2A 4GBVA 2H4IA 3A3CA 2Y7IA 1DCUA 3D1RA 4GWSA 2Q89A 2Y7KA 4OESA 2CEXA 1LFIA 1MG1A 1YPNA 2RINA 2Y5LA 3QIMA 4DXUA 1GGGA 1JEVA 5HBCA 1Y1MA 1MQGA 3ILTB 1FPLA 3KN8A 4MIJA 1J1NA 1MXXA 3ROJA 1QJMA 3G3GA 3SESA 1P1OA 3T96B 2DWHA 2QVUA 1UIUA 3ZKKA 1MY2A 4GL8A 1BTJA 1MS7A 2X7PA 3EHSA 5I58B 3TDJA 2REJA 4R73A 1FQCA 3SEVA 1XT8A 4Z7EA 1FJ9A 4NF8A 4BDRA 3PUYE 4HCWA 3N5LA 4JSOA 5IKBA 1FBGA 3KOSA 1EYJA 2OWTA 2VHAA 5H8NA 4F18A 3RNNA 3FATA 2G29A 1LBYA 2QMWA 4QFKA 4HS7A 4PFRA 4LN5A 1BKAA 5ESYA 3IB0A 3LC8A 2XXKA 4OMBA 2DE4A 4PP0A 4F22A 4YICA 1US4A 4BDMA 5ICTA 4N81A 4AS5A 1LFGA 5I56A 4OEVA 4X04A 3H3GA 3K02A 1UTBA 2P3NA 2QRYA 5LDZA 2XWKA 3Q27A 3K2DA 4GL0A 2XX9A 4F2OA 1OQGA 4FJPA 1H43A 1FQFA 2F7CA 4N13A 1NUXA 1ZU0A 1L5TA 1AWBA 4PAKA 3KGCA 1JETA 2F3BA 2QS3A 2CZIA 5H8FA 1MXYA 5KCJB 2Y84A 5I57A 3MYUA 3K1PA 4JBZA 5I3SA 1Y3NA 3KJ7A 4LQ2A 1NNTA 1JW1A 3EKIA 4WEPA 1SDXA 5F7VA 4AB5A 1JVYA 4F1UA 2I0BA 1B3FA 2ZNSA 3TTMA 3BFTA 4ZEIA 3T66A 3C4MA 3S9EA 3C31A 4R6HA 1NUYA 3KBRA 2I4BA 4HE1A 3UIFA 1USYH 3ODBA 4N6PA 5H8QB 3T22A 5DW8A 1OQHA 4O3CA 3IOWA 5L8DA 3VLUA 1MY4A 3FASA 2ONRA 4I8CA 1HSJA 1PBPA 4GF8A 2E0SA 1LAFE 4KCDA 4NWDA 2KR0A 1DSNA 1LB9A 1P99A 2G93A 1IEJA 2V93A 2H99A 3U94A 2JJKA 1B32A 4LZ7A 4LVQA 3RT6B 1ANFA 1NMUA 1FSAA 4KQPA 1P1NA 5TU0A 2B3FA 3LUYA 1B3HA 1NH8A 2H9BA 1Y9UA 5ICQA 3RQTA 3L6HA 5KCJA 3UORA 5CMBA 4H8JA 3LSLA 3I3VA 2OK2A 3T9XB 4TLMB 1QW0A 4POXA 5DTBA 1FPFA 4NMYA 3VVFA 3PUWE 4WXJA 4DXBA 4R9FA 1BK4A 1FJ6A 4DCYA 3KOTA 1B3EA 2V4CA 4N91A 2UVHA 2PYYA 2D3IA 4ELRA 2O69A 1XHYA 3G7WA 4QSDA 3CR9A 5JK4A 2XHDA 3FIRA 1BP5A 2L5VA 1B5HA 2OX3A 4FIMA 1US5A 2I4CA 3T1BA 1MXUA 3O29A 2FHYA 4G68B 3GXAA 3E78A 1IMFA 2RC7A 5JTYB 4MNIA 1FQAA 1FTKA 2PT1A 3QUJA 3VVEA 4N8GA 4JVCA 2WEFA 1MPDA 3HHFA 2HFBA 3G3JA 1YAEA 3IR1A 1YZ0A 5DEXA 3IJOB 1NV6A 1CE2A 3K4UA 5ET7A 1B46A 2Y7WA 2Q2AA 1H45A 4QSCA 4YKIA 4HW8A 1RYXA 1B5IA 4DE8A 1JW5A 2IA4A 4NHBA 2ONKE 3ZKLA 1D3KA 1GTKA 2D21A 3FZVA 2R6GE 2QSXA 3I6VA 3V8XB 1MM7A 2YPNA 4FE8A 3FJ7A 3FVOA 4YMBA 2I0CA 3A3UA 2ALUA 2GFEA 4N6KA 1WODA 3MZBA 1IXGA 2V3UA 4KPTA 1AIVA 2Z8EA 4DXCA 5DVIA 4GX4A 2AYSA 1IQ7A 5JTYA 1S50A 3PMXA 2HHMA 5A5LA 5CBSA 4IY6A 2VOZA 5AA2D 4RA1A 1SW5A 4GWUA 4MNCA 4XIGQ 5BUUA 3CSGA 1NV3A 1MXZA 4F1YA 4P1LA 3W9WA 1OVTA 3G3HA 1FW0A 1D9VA 2YLNA 1MQHA 1LBBA 2O1MA 4XF5A 1NV5A 1A55A 4OWDA 3ECRA 3M8UA 4X1DA 2RF1A 2DE2A 2AIXA 1MH3A 1PB9A 3HPIA 4NG7A 2HPGA 5CBRA 5EYHA 3O97A 1IMCA 1ZJLA 3P7IA 2I49A 3BKIB 4ZEKA 3TAJA 4NF5A 1JEUA 2IEEA 4NTLA 4DLDA 5DYHA 5IGAA 2ZYNA 4PBQA 1RDYA 3W9VA 1IXCA 1QKAA 3IB2A 1JVXA 4PQJA 1LBXA 4ZEBA 5KZTA 4EXLA 4ZE8A 4GVOA 1B05A 1EU8A 1B5JA 4H8IA 3VFJA 4RK2A 5AA4B 2Q8MA 1B2HA 5CMCA 2O6AA 2F3DA 3B8BA 1H76A 4PE3A 1MM6A 3FGSA 4ZZEA 1TXFA 3E79A 3QSLA 4G68C 4LQ5A 1YYZA 2A5TB 3O66A 3S2VA 4OANA 5IZZA 1IXHA 1UTHB 2F97A 4Q8RA 4DCXA 4YKJA 2Z23A 4QFNA 1VE4A 3TMGA 1O7TA 2HEUA 2DYXA 3EN3A 3OEKA 1B52A 3KN7A 3V5AA 1NV0A 1BLFA 4XKQA 3TTLA 4RNSA 1LAXA 1B3GA 4PDDA 1R1NA 3TUSA 1AH5A 3PU5A 3LBSA 4KCCA 4DI3D 1FBFA 4RYAA 3QK6A 4IO5A 1INPA 4X8RA 1IZ1A 2DXYA 2Q9TA 4RJZA 1FQEA 2GQ1A 4G2ZA 2Z8FA 4NQ8A 1PBQA 4H45A 5IZ3A 4KHZE 1RDZA 3RTFB 4YB6A 3EHUA 4U22A 3OMBA 4GWYA 4PFWA 4O8MA 1AOVA 4NF8B 5ET8A 5CM6A 2F5XA 4JWOA 3D4GA 4HTGA 1PB8A 3ONMA 3ISPA 4P56A 3CFXA 5H8NB 1NH7A 1XVYA 2B4LA 5AE4A 3IORA 3GYYA 2VPNA 4YKKA 1DBZA 3MVXA 4IO3A 2OPEA 3RLFE 4Q30B 1MQIA 2ABHA 1KA0A 1O63A 1QUKA 3B6TA 4EQ7A 2Q2CA 3U92A 3KSXA 4N8YA 1ZKBA 1QVSA 4QSEA 5I56B 4GLIA 1JP4A 4R2FA 1UTBB 1I6AA 1EZPA 1MDP1 1JQFA 4U4SA 4L17A 5I7IA 4C0RA 3E3KA 3CG1A 4GOTA 2CZKA 2H25A 1B1HA 1M5DA 4ZECA 4NAPA 1WVJA 1IXIA 3OO9A 4LZ5A 4N17A 1ZMGA 5H8FB 1WDNA 3KBZA 1D4NA 2OJTA 5I2KA 4QFPA 3HCQA 1A8EA 4MNPA 5I57B 4ZDMA 1FTLA 4LZ8A 2ZZWA 3K6VA 4FBPA 3OSQA 3MPLA 4X9TA 3R7XA 2FIXA 2NXOA 4PFYA 2XWIA 1N3XA 1I69A 2PFYA 3G3IA 4P8BA 2HCAA 4R9GA 2FVZA 3U8QA 2ZZXA 4PAIA 1SI0A 2LAOA 4KXPA 3G3FA 4FEBA 2XD2A 1NUZA 2BJJX 4X48A 5FHNA 4OENA 2HQ0A 3I5OA 4GX6A 2OLBA 3O2AA 5IM2A 2HAUA 4KD5A 4EQBA 3C35A 4G4PA 4GXAA 3MP8A 3PGFA 4QBAA 1NV7A 5M2VA 3MVWA 1MY3A 1DTGA 3DM0A 1B6HA 1ZIUA 5ET6A 3FVNA 4OA4A 3MQ9A 3S9NC 1N76A 5EQAA 2DE3A 3MWBA 4OHNA 4OVJA 4PFBA 3A09A 3TQWA 5B70A 4MX6A 3SZPA 2HXRA 1NNPA 3B7DA 5EQ7A 3LSWA 3M3KA 3S9MC 1IIWA 4BDLA 1MY0A 1QKBA 3FBPA 1URGA 2XXHA 3BFUA 1FBHA 3K6XA 4KR5A 3Q28A 4MBPA 5DVJA 4YZZA 3N26A 4LONB 2DP8A 2NWJA 4R74A 3KJTA 1B0HA 4H6DA 3WAEA 1B7UA 3FXRA 3MVYA 2XX7A 3R6UA 3OENA 2YJPA 1FBEA 3EHTA 2XWOA 1XI6A 1N7XA 1Y3QA 1SBPA 3IX1A 1IMBA 3R26A 4BDNA 1EYIA 1SPIA 1K9ZA 2VP1A 1SYHA 4PE5B 5DVFA 2XXVA 1MH4A 1A54A 3T0JA 3PD8A 4OERA 3H6WA 5ELVA 2XXQA 2NOOA 4F3PA 3FXUA 1GVCA 3TKDA 2O68A 1FPDA 1GR2A 1NFTA 1UQWA 3GBBA 5H8HA 2ESNA 1B3LA 4P9KA 1FPEA 2V3TA 4RK9A 3GLBA 1G0IA 4IB2A 1Z7ME 2CZHA 4IGTA 5DEXB 5I59A 1KZ8A 1SW4A 3U72A 3IOTA 5FTHA 4MJOA 1SW2A 2ZYKA 3U65A 3HO7A 1VFDA 1MRPA 2Y7RA 2QFLA 4U2RA 3AXFA 4KI0E 4FATA 3FV1A 2CZLA 4GIZA 4N6DA 2I3VA 3DP4A 4ESXA 2WYKA 2B4MA 2WX9A 1LBVA 2W7YA 1NNKA 4NEDA 4MLQA 4MHFA 4F31B 3IJXB 3TEPA 3DP8A 3PD9A 5FHMA 3IK6B 3JZJA 4C1UA 1VFEA 3T9UA 4JWYA 4JVDA 1B7ZA 4PGNA 3E13X 1NV4A 4NF0A 4H46A 2AL4A 4OYVA 4N4UA 4PETA 4NF4A 4F19A 1OVBA 3C36A 4YB7A 3WAFA 2PFZA 2ZNTA 1DK4A 1LSTA 1XOCA 5EQ9A 2UVJA 3HHGA 5EYFA 2NVUB 3PUVE 1EZ9A 1FTMA 3OO7A 4RPNA 1H44A 4MMPA 3MP1A 5HPQA 2Q88A 3TCFA 2Z8DA 3T93B 3RYDA 4DI4B 1LBZA 1NL5A 4IO2A 4NX1A 4NF5B 1FPGA 1FTAA 1GV8A 4IO7A 1Q1KA 2H98A 4ISUA 4PFTA 4P0IA 1LCFA 3W15C 1FPKA 1FTJA 2H5YA 4PF6A 2NUVA 4H67A 3C9HA 1N7WA 5JEIA 3DLNA 3B6WA 2PBWA 1QULA 4LUBA 5I84A 2DWJA 3T9VA 4IO6A 1NV1A 3PMVA 5FBPA 2X7QA 2UVGA 3CFZA 3MPKA 4O94A 4HCYA 3O6IA 1LB8A 1FQDA 4PFIA 1M5CA 3T9HB 1EH3A 4ELQA 4AB6A 1H3DA 5T3JA 5TP9A 2QS2A 4WEDA 1MQDA 4KFQA 3MJNA 3V89B 4R75A 4U21A 2CEYA 1R6ZA 1IMEA 4MH5A 2ANJA 2GHAA 1IMAA 4AQ4A
chains in the Genus database with same CATH topology
1NUXA 1AWBA 4PAKA 1FPIA 2B4LA 2KQZA 4JVIA 2F3BA 3GYYA 2VPNA 3LUZA 1DBZA 2CZIA 2R8TA 3PTYA 2FBPA 1NV2A 3MYUA 4PGPA 5I3SA 1KA0A 5F24A 3EKIA 1G0HA 2PCRA 5IZ3B 4F1UA 4N8YA 3NOHA 5J16A 1JP4A 4NGUA 2WYPA 4MAGA 1KA1A 1FRPA 5I7IA 1NUYA 4OVRA 4HE1A 4NN3A 2CZKA 5DW8A 4NAPA 2VPOA 4N17A 4PF8A 3KBZA 2QVRA 4MNPA 3LV0A 3A29A 4PBHA 2WBBA 2KR0A 2ZZWA 4FBPA 5J1DA 4X9TA 2FIXA 2JJKA 2XWIA 1FSAA 3IFAA 2PFYA 2XWVA 4P8BA 5I5PA 4G61A 1D9QA 2FVZA 2DVZA 4OVPA 3BIGA 2ZZXA 4PAIA 4I40A 4KXPA 2DDKA 4XEQA 4XFEA 4OVTA 1FPJA 4MCOA 1NUZA 1FBCA 3B50A 2HZLA 4HE0A 1FPFA 4GX6A 5IM2A 1BK4A 1FJ6A 4O7IA 2MKZA 2V4CA 3CHGA 4OVQA 4N91A 1NV7A 4QBAA 4AS4A 4OA4A 5ET6A 4OVSA 5JK4A 1EYKA 5EQAA 2DE3A 2L5VA 4PFBA 4MX6A 3SZPA 2HXRA 5EQ7A 2OX3A 3T1BA 4F1VA 2FHYA 1YXIA 3MSTA 1IMFA 2ZZVA 3E78A 4GWXA 4MNIA 4O7MA 4M1VA 3FBPA 1FBHA 4N8GA 4GBWA 4P47A 4UABA 1K9YA 4JVCA 4YZZA 2WEFA 3RPLA 2BJIA 4P3LA 4PAFA 1FBEA 1YZ0A 2XWOA 1XI6A 1NV6A 1RDXA 1IMBA 5ET7A 1EYIA 1SPIA 1K9ZA 2QVVA 5EQ8A 4NHBA 4HXVA 2P3VA 1LEVA 3T0JA 2XA5A 4I3YA 5ET5A 2Y5KA 4HE2A 1CNQA 4N6KA 1FPDA 3IFCA 4PC9A 3RPLB 4P9KA 1FPEA 1G0IA 2CZHA 4GX4A 1KZ8A 3QMFA 4MJOA 4GX3A 1VDWA 3U65A 1FPBA 2HHMA 5A5LA 2WBDA 1FBPA 2QFLA 4GWUA 4MNCA 2FIEA 1NV3A 5EYGA 4P1LA 4N6DA 1NI9A 3W9WA 5LTCA 2WYKA 2B4MA 4XF5A 1NV5A 2WX9A 4QXDA 1LBVA 4GWWA 2DE2A 3KC0A 4MHFA 4NG7A 2HPGA 1Q9DA 5EYHA 1IMCA 4I3EA 4PTKA 4JVDA 4PGNA 1FBDA 4PCDA 1NV4A 4NF0A 5IGAA 3KC1A 2V3QA 4PBQA 4H46A 1RDYA 3W9VA 1QGXA 4GBVA 4N4UA 4PETA 4F19A 1LBXA 4IR8A 1DCUA 3D1RA 4GWSA 1IMAA 1LBWA 2PFZA 1DK4A 2CEXA 4GWZA 5EQ9A 2Y5LA 4MMPA 2Q8MA 2VT5A 3FXBA 1FPLA 5IZ1A 4MIJA 2F3DA 3B8BA 4PE3A 3ROJA 2HZKA 3E79A 3RYDA 4DI4B 1LBZA 3HFUA 4NX1A 1YYZA 1FPGA 1FTAA 4OANA 2QVUA 5IZZA 1FPKA 4N15A 4PF6A 1NV0A 4MEVA 1FJ9A 4HCWA 4PDDA 1NV1A 5FBPA 2OWZA 1FBGA 4DI3D 1FBFA 1EYJA 4F18A 1LBYA 4O94A 4PFRA 4X8RA 1INPA 4HCYA 2Q74A 4LN5A 4PFIA 1NUWA 5ESYA 2XXKA 1IMDA 2Q9TA 2DE4A 2GQ1A 2QPQA 5T3JA 4YICA 4NQ8A 3BIHA 4H45A 5IZ3A 1RDZA 4P1EA 4N81A 4AS5A 4GWYA 2CEYA 4X04A 4O8MA 5CM6A 1IMEA 2F5XA 2P3NA 5LDZA 2XWKA 3ISPA 5ET8A 4P56A 4PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPJ A;  4HE2 A;  1NUZ A;  1FBC A;  1NUX A;  2Y5L A;  1AWB A;  1CNQ A;  1FPI A;  1FPD A;  3IFC A;  2Q8M A;  3RPL B;  4HE0 A;  2VT5 A;  2F3B A;  1FPF A;  1FPL A;  5IZ1 A;  1FPE A;  3LUZ A;  2F3D A;  3B8B A;  1DBZ A;  2CZI A;  2R8T A;  4GX6 A;  1G0I A;  3ROJ A;  1BK4 A;  1FJ6 A;  2CZH A;  2FBP A;  3RYD A;  4O7I A;  1LBZ A;  4GX4 A;  1KZ8 A;  1NV2 A;  1YYZ A;  3QMF A;  4MJO A;  5I3S A;  1FPG A;  1NV7 A;  1KA0 A;  1FTA A;  4GX3 A;  5F24 A;  1VDW A;  2QVU A;  1FPB A;  2HHM A;  4AS4 A;  1G0H A;  2PCR A;  5ET5 A;  5ET6 A;  5A5L A;  5IZ3 B;  2WBD A;  1EYK A;  5EQA A;  1FBP A;  2QFL A;  4GWU A;  1FPK A;  2FIE A;  5J16 A;  1NV3 A;  5EYG A;  1JP4 A;  5EQ7 A;  2OX3 A;  1NV0 A;  2FHY A;  1NI9 A;  1YXI A;  1FJ9 A;  1KA1 A;  1IMF A;  1FRP A;  4GWX A;  1NUY A;  4HE1 A;  3FBP A;  1NV1 A;  5FBP A;  1FBH A;  2OWZ A;  4GBW A;  1NV5 A;  1FBG A;  2CZK A;  4QXD A;  5DW8 A;  1LBV A;  1FBF A;  1EYJ A;  1K9Y A;  4GWW A;  2WEF A;  1LBY A;  3RPL A;  3KC0 A;  3KBZ A;  2BJI A;  1INP A;  1Q9D A;  2Q74 A;  2QVR A;  3LV0 A;  5EYH A;  3A29 A;  1IMC A;  2WBB A;  1NUW A;  5ESY A;  1FBE A;  4I3E A;  1YZ0 A;  1IMD A;  4FBP A;  1XI6 A;  1NV6 A;  4PTK A;  1RDX A;  1IMB A;  1FBD A;  2FIX A;  2GQ1 A;  5ET7 A;  1NV4 A;  5T3J A;  3KC1 A;  2JJK A;  4H46 A;  1RDY A;  1EYI A;  3BIH A;  4H45 A;  5IZ3 A;  1SPI A;  1K9Z A;  1RDZ A;  1FSA A;  2QVV A;  5EQ8 A;  1QGX A;  3IFA A;  4N81 A;  4HXV A;  4AS5 A;  4GBV A;  2P3V A;  4GWY A;  4G61 A;  1LEV A;  1D9Q A;  1LBX A;  2FVZ A;  4IR8 A;  1DCU A;  3D1R A;  4GWS A;  5ET8 A;  1IME A;  3BIG A;  1LBW A;  2P3N A;  3T0J A;  4I3Y A;  5LDZ A;  1DK4 A;  4I40 A;  4KXP A;  2DDK A;  1IMA A;  4GWZ A;  5EQ9 A;  2Y5K A; 
#chains in the Genus database with same CATH topology
 2UVI A;  5KDT B;  1FPI A;  5L9M A;  3HV1 A;  4JVI A;  1B7H A;  3TTN A;  2O7I A;  4THI A;  4Z0I A;  2FBP A;  1ZTY A;  4YB5 A;  4OQO A;  3UGW A;  1FTO A;  4EDP A;  1ZBM A;  5F24 A;  4UA8 A;  3U1O A;  3UK4 A;  3N94 A;  5I2N B;  1SW1 A;  5IZ3 B;  3K0V A;  3JYR A;  3ILU B;  1QUJ A;  5J16 A;  2HAV A;  2I48 A;  4NGU A;  4NWC A;  4MAG A;  1KA1 A;  4OVR A;  4OTE A;  3O6H A;  2I58 A;  1LGB C;  5FTI A;  2VPO A;  3MP6 A;  2ZNU A;  3UP9 A;  1TFA A;  3RPW A;  1IIT A;  2QVR A;  4RY1 A;  3A29 A;  4H1X A;  3VDF A;  4PBH A;  2XXY A;  3TZA A;  3VXB A;  2M8C A;  3MC2 A;  5J1D A;  4OFJ A;  5EHS A;  2I3W A;  2O1L A;  3CG3 A;  1OMP A;  5KDT A;  1B40 A;  3MUQ A;  1B0L A;  3IFA A;  4GWO A;  5K2Y A;  5I5P A;  4G61 A;  1D9Q A;  1B58 A;  1RYO A;  3VE1 B;  4O3A A;  4OVP A;  3USD A;  4E0W A;  3RGY A;  1JW4 A;  4I40 A;  2ZYO A;  3FJG A;  4XEQ A;  2F7B A;  1TT1 A;  5B7D A;  4OVT A;  4PFU A;  4G8H A;  1I6Q A;  2XXI A;  1FBC A;  2HZL A;  4E0X A;  5I2N A;  4C1T A;  3L6G A;  5I2K B;  4OXV A;  2PVU A;  4R72 A;  1DTZ A;  1ELJ A;  4I62 A;  4EF2 A;  2OPD A;  2MKZ A;  4GD5 A;  4OVQ A;  3CSB A;  4QF9 A;  2THI A;  3H4Z A;  5AA3 A;  1R9Q A;  3TQL A;  1LBC A;  4AS4 A;  3KN3 A;  4OVS A;  4KYD A;  2QS1 A;  3MBP A;  3PPP A;  3TEL A;  4F1V A;  4XXU A;  3MST A;  2ZZV A;  4GWX A;  3U93 A;  4GBW A;  4P47 A;  4I1D A;  4ELO A;  1P1W A;  1K9Y A;  3HST A;  1Y1Z A;  3C34 A;  4FAJ A;  3RPL A;  4F3S A;  2PMS A;  1POT A;  2BJI A;  2CMO A;  4PAF A;  4MLV A;  5TPA A;  2DQV A;  5CMM A;  2A5S A;  1A40 A;  1RDX A;  4ZEF A;  3ZS6 A;  3KSJ A;  2DWA A;  2UYF A;  2F6P A;  4IO4 A;  2QVV A;  1TWY A;  2OZZ A;  3H6T A;  4H65 A;  1B4Z A;  4HXV A;  1A8F A;  3TTR A;  1LEV A;  5A5X A;  1M5B A;  3IB1 A;  2HXW A;  2ONS A;  3IO4 A;  5ITO A;  1URD A;  1Z7N E;  4QRZ A;  3K6U A;  5ET5 A;  4YKP A;  3C32 A;  3BBR A;  4HE2 A;  3TPA A;  1N84 A;  4ZE9 A;  4PC9 A;  3K1M A;  1YTV A;  3H7M A;  4G8N A;  5LOM A;  2RKM A;  2RC9 A;  3OEL A;  4Q5T A;  3N6T A;  1VDW A;  1PB7 A;  3FUZ A;  3F11 A;  2WBD A;  3OOA A;  3IOV A;  5AA2 B;  3CVG A;  3MW0 A;  3C33 A;  3H6U A;  1MDQ A;  1DPP A;  2FIE A;  4F39 A;  5EYG A;  5DT6 A;  1PDA A;  5H8S A;  1SVX B;  4BDO A;  4F3G A;  4LP2 B;  1MY1 A;  4P11 A;  4GRK A;  4QXD A;  4GFR A;  2P2A A;  5H8H B;  4U1Z A;  3SKP A;  3KC0 A;  5ISU A;  1KWH A;  5I59 B;  2I6E A;  4I3E A;  5IAI A;  4EF1 A;  4PTK A;  1SD3 A;  4F2Q A;  4PCD A;  4GQO A;  2ZYM A;  2DSF A;  3KC1 A;  4XKP A;  2KLF A;  4QFL A;  3TOD A;  1QGX A;  3IO6 A;  2DS9 A;  2DVC A;  4U23 A;  4XTC Q;  5I58 A;  4QFO A;  3S4U A;  1Y4T A;  4IR8 A;  1NNF A;  1IUD A;  1LBW A;  4MFI A;  1OLA A;  4FED A;  2GH9 A;  4YMA A;  4ZS9 A;  3EF7 A;  4GWZ A;  4XKN A;  1YCJ A;  3OD7 A;  2VT5 A;  3FXB A;  5IZ1 A;  1MXV A;  3PUX E;  5AA2 A;  1OIB A;  1SI1 A;  2XXU A;  2HZK A;  3OO8 A;  3CIJ A;  3HFU A;  3KEI A;  3G3K A;  2FYI A;  3ZSF A;  5FHO A;  1AMF A;  1MXW A;  3FV2 A;  2Q8J A;  2XX8 A;  4G8M A;  3K01 A;  2AL5 A;  4NF4 B;  4N15 A;  1P1Q A;  2VD2 A;  1CB6 A;  1DPE A;  4JB7 A;  1MPB A;  1N0T A;  2R9J A;  2XXW A;  4MEV A;  1B51 A;  3B6Q A;  4G77 A;  2OWZ A;  2OBG A;  5K2X A;  3IOU A;  2UYE A;  3PPR A;  2F78 A;  1VR5 A;  1NKX A;  2Q74 A;  4R2B A;  4JWX A;  3RTW B;  1LFH A;  1NUW A;  1SQY A;  4OEU A;  3LSF B;  3SDF A;  1IMD A;  1B1X A;  4YAH X;  3SET A;  3D4C A;  2QPQ A;  5EHM A;  2RC8 A;  4U4X A;  4WKM A;  5L9S A;  3BIH A;  4P1E A;  3K1N A;  3H6V A;  4PDH A;  2OCU A;  3FXQ A;  4ESW A;  5H8Q A;  2Y7P A;  5CC2 A;  3GBA A;  4ELP A;  2KQZ A;  1F9B A;  1LAH E;  3VXC A;  3TCH A;  3LUZ A;  1RKM A;  2R8T A;  3PTY A;  3MZ9 A;  4EQ9 A;  1S9T A;  5CMK A;  1Y4C A;  2VD3 A;  4NF6 B;  1NV2 A;  3E9X A;  4PGP A;  3KFM A;  5TP9 B;  3TFL A;  4OET A;  1G0H A;  2PCR A;  1M5F A;  3OSR A;  3NOH A;  2B65 A;  2Z22 A;  3IAZ A;  1FQB A;  3O6G A;  2WYP A;  3SEW A;  3M3F A;  3JV9 A;  1FRP A;  4H5F A;  3FJM A;  2B3B A;  2P0S A;  3H03 A;  3PV0 E;  3TTK A;  4NN3 A;  3IL1 B;  3VLW A;  2V84 A;  1B4H A;  4POW A;  3SEU A;  1AL3 A;  4PF8 A;  2UXA A;  2FNC A;  3CI8 A;  3FVK A;  3LV0 A;  2WBB A;  1R9L A;  2O51 A;  5CI5 A;  3CRB A;  1XS5 A;  2P1S A;  3EQ1 A;  4U1O A;  3VV5 A;  2RCB A;  3PPO A;  2XXX A;  1II5 A;  2F34 A;  4OFL A;  2OWS A;  5HM4 B;  1D9Y A;  3N6U A;  5L9O A;  2F35 A;  4Q0C A;  4BDQ A;  1XVX A;  2XWV A;  2DVZ A;  1N04 A;  4TLL B;  3BIG A;  3QYT A;  3K00 A;  1LAG E;  3DP6 A;  4G68 A;  2DDK A;  3OO6 A;  4NF6 A;  4XFE A;  3VLV A;  4YU0 A;  1FPJ A;  4MCO A;  4DZ1 A;  4IGR A;  4FOR A;  2R71 A;  2DOJ A;  3B50 A;  2F36 A;  2QS4 A;  1DOT A;  2O84 X;  2QL3 A;  4HE0 A;  4M4G A;  3M3L A;  4R6K A;  1MQJ A;  1VSO A;  3RY3 A;  4O7I A;  4I9D A;  1OLC A;  3E4R A;  4LAT A;  3CHG A;  1FCK A;  1UIV A;  3HN0 A;  2ZXT A;  2GRV A;  1A7L A;  4X1B A;  1POY 1;  3LSX A;  4OFO A;  4F3B A;  1JNF A;  1EYK A;  1Q35 A;  4XKR A;  2F7A A;  1B9J A;  4RXL A;  4JSD A;  2O7U A;  1DMB A;  4DIG A;  3PPN A;  4K3F A;  1USY E;  2PT2 A;  1O64 A;  3QXM A;  1N3W A;  1YXI A;  4KYS A;  4O7M A;  4M1V A;  4P0G A;  4JDF A;  5BWJ A;  3DEL B;  4UAB A;  2REG A;  2GHB A;  4EUO A;  1XC1 A;  1HSE A;  1Y20 A;  4TQU Q;  2F6G A;  5AA1 A;  3PUZ E;  1A99 A;  4LA9 A;  3RT8 A;  4P3L A;  3OXN A;  4ZED A;  4F29 A;  3OEM A;  1PC3 A;  1MPC A;  3O28 A;  3H06 B;  2E1S A;  2FA7 A;  3Q26 A;  2QMX A;  3RUM A;  3S9L C;  1SYI A;  1Y3P A;  2D5W A;  5F1Q A;  1QUI A;  2X26 A;  3K6W A;  5EQ8 A;  4BLA A;  3PPQ A;  3FD3 A;  2P3V A;  1ATG A;  3QAX A;  4DDD A;  1M5E A;  2XA5 A;  4I3Y A;  3SER A;  1EZO A;  2Y5K A;  4RPO A;  1PEB A;  4ECF A;  1CNQ A;  3FVG A;  4H0W A;  3IFC A;  3Q29 A;  3RPL B;  3KZG A;  1T0K A;  3MZ1 A;  4ZZA A;  3GZG A;  5TPA B;  2VGQ A;  4EXK A;  3SEX A;  4R6Y A;  3QMF A;  3PMW A;  4UAC A;  4GX3 A;  2QJE A;  4O3B A;  4TOZ A;  3TCG A;  2XD3 A;  1ZLQ A;  4N07 A;  1FPB A;  4GXS B;  3SEY A;  5ITP A;  1P1U A;  1TFD A;  3MAM A;  4H5G A;  4IY5 A;  1FBP A;  4MF3 A;  2DWI A;  2RCA A;  5A5X B;  3EPE A;  3Q25 A;  3O9P A;  5CRY A;  2F8D A;  3RN8 A;  1NI9 A;  4ND9 A;  4OZ9 A;  5LTC A;  3UA8 A;  3UN6 A;  3V83 A;  1I6B A;  2XXT A;  4KYE A;  2PX1 A;  2XXP A;  2WKY A;  4GWW A;  2V25 A;  3TYH A;  1LLS A;  5AA4 A;  1Q9D A;  4ONY A;  1URS A;  1BIY A;  4JXI A;  3THI A;  3QUF A;  3MVZ A;  1LCT A;  3CFL A;  4QHQ A;  2ZMB A;  2A5T A;  1FBD A;  3LR1 A;  4NE4 A;  2XXR A;  1HSL A;  2V3Q A;  1UTH A;  2DXR A;  1S7Y A;  3VVD A;  4FEC A;  3KG2 A;  4GBV A;  2H4I A;  3A3C A;  2Y7I A;  1DCU A;  3D1R A;  4GWS A;  2Q89 A;  2Y7K A;  4OES A;  2CEX A;  1LFI A;  1MG1 A;  1YPN A;  2RIN A;  2Y5L A;  3QIM A;  4DXU A;  1GGG A;  1JEV A;  5HBC A;  1Y1M A;  1MQG A;  3ILT B;  1FPL A;  3KN8 A;  4MIJ A;  1J1N A;  1MXX A;  3ROJ A;  1QJM A;  3G3G A;  3SES A;  1P1O A;  3T96 B;  2DWH A;  2QVU A;  1UIU A;  3ZKK A;  1MY2 A;  4GL8 A;  1BTJ A;  1MS7 A;  2X7P A;  3EHS A;  5I58 B;  3TDJ A;  2REJ A;  4R73 A;  1FQC A;  3SEV A;  1XT8 A;  4Z7E A;  1FJ9 A;  4NF8 A;  4BDR A;  3PUY E;  4HCW A;  3N5L A;  4JSO A;  5IKB A;  1FBG A;  3KOS A;  1EYJ A;  2OWT A;  2VHA A;  5H8N A;  4F18 A;  3RNN A;  3FAT A;  2G29 A;  1LBY A;  2QMW A;  4QFK A;  4HS7 A;  4PFR A;  4LN5 A;  1BKA A;  5ESY A;  3IB0 A;  3LC8 A;  2XXK A;  4OMB A;  2DE4 A;  4PP0 A;  4F22 A;  4YIC A;  1US4 A;  4BDM A;  5ICT A;  4N81 A;  4AS5 A;  1LFG A;  5I56 A;  4OEV A;  4X04 A;  3H3G A;  3K02 A;  1UTB A;  2P3N A;  2QRY A;  5LDZ A;  2XWK A;  3Q27 A;  3K2D A;  4GL0 A;  2XX9 A;  4F2O A;  1OQG A;  4FJP A;  1H43 A;  1FQF A;  2F7C A;  4N13 A;  1NUX A;  1ZU0 A;  1L5T A;  1AWB A;  4PAK A;  3KGC A;  1JET A;  2F3B A;  2QS3 A;  2CZI A;  5H8F A;  1MXY A;  5KCJ B;  2Y84 A;  5I57 A;  3MYU A;  3K1P A;  4JBZ A;  5I3S A;  1Y3N A;  3KJ7 A;  4LQ2 A;  1NNT A;  1JW1 A;  3EKI A;  4WEP A;  1SDX A;  5F7V A;  4AB5 A;  1JVY A;  4F1U A;  2I0B A;  1B3F A;  2ZNS A;  3TTM A;  3BFT A;  4ZEI A;  3T66 A;  3C4M A;  3S9E A;  3C31 A;  4R6H A;  1NUY A;  3KBR A;  2I4B A;  4HE1 A;  3UIF A;  1USY H;  3ODB A;  4N6P A;  5H8Q B;  3T22 A;  5DW8 A;  1OQH A;  4O3C A;  3IOW A;  5L8D A;  3VLU A;  1MY4 A;  3FAS A;  2ONR A;  4I8C A;  1HSJ A;  1PBP A;  4GF8 A;  2E0S A;  1LAF E;  4KCD A;  4NWD A;  2KR0 A;  1DSN A;  1LB9 A;  1P99 A;  2G93 A;  1IEJ A;  2V93 A;  2H99 A;  3U94 A;  2JJK A;  1B32 A;  4LZ7 A;  4LVQ A;  3RT6 B;  1ANF A;  1NMU A;  1FSA A;  4KQP A;  1P1N A;  5TU0 A;  2B3F A;  3LUY A;  1B3H A;  1NH8 A;  2H9B A;  1Y9U A;  5ICQ A;  3RQT A;  3L6H A;  5KCJ A;  3UOR A;  5CMB A;  4H8J A;  3LSL A;  3I3V A;  2OK2 A;  3T9X B;  4TLM B;  1QW0 A;  4POX A;  5DTB A;  1FPF A;  4NMY A;  3VVF A;  3PUW E;  4WXJ A;  4DXB A;  4R9F A;  1BK4 A;  1FJ6 A;  4DCY A;  3KOT A;  1B3E A;  2V4C A;  4N91 A;  2UVH A;  2PYY A;  2D3I A;  4ELR A;  2O69 A;  1XHY A;  3G7W A;  4QSD A;  3CR9 A;  5JK4 A;  2XHD A;  3FIR A;  1BP5 A;  2L5V A;  1B5H A;  2OX3 A;  4FIM A;  1US5 A;  2I4C A;  3T1B A;  1MXU A;  3O29 A;  2FHY A;  4G68 B;  3GXA A;  3E78 A;  1IMF A;  2RC7 A;  5JTY B;  4MNI A;  1FQA A;  1FTK A;  2PT1 A;  3QUJ A;  3VVE A;  4N8G A;  4JVC A;  2WEF A;  1MPD A;  3HHF A;  2HFB A;  3G3J A;  1YAE A;  3IR1 A;  1YZ0 A;  5DEX A;  3IJO B;  1NV6 A;  1CE2 A;  3K4U A;  5ET7 A;  1B46 A;  2Y7W A;  2Q2A A;  1H45 A;  4QSC A;  4YKI A;  4HW8 A;  1RYX A;  1B5I A;  4DE8 A;  1JW5 A;  2IA4 A;  4NHB A;  2ONK E;  3ZKL A;  1D3K A;  1GTK A;  2D21 A;  3FZV A;  2R6G E;  2QSX A;  3I6V A;  3V8X B;  1MM7 A;  2YPN A;  4FE8 A;  3FJ7 A;  3FVO A;  4YMB A;  2I0C A;  3A3U A;  2ALU A;  2GFE A;  4N6K A;  1WOD A;  3MZB A;  1IXG A;  2V3U A;  4KPT A;  1AIV A;  2Z8E A;  4DXC A;  5DVI A;  4GX4 A;  2AYS A;  1IQ7 A;  5JTY A;  1S50 A;  3PMX A;  2HHM A;  5A5L A;  5CBS A;  4IY6 A;  2VOZ A;  5AA2 D;  4RA1 A;  1SW5 A;  4GWU A;  4MNC A;  4XIG Q;  5BUU A;  3CSG A;  1NV3 A;  1MXZ A;  4F1Y A;  4P1L A;  3W9W A;  1OVT A;  3G3H A;  1FW0 A;  1D9V A;  2YLN A;  1MQH A;  1LBB A;  2O1M A;  4XF5 A;  1NV5 A;  1A55 A;  4OWD A;  3ECR A;  3M8U A;  4X1D A;  2RF1 A;  2DE2 A;  2AIX A;  1MH3 A;  1PB9 A;  3HPI A;  4NG7 A;  2HPG A;  5CBR A;  5EYH A;  3O97 A;  1IMC A;  1ZJL A;  3P7I A;  2I49 A;  3BKI B;  4ZEK A;  3TAJ A;  4NF5 A;  1JEU A;  2IEE A;  4NTL A;  4DLD A;  5DYH A;  5IGA A;  2ZYN A;  4PBQ A;  1RDY A;  3W9V A;  1IXC A;  1QKA A;  3IB2 A;  1JVX A;  4PQJ A;  1LBX A;  4ZEB A;  5KZT A;  4EXL A;  4ZE8 A;  4GVO A;  1B05 A;  1EU8 A;  1B5J A;  4H8I A;  3VFJ A;  4RK2 A;  5AA4 B;  2Q8M A;  1B2H A;  5CMC A;  2O6A A;  2F3D A;  3B8B A;  1H76 A;  4PE3 A;  1MM6 A;  3FGS A;  4ZZE A;  1TXF A;  3E79 A;  3QSL A;  4G68 C;  4LQ5 A;  1YYZ A;  2A5T B;  3O66 A;  3S2V A;  4OAN A;  5IZZ A;  1IXH A;  1UTH B;  2F97 A;  4Q8R A;  4DCX A;  4YKJ A;  2Z23 A;  4QFN A;  1VE4 A;  3TMG A;  1O7T A;  2HEU A;  2DYX A;  3EN3 A;  3OEK A;  1B52 A;  3KN7 A;  3V5A A;  1NV0 A;  1BLF A;  4XKQ A;  3TTL A;  4RNS A;  1LAX A;  1B3G A;  4PDD A;  1R1N A;  3TUS A;  1AH5 A;  3PU5 A;  3LBS A;  4KCC A;  4DI3 D;  1FBF A;  4RYA A;  3QK6 A;  4IO5 A;  1INP A;  4X8R A;  1IZ1 A;  2DXY A;  2Q9T A;  4RJZ A;  1FQE A;  2GQ1 A;  4G2Z A;  2Z8F A;  4NQ8 A;  1PBQ A;  4H45 A;  5IZ3 A;  4KHZ E;  1RDZ A;  3RTF B;  4YB6 A;  3EHU A;  4U22 A;  3OMB A;  4GWY A;  4PFW A;  4O8M A;  1AOV A;  4NF8 B;  5ET8 A;  5CM6 A;  2F5X A;  4JWO A;  3D4G A;  4HTG A;  1PB8 A;  3ONM A;  3ISP A;  4P56 A;  3CFX A;  5H8N B;  1NH7 A;  1XVY A;  2B4L A;  5AE4 A;  3IOR A;  3GYY A;  2VPN A;  4YKK A;  1DBZ A;  3MVX A;  4IO3 A;  2OPE A;  3RLF E;  4Q30 B;  1MQI A;  2ABH A;  1KA0 A;  1O63 A;  1QUK A;  3B6T A;  4EQ7 A;  2Q2C A;  3U92 A;  3KSX A;  4N8Y A;  1ZKB A;  1QVS A;  4QSE A;  5I56 B;  4GLI A;  1JP4 A;  4R2F A;  1UTB B;  1I6A A;  1EZP A;  1MDP 1;  1JQF A;  4U4S A;  4L17 A;  5I7I A;  4C0R A;  3E3K A;  3CG1 A;  4GOT A;  2CZK A;  2H25 A;  1B1H A;  1M5D A;  4ZEC A;  4NAP A;  1WVJ A;  1IXI A;  3OO9 A;  4LZ5 A;  4N17 A;  1ZMG A;  5H8F B;  1WDN A;  3KBZ A;  1D4N A;  2OJT A;  5I2K A;  4QFP A;  3HCQ A;  1A8E A;  4MNP A;  5I57 B;  4ZDM A;  1FTL A;  4LZ8 A;  2ZZW A;  3K6V A;  4FBP A;  3OSQ A;  3MPL A;  4X9T A;  3R7X A;  2FIX A;  2NXO A;  4PFY A;  2XWI A;  1N3X A;  1I69 A;  2PFY A;  3G3I A;  4P8B A;  2HCA A;  4R9G A;  2FVZ A;  3U8Q A;  2ZZX A;  4PAI A;  1SI0 A;  2LAO A;  4KXP A;  3G3F A;  4FEB A;  2XD2 A;  1NUZ A;  2BJJ X;  4X48 A;  5FHN A;  4OEN A;  2HQ0 A;  3I5O A;  4GX6 A;  2OLB A;  3O2A A;  5IM2 A;  2HAU A;  4KD5 A;  4EQB A;  3C35 A;  4G4P A;  4GXA A;  3MP8 A;  3PGF A;  4QBA A;  1NV7 A;  5M2V A;  3MVW A;  1MY3 A;  1DTG A;  3DM0 A;  1B6H A;  1ZIU A;  5ET6 A;  3FVN A;  4OA4 A;  3MQ9 A;  3S9N C;  1N76 A;  5EQA A;  2DE3 A;  3MWB A;  4OHN A;  4OVJ A;  4PFB A;  3A09 A;  3TQW A;  5B70 A;  4MX6 A;  3SZP A;  2HXR A;  1NNP A;  3B7D A;  5EQ7 A;  3LSW A;  3M3K A;  3S9M C;  1IIW A;  4BDL A;  1MY0 A;  1QKB A;  3FBP A;  1URG A;  2XXH A;  3BFU A;  1FBH A;  3K6X A;  4KR5 A;  3Q28 A;  4MBP A;  5DVJ A;  4YZZ A;  3N26 A;  4LON B;  2DP8 A;  2NWJ A;  4R74 A;  3KJT A;  1B0H A;  4H6D A;  3WAE A;  1B7U A;  3FXR A;  3MVY A;  2XX7 A;  3R6U A;  3OEN A;  2YJP A;  1FBE A;  3EHT A;  2XWO A;  1XI6 A;  1N7X A;  1Y3Q A;  1SBP A;  3IX1 A;  1IMB A;  3R26 A;  4BDN A;  1EYI A;  1SPI A;  1K9Z A;  2VP1 A;  1SYH A;  4PE5 B;  5DVF A;  2XXV A;  1MH4 A;  1A54 A;  3T0J A;  3PD8 A;  4OER A;  3H6W A;  5ELV A;  2XXQ A;  2NOO A;  4F3P A;  3FXU A;  1GVC A;  3TKD A;  2O68 A;  1FPD A;  1GR2 A;  1NFT A;  1UQW A;  3GBB A;  5H8H A;  2ESN A;  1B3L A;  4P9K A;  1FPE A;  2V3T A;  4RK9 A;  3GLB A;  1G0I A;  4IB2 A;  1Z7M E;  2CZH A;  4IGT A;  5DEX B;  5I59 A;  1KZ8 A;  1SW4 A;  3U72 A;  3IOT A;  5FTH A;  4MJO A;  1SW2 A;  2ZYK A;  3U65 A;  3HO7 A;  1VFD A;  1MRP A;  2Y7R A;  2QFL A;  4U2R A;  3AXF A;  4KI0 E;  4FAT A;  3FV1 A;  2CZL A;  4GIZ A;  4N6D A;  2I3V A;  3DP4 A;  4ESX A;  2WYK A;  2B4M A;  2WX9 A;  1LBV A;  2W7Y A;  1NNK A;  4NED A;  4MLQ A;  4MHF A;  4F31 B;  3IJX B;  3TEP A;  3DP8 A;  3PD9 A;  5FHM A;  3IK6 B;  3JZJ A;  4C1U A;  1VFE A;  3T9U A;  4JWY A;  4JVD A;  1B7Z A;  4PGN A;  3E13 X;  1NV4 A;  4NF0 A;  4H46 A;  2AL4 A;  4OYV A;  4N4U A;  4PET A;  4NF4 A;  4F19 A;  1OVB A;  3C36 A;  4YB7 A;  3WAF A;  2PFZ A;  2ZNT A;  1DK4 A;  1LST A;  1XOC A;  5EQ9 A;  2UVJ A;  3HHG A;  5EYF A;  2NVU B;  3PUV E;  1EZ9 A;  1FTM A;  3OO7 A;  4RPN A;  1H44 A;  4MMP A;  3MP1 A;  5HPQ A;  2Q88 A;  3TCF A;  2Z8D A;  3T93 B;  3RYD A;  4DI4 B;  1LBZ A;  1NL5 A;  4IO2 A;  4NX1 A;  4NF5 B;  1FPG A;  1FTA A;  1GV8 A;  4IO7 A;  1Q1K A;  2H98 A;  4ISU A;  4PFT A;  4P0I A;  1LCF A;  3W15 C;  1FPK A;  1FTJ A;  2H5Y A;  4PF6 A;  2NUV A;  4H67 A;  3C9H A;  1N7W A;  5JEI A;  3DLN A;  3B6W A;  2PBW A;  1QUL A;  4LUB A;  5I84 A;  2DWJ A;  3T9V A;  4IO6 A;  1NV1 A;  3PMV A;  5FBP A;  2X7Q A;  2UVG A;  3CFZ A;  3MPK A;  4O94 A;  4HCY A;  3O6I A;  1LB8 A;  1FQD A;  4PFI A;  1M5C A;  3T9H B;  1EH3 A;  4ELQ A;  4AB6 A;  1H3D A;  5T3J A;  5TP9 A;  2QS2 A;  4WED A;  1MQD A;  4KFQ A;  3MJN A;  3V89 B;  4R75 A;  4U21 A;  2CEY A;  1R6Z A;  1IME A;  4MH5 A;  2ANJ A;  2GHA A;  1IMA A;  4AQ4 A; 
#chains in the Genus database with same CATH homology
 1NUX A;  1AWB A;  4PAK A;  1FPI A;  2B4L A;  2KQZ A;  4JVI A;  2F3B A;  3GYY A;  2VPN A;  3LUZ A;  1DBZ A;  2CZI A;  2R8T A;  3PTY A;  2FBP A;  1NV2 A;  3MYU A;  4PGP A;  5I3S A;  1KA0 A;  5F24 A;  3EKI A;  1G0H A;  2PCR A;  5IZ3 B;  4F1U A;  4N8Y A;  3NOH A;  5J16 A;  1JP4 A;  4NGU A;  2WYP A;  4MAG A;  1KA1 A;  1FRP A;  5I7I A;  1NUY A;  4OVR A;  4HE1 A;  4NN3 A;  2CZK A;  5DW8 A;  4NAP A;  2VPO A;  4N17 A;  4PF8 A;  3KBZ A;  2QVR A;  4MNP A;  3LV0 A;  3A29 A;  4PBH A;  2WBB A;  2KR0 A;  2ZZW A;  4FBP A;  5J1D A;  4X9T A;  2FIX A;  2JJK A;  2XWI A;  1FSA A;  3IFA A;  2PFY A;  2XWV A;  4P8B A;  5I5P A;  4G61 A;  1D9Q A;  2FVZ A;  2DVZ A;  4OVP A;  3BIG A;  2ZZX A;  4PAI A;  4I40 A;  4KXP A;  2DDK A;  4XEQ A;  4XFE A;  4OVT A;  1FPJ A;  4MCO A;  1NUZ A;  1FBC A;  3B50 A;  2HZL A;  4HE0 A;  1FPF A;  4GX6 A;  5IM2 A;  1BK4 A;  1FJ6 A;  4O7I A;  2MKZ A;  2V4C A;  3CHG A;  4OVQ A;  4N91 A;  1NV7 A;  4QBA A;  4AS4 A;  4OA4 A;  5ET6 A;  4OVS A;  5JK4 A;  1EYK A;  5EQA A;  2DE3 A;  2L5V A;  4PFB A;  4MX6 A;  3SZP A;  2HXR A;  5EQ7 A;  2OX3 A;  3T1B A;  4F1V A;  2FHY A;  1YXI A;  3MST A;  1IMF A;  2ZZV A;  3E78 A;  4GWX A;  4MNI A;  4O7M A;  4M1V A;  3FBP A;  1FBH A;  4N8G A;  4GBW A;  4P47 A;  4UAB A;  1K9Y A;  4JVC A;  4YZZ A;  2WEF A;  3RPL A;  2BJI A;  4P3L A;  4PAF A;  1FBE A;  1YZ0 A;  2XWO A;  1XI6 A;  1NV6 A;  1RDX A;  1IMB A;  5ET7 A;  1EYI A;  1SPI A;  1K9Z A;  2QVV A;  5EQ8 A;  4NHB A;  4HXV A;  2P3V A;  1LEV A;  3T0J A;  2XA5 A;  4I3Y A;  5ET5 A;  2Y5K A;  4HE2 A;  1CNQ A;  4N6K A;  1FPD A;  3IFC A;  4PC9 A;  3RPL B;  4P9K A;  1FPE A;  1G0I A;  2CZH A;  4GX4 A;  1KZ8 A;  3QMF A;  4MJO A;  4GX3 A;  1VDW A;  3U65 A;  1FPB A;  2HHM A;  5A5L A;  2WBD A;  1FBP A;  2QFL A;  4GWU A;  4MNC A;  2FIE A;  1NV3 A;  5EYG A;  4P1L A;  4N6D A;  1NI9 A;  3W9W A;  5LTC A;  2WYK A;  2B4M A;  4XF5 A;  1NV5 A;  2WX9 A;  4QXD A;  1LBV A;  4GWW A;  2DE2 A;  3KC0 A;  4MHF A;  4NG7 A;  2HPG A;  1Q9D A;  5EYH A;  1IMC A;  4I3E A;  4PTK A;  4JVD A;  4PGN A;  1FBD A;  4PCD A;  1NV4 A;  4NF0 A;  5IGA A;  3KC1 A;  2V3Q A;  4PBQ A;  4H46 A;  1RDY A;  3W9V A;  1QGX A;  4GBV A;  4N4U A;  4PET A;  4F19 A;  1LBX A;  4IR8 A;  1DCU A;  3D1R A;  4GWS A;  1IMA A;  1LBW A;  2PFZ A;  1DK4 A;  2CEX A;  4GWZ A;  5EQ9 A;  2Y5L A;  4MMP A;  2Q8M A;  2VT5 A;  3FXB A;  1FPL A;  5IZ1 A;  4MIJ A;  2F3D A;  3B8B A;  4PE3 A;  3ROJ A;  2HZK A;  3E79 A;  3RYD A;  4DI4 B;  1LBZ A;  3HFU A;  4NX1 A;  1YYZ A;  1FPG A;  1FTA A;  4OAN A;  2QVU A;  5IZZ A;  1FPK A;  4N15 A;  4PF6 A;  1NV0 A;  4MEV A;  1FJ9 A;  4HCW A;  4PDD A;  1NV1 A;  5FBP A;  2OWZ A;  1FBG A;  4DI3 D;  1FBF A;  1EYJ A;  4F18 A;  1LBY A;  4O94 A;  4PFR A;  4X8R A;  1INP A;  4HCY A;  2Q74 A;  4LN5 A;  4PFI A;  1NUW A;  5ESY A;  2XXK A;  1IMD A;  2Q9T A;  2DE4 A;  2GQ1 A;  2QPQ A;  5T3J A;  4YIC A;  4NQ8 A;  3BIH A;  4H45 A;  5IZ3 A;  1RDZ A;  4P1E A;  4N81 A;  4AS5 A;  4GWY A;  2CEY A;  4X04 A;  4O8M A;  5CM6 A;  1IME A;  2F5X A;  2P3N A;  5LDZ A;  2XWK A;  3ISP A;  5ET8 A;  4P56 A;  4PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...