5DW8A

Crystal structure of 2'amp bound saimpase-ii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
269
structure length
260
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
publication title Crystal structure of 2'AMP bound SaIMPase-II
rcsb
source organism Staphylococcus aureus
total genus 76
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5dw8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5dw8A02
1FBPA 3LUZA 1NV1A 1NV5A 4GWZA 1IMCA 1INPA 2WBBA 3D1RA 2CZKA 5T3JA 5J16A 1FPFA 1QGXA 1AWBA 2Y5KA 2QFLA 4GX4A 4PTKA 1IMFA 5ET8A 4HE1A 4GX6A 1FPGA 4FBPA 4H46A 2QVUA 1LBZA 2HHMA 1NV4A 4QXDA 1FPBA 2PCRA 1D9QA 1G0HA 1YYZA 1LBYA 3LV0A 2FIXA 1EYIA 5ET5A 2P3NA 1LBWA 2CZIA 4GX3A 2WBDA 3KC1A 5IZ1A 4HXVA 1DCUA 3KC0A 1JP4A 4O7IA 2WEFA 5ET7A 5EQ9A 4I3EA 1IMDA 5I3SA 3QMFA 1EYJA 4H45A 1IMBA 1FBGA 1XI6A 5ET6A 1DK4A 5F24A 1FRPA 1FPKA 1SPIA 1CNQA 1FPEA 1LBVA 1NUWA 2CZHA 4I3YA 2QVVA 2Q8MA 1FBFA 2QVRA 1DBZA 2FBPA 4GBVA 4IR8A 2GQ1A 1FBDA 2JJKA 1FTAA 3FBPA 2OWZA 1FJ6A 2F3BA 1FBHA 1NUXA 4AS4A 1IMEA 2P3VA 3RPLA 4GBWA 1NUYA 1NV2A 5ESYA 1NI9A 1IMAA 1FBEA 1NV7A 3IFAA 4GWUA 4AS5A 5A5LA 1FBCA 1RDZA 2DDKA 5FBPA 1RDYA 1BK4A 3BIHA 5LDZA 5IZ3A 4HE2A 1KA1A 3A29A 1RDXA 5EYHA 1FPLA 1FPJA 2FHYA 3KBZA 1K9YA 4HE0A 4GWWA 1NV3A 1NUZA 2FIEA 3BIGA 1FPDA 4MJOA 3B8BA 1KA0A 5EYGA 3T0JA 1NV0A 1G0IA 1FPIA 1K9ZA 1LEVA 1VDWA 1Q9DA 1YZ0A 2VT5A 2F3DA 1KZ8A 1FSAA 2BJIA 3RYDA 3RPLB 3IFCA 5EQ7A 1YXIA 4KXPA 4GWSA 4I40A 5DW8A 2OX3A 4G61A 2R8TA 1NV6A 1FJ9A 2Y5LA 4GWXA 1LBXA 4GWYA 2Q74A 5EQAA 1EYKA 2FVZA 5IZ3B 3ROJA 5EQ8A 4N81A
chains in the Genus database with same CATH superfamily
1II5A 2XX9A 1EZ9A 3G3KA 1N0TA 1INPA 3R7XA 3FVGA 1P1WA 1B5IA 3GZGA 1QGXA 5CMKA 3FVNA 2I3VA 2XD2A 3IORA 3V89B 1N3WA 2DWIA 4OEUA 4N07A 2Z8EA 1EYIA 1JW5A 2WBDA 2PT1A 5ISUA 3FXQA 1UTHB 3QUJA 3RNNA 2F6GA 1A40A 4ZEKA 4EQ7A 4DI3D 2QVVA 2JJKA 3MSTA 4GIZA 4NMYA 4PBQA 4TLLB 3KJTA 1N04A 4LZ7A 3H6UA 4N8GA 4OERA 3K00A 3N26A 4TOZA 2HFBA 3HCQA 2FHYA 3M3LA 3FUZA 3TCFA 4O94A 4PE5B 3WAFA 2Y7IA 1EU8A 2NWJA 4RXLA 5ICQA 2OK2A 3MZBA 3TTRA 1MDP1 1DPPA 1PEBA 1O63A 2DYXA 1VFEA 5KDTB 4DXCA 3CI8A 4WEDA 5L9SA 2H99A 1LBCA 4ZEIA 5EQ8A 2HAVA 3C34A 3PPQA 2NXOA 4RA1A 4MCOA 3MZ1A 3UORA 1QUJA 2D3IA 1LFHA 1XHYA 5A5XB 5JTYA 4MLVA 3P7IA 4NWDA 2QVUA 2XXUA 3KN3A 4G68A 1LFIA 1FTMA 1PB8A 1SBPA 1LGBC 3KSJA 5M2VA 4BDRA 1B4ZA 2HAUA 1YTVA 4PAKA 4RPOA 1A55A 1B32A 2UYEA 3SEUA 2VD3A 1CNQA 2ALUA 3KN8A 1Y3QA 3FBPA 2O84X 1VFDA 5H8HB 4F3BA 4KQPA 3KG2A 2RC8A 3PV0E 1IMAA 3IFAA 4GWUA 4AS5A 1RDZA 3S9LC 2DE2A 2DDKA 3T9HB 1OLCA 3PUWE 4ISUA 1NNFA 1JEUA 3SEWA 3LR1A 4UABA 1SW5A 2O6AA 3PPOA 1IXCA 5TU0A 2PT2A 3BBRA 1NV0A 1G0IA 1B4HA 1MDQA 1WODA 2XXTA 4H5GA 4JVIA 3IO4A 3LSLA 4XKPA 4QRZA 1MM7A 3MVYA 1QKBA 2RCAA 4P0GA 1A54A 4PC9A 4FECA 4X1BA 2OWTA 4F29A 3G3JA 1QKAA 2H9BA 4EDPA 2H5YA 2MKZA 4BDQA 1FPFA 2I48A 2Y5KA 1WVJA 4C0RA 1NH8A 3H6TA 3KOTA 5FHNA 1Z7NE 4ESXA 2V4CA 4U4SA 1B5HA 5ET5A 1NH7A 3C35A 2Q89A 2YPNA 4MH5A 1DOTA 3E9XA 2F7CA 4F18A 1DTZA 3OSQA 2ZZXA 4MF3A 3U92A 2M8CA 2QRYA 1OLAA 1VSOA 1B46A 4H5FA 1S9TA 1NV2A 2AYSA 3HPIA 2DOJA 5IZ3A 2ANJA 5ELVA 2PX1A 4GL8A 4X48A 4K3FA 1K9YA 2ZYMA 3VE1B 4QFOA 2B65A 3IX1A 3B8BA 5EYGA 4QHQA 2G93A 1VDWA 5KCJA 4ZZAA 4O3AA 2VHAA 1FSAA 4H8IA 4P3LA 4PGNA 3TCHA 2HQ0A 4ZEDA 5K2XA 2OPDA 4LA9A 5DYHA 2O51A 5H8NB 1XT8A 2Y7WA 1NNTA 3VV5A 5B70A 4GD5A 2I58A 1SW1A 4NAPA 1N7WA 4OVQA 3CHGA 3QXMA 2QS1A 5I56B 1LB8A 1BP5A 4HE1A 1JNFA 3FZVA 3CG1A 4DCXA 1H76A 3PUVE 2H98A 4DCYA 1MY3A 5IKBA 1TFAA 1XS5A 2RKMA 1NV4A 3HO7A 3VXBA 1IXIA 1IEJA 1LBYA 2QJEA 1LBBA 3UA8A 3S9EA 3KC1A 4FATA 3KC0A 3K6UA 3C31A 3EKIA 5IGAA 4JSDA 1IMBA 1B52A 4RY1A 1DK4A 2XHDA 2E1SA 4MHFA 4DXUA 5JEIA 4R74A 4XTCQ 2XXPA 3K02A 3SEXA 4RNSA 1H44A 4X9TA 1GGGA 2UXAA 2ZYKA 1FBEA 3DP8A 2UVJA 1OIBA 3TDJA 1YCJA 1FQFA 3QSLA 4YZZA 1RDXA 1P1UA 3V5AA 4UACA 3KEIA 5K2YA 4HE0A 1AMFA 3LUYA 3TMGA 5I58B 2R9JA 2Y7KA 4AQ4A 3GXAA 3ZKKA 2HXWA 4GXAA 4IO6A 2DWHA 2XXYA 1MPBA 1MH3A 1B40A 4HS7A 2X26A 2X7PA 4OVTA 5TPAA 3KSXA 4GFRA 3MYUA 5LTCA 5DEXB 2PMSA 4YAHX 1SI1A 4BDNA 5CMBA 3H6VA 1JQFA 1AWBA 3OO8A 4PCDA 1LAFE 3TUSA 2I49A 3ONMA 2VPOA 4F22A 1MXXA 3FXUA 4U2RA 2XXKA 3GBBA 1URGA 3FV1A 3IR1A 2G29A 3MBPA 3T9XB 1GVCA 3T66A 2HXRA 2D21A 4I3EA 1FQBA 1MPDA 1FBGA 2ZMBA 2V3UA 4OTEA 2B4LA 4PAFA 3TYHA 5LOMA 1LCTA 1SI0A 4NF5A 3PTYA 4I62A 3V8XB 1FBDA 1QJMA 1SYHA 2ONSA 2NVUB 4U21A 1NI9A 4ZS9A 3ILUB 4IO3A 4H0WA 3T9UA 4AB6A 1MY4A 4PE3A 1TT1A 2F35A 3IO6A 3K0VA 3E4RA 2O1LA 4NHBA 1FQDA 4QSEA 1B7HA 3B6WA 3OD7A 4PFUA 2V25A 4YKKA 1NV3A 5CBSA 2WX9A 4PFIA 4ZECA 4MAGA 2DE3A 3UIFA 1MS7A 3HV1A 4P11A 1Q9DA 3N6TA 3QUFA 3PPPA 3E3KA 3CIJA 4C1UA 1JVXA 2XXWA 4XKNA 3Q27A 5CRYA 4GWXA 4RJZA 3IOTA 1FQCA 3ROJA 2Q9TA 3U72A 2BJJX 4NF6B 1USYH 4KYDA 3U1OA 1MXZA 3M8UA 1IMCA 4ELOA 3UP9A 3TKDA 1CB6A 1UTHA 3SETA 3FXRA 3PU5A 3H06B 4PQJA 4N91A 4FBPA 5B7DA 3OO7A 1IQ7A 3PGFA 4IY5A 1B2HA 2D5WA 3H4ZA 4DE8A 3K4UA 4BDMA 3CSBA 2O7UA 5JK4A 3IB0A 5ET6A 3TTKA 4H8JA 4N4UA 4OFOA 1FPEA 1MPCA 4KCDA 3C9HA 5FTHA 3THIA 4I3YA 4NF0A 1R1NA 4HCYA 4PFWA 1FTAA 2VPNA 1TWYA 2Q88A 2P1SA 3FVKA 2WYKA 4OVSA 1UTBA 3U93A 3K6XA 2RC9A 1HSLA 3RQTA 1GV8A 3C32A 4X8RA 1RYXA 2Z8FA 3BIHA 1Y3PA 4FJPA 1B7UA 4OZ9A 3TELA 2O1MA 4GWWA 3V83A 1SYIA 1MG1A 3T1BA 5A5XA 5H8QB 1MXWA 4ZEBA 1YZ0A 2XWOA 1ZLQA 4RK2A 3C33A 3U65A 1B3FA 3IAZA 1T0KA 2WBBA 3D1RA 2DS9A 4PDHA 1AL3A 2XXIA 2GH9A 1M5CA 3TPAA 2W7YA 3QAXA 1Q35A 4Q30B 2YJPA 5I2KB 1N7XA 3Q29A 2DVCA 5H8HA 4ELPA 4PF6A 4BDLA 1RYOA 4U1ZA 4XEQA 1FCKA 3MVXA 5I3SA 3D4GA 4NF8B 5EQ9A 4E0WA 2X7QA 4PFBA 4QSDA 3C4MA 3KBRA 2I0BA 4G77A 4OXVA 4MX6A 3EN3A 2VD2A 5FHMA 4ZE8A 1Y9UA 1MQDA 3RUMA 1NUXA 4KFQA 2OLBA 4GBWA 1NUYA 3LSXA 2QS4A 3AXFA 5IAIA 3CG3A 5ITOA 3MUQA 2QMWA 2Z8DA 3LSFB 2DSFA 5EHMA 3HHFA 2ZNSA 4EXLA 3T22A 3USDA 2CZLA 4PBHA 3N94A 4JWOA 4H6DA 2HCAA 1QW0A 2XD3A 4EQBA 2DP8A 2VP1A 4G8MA 3OEKA 1FTKA 5I57B 3MWBA 1MQJA 4LATA 1MY0A 4F39A 1B7ZA 4P0IA 1LFGA 1OVBA 3IOVA 1S7YA 3B6QA 1URDA 3E13X 4P9KA 3C36A 3U94A 4QFKA 3CSGA 2DXYA 3O6GA 1HSEA 2NUVA 3O6IA 3PMVA 4F1UA 2A5TB 2WEFA 5ET7A 1R9QA 1US4A 2F7BA 1PB9A 3VLUA 2F97A 3FD3A 1LAHE 5F24A 1FRPA 3Q25A 1Y3NA 3RT6B 1AH5A 5HBCA 3TZAA 4LP2B 2NOOA 3EHUA 3OO9A 4EF1A 5DVFA 4P1LA 3DP6A 2DXRA 5I7IA 5H8NA 1OQHA 4HE2A 2Y84A 4N8YA 5AA4A 3FJ7A 5EHSA 5IM2A 1B3LA 5TP9B 2F8DA 3MVWA 4DXBA 4POWA 5I56A 3MAMA 4GRKA 2XA5A 2VGQA 4WKMA 3RPLB 5CI5A 3O2AA 1DPEA 4F1YA 1EZPA 4I40A 4OFJA 1LSTA 1NL5A 1LAXA 4NGUA 2F36A 1NFTA 4R6YA 4Z0IA 5I2NB 1JEVA 3LUZA 4QFLA 1Y4CA 3VXCA 3VDFA 4RYAA 1IITA 5BUUA 2AIXA 4MNPA 2O68A 4OHNA 3WAEA 2ZYOA 3FXBA 3O97A 1A7LA 3K2DA 4FE8A 4FORA 3OO6A 4XKRA 1FTOA 2OCUA 4LONB 4H1XA 3RT8A 5H8FA 1UIVA 1TXFA 2ZNUA 2AL4A 3TTNA 3CRBA 4IO7A 5FTIA 1URSA 3MC2A 3TQWA 4IY6A 2Q8JA 4YMBA 1BTJA 5AA2B 5I58A 3SEVA 2QVRA 2E0SA 4U23A 4GF8A 1ZJLA 3D4CA 3CR9A 4IO2A 4IO4A 4JVCA 1SW4A 4O8MA 3FATA 3K6WA 1QUKA 2DVZA 2V3QA 3SEYA 4PDDA 3OEMA 4QF9A 5F7VA 5I59B 3KBZA 4GQOA 3SDFA 2KR0A 1NUZA 2FIEA 4NWCA 3BIGA 1N84A 3T0JA 1OMPA 2REJA 3K1NA 3TCGA 1BIYA 2HEUA 5KCJB 2Y7PA 4L17A 4EXKA 3ECRA 3M3KA 3G3GA 1H3DA 1ANFA 1FQEA 2OZZA 1IIWA 4QFNA 2DWJA 2ZXTA 4NF4B 4PFTA 1JW4A 1QVSA 2O69A 4GX4A 4KD5A 5I5PA 4NQ8A 5BWJA 4Q5TA 3KZGA 4LUBA 5CM6A 4M1VA 1LCFA 5KZTA 3IK6B 1FPBA 3TFLA 1L5TA 1YYZA 4G4PA 5ITPA 3O6HA 4XF5A 1NKXA 4QSCA 3H3GA 3O28A 1XI6A 1R9LA 1FPKA 1FTJA 3S2VA 1NUWA 2CZHA 4FAJA 4POXA 4IR8A 2OPEA 3K1MA 4ELRA 1FBHA 1FW0A 4G68C 2ZZVA 1N3XA 1POY1 1NNKA 3PUYE 4O3CA 3RLFE 4ECFA 5LDZA 2VOZA 2PFZA 3QIMA 2L5VA 1SQYA 1KA1A 5EYHA 1D3KA 2CEXA 3VVDA 3Q28A 3VVEA 3R6UA 2V84A 5CC2A 2RC7A 3MP6A 4ELQA 4R6HA 1DMBA 1MM6A 1B9JA 3M3FA 3IJXB 2F5XA 4OMBA 1USYE 4EF2A 2ZNTA 3PUZE 4R2BA 3PUXE 3QK6A 2Q74A 3LSWA 2FVZA 1D9YA 3W9VA 2THIA 1H45A 3PMWA 1MY1A 1NV1A 1D4NA 1S50A 4H65A 1N76A 4MEVA 4N17A 2XXQA 2DWAA 2IEEA 1IMFA 4JWXA 1MRPA 4F19A 5AA3A 3TTMA 3B7DA 4LQ5A 1A8EA 4NE4A 4Z7EA 3G7WA 4OVPA 1LBWA 2CZIA 4P47A 1RKMA 2QL3A 3E78A 1DCUA 1JP4A 3ZS6A 1M5EA 1P1OA 1IMDA 2XX7A 3DP4A 5HM4B 4OESA 1MXVA 1B1HA 5CMMA 4JDFA 2Q2CA 3SESA 2OJTA 4ZEFA 4ZZEA 1OVTA 4GBVA 4NF5B 2ONRA 2OWZA 1Z7ME 3JV9A 1IMEA 1MQHA 4XIGQ 5IZZA 1R6ZA 4OA4A 3JYRA 4PGPA 4F1VA 1MY2A 1CE2A 3G3IA 1B3EA 1LB9A 3G3FA 3RN8A 1MXUA 3QYTA 4JB7A 3A29A 4BDOA 4U1OA 4NEDA 2XXXA 3B50A 1FPDA 3FVOA 4IO5A 4HW8A 1K9ZA 4M4GA 2ZYNA 3HFUA 5KDTA 5I2KA 1IXHA 4GWSA 4KYSA 5L8DA 1NV6A 1I6BA 4ND9A 2Y5LA 4PFRA 4O7MA 3IJOB 3B6TA 2QMXA 2O7IA 1IZ1A 4R73A 2QSXA 3OMBA 4NF8A 1GR2A 3G3HA 3R26A 4JWYA 5J16A 4TQUQ 3N5LA 1IXGA 2QFLA 5ET8A 3T93B 4GX6A 4N13A 2GFEA 4XXUA 5AA2D 3OXNA 2DQVA 3IB2A 2PCRA 2QS2A 3EF7A 1PDAA 4U22A 2FYIA 3RY3A 1A8FA 4KCCA 1SPIA 1LBVA 1J1NA 4AB5A 2FBPA 3MP8A 1NMUA 3CFZA 2OBGA 5AA1A 3LBSA 3ZSFA 4ESWA 1ZU0A 1MQIA 4UA8A 1ZKBA 3BKIB 3RPWA 4OYVA 3U8QA 4N6DA 4PAIA 2XWIA 1UTBB 4MLQA 2HPGA 3K6VA 4MMPA 4QBAA 4R2FA 2LAOA 2PYYA 4GOTA 1B51A 2RINA 5I57A 3MQ9A 2KQZA 1KA0A 2UVIA 3O29A 3I6VA 2BJIA 1EH3A 1AIVA 4I1DA 2PBWA 4DLDA 4DDDA 1VE4A 4OVJA 3MVZA 4P1EA 3FIRA 2P2AA 3KJ7A 2H4IA 1P99A 3GLBA 2A5TA 4F3SA 4JXIA 1UQWA 3SERA 2CZKA 3S4UA 3UN6A 2F78A 1QULA 3HN0A 2UYFA 4R6KA 4PTKA 3PPNA 4YB6A 1D9VA 3ILTB 4R72A 2HHMA 4PETA 3RTFB 2FA7A 4R75A 2UVGA 1BKAA 1ZIUA 4G8NA 2GHAA 4OFLA 4I9DA 3LV0A 4XFEA 2FIXA 3A3UA 4GX3A 4U4XA 5IZ1A 4HXVA 3T9VA 4LN5A 2HZLA 4JSOA 2F34A 2XWKA 1Y1MA 3QMFA 1B58A 1EYJA 3H03A 1MH4A 1B3HA 3IOWA 4LQ2A 4RPNA 1B3GA 1XOCA 4OETA 5JTYB 2XX8A 2RCBA 2HZKA 5TP9A 2CEYA 4XKQA 3EPEA 4F2QA 4G68B 1B5JA 4AS4A 4FEDA 4FEBA 1AOVA 3MPLA 2GRVA 3RPLA 4DIGA 2R6GE 4PFYA 3UGWA 4NX1A 2GHBA 1DTGA 1KWHA 4IB2A 4OENA 1Q1KA 3FJGA 5I2NA 1FPLA 4OVRA 1JW1A 3VVFA 3MJNA 3W9WA 3VLVA 3FGSA 3KN7A 3TQLA 2QPQA 1LEVA 2XXRA 1ZMGA 2VT5A 2XXHA 2I3WA 4ZE9A 2R71A 5EQ7A 4YKIA 5HPQA 3A09A 4KI0E 2R8TA 1LLSA 4LVQA 3VFJA 1NNPA 1PC3A 3OOAA 4N81A 4TLMB 1FBPA 4I8CA 1SD3A 3UK4A 1NV5A 3O9PA 2AL5A 2Y7RA 5ICTA 5EYFA 5T3JA 3KGCA 2I0CA 4QFPA 4OWDA 5FHOA 5AA2A 4EUOA 4RK9A 4H46A 4OQOA 4EQ9A 1D9QA 1I6QA 2I4BA 4NG7A 1US5A 4KYEA 4HTGA 4MBPA 1MQGA 5I84A 4GL0A 4H45A 3H7MA 2WYPA 1B0LA 3S9NC 1M5DA 2A5SA 5I59A 3GBAA 1B05A 3A3CA 2Q8MA 4P8BA 3Q26A 2F3BA 1PB7A 1XVXA 4YB7A 2P0SA 1FQAA 5ESYA 4MFIA 1XC1A 5L9MA 2I6EA 1NV7A 1I69A 3OELA 4DI4B 1FBCA 5FBPA 2V93A 3SKPA 2B3FA 2ZZWA 3MZ9A 4MNCA 4PF8A 3FJMA 5F1QA 4GVOA 4OANA 4NN3A 2B3BA 5AA4B 4NF4A 5DT6A 1Y1ZA 1M5BA 3LC8A 1EZOA 2Q2AA 2B4MA 3JZJA 2XXVA 2OWSA 1KZ8A 1YAEA 2ABHA 3RYDA 3IFCA 1YXIA 1OQGA 1VR5A 3IB1A 3BFUA 4DZ1A 5DVJA 1LBXA 4GWYA 1EYKA 5IZ3B 1QUIA 5DEXA 4GLIA 4GWZA 3F11A 2I4CA 1GTKA 3E79A 5AE4A 1O64A 1LAGE 1B0HA 3IL1B 2ESNA 5J1DA 3RTWB 3I5OA 4YICA 3ISPA 3FV2A 4JBZA 4GWOA 3EQ1A 5L9OA 5H8FB 4JVDA 3GYYA 4OEVA 1BLFA 2F7AA 4O7IA 2PVUA 1IUDA 4KHZE 3MP1A 1POTA 4LZ8A 1XVYA 3PPRA 5H8SA 2RF1A 1DSNA 3CVGA 2YLNA 5CBRA 1PBQA 1WDNA 1F9BA 2Z22A 1SDXA 2XWVA 4YU0A 1HSJA 4E0XA 3PD9A 4GXSB 5A5LA 3K01A 3MW0A 1ATGA 3BFTA 4H67A 3W15C 2ONKE 1A99A 1FPJA 4F2OA 5DVIA 1ZTYA 3L6GA 3O66A 3EHSA 4ZDMA 3VLWA 1FPIA 1ZBMA 3MPKA 4WXJA 3FASA 2F3DA 2UVHA 3DLNA 4IGTA 4KXPA 4N6KA 4G2ZA 4C1TA 5DW8A 4G61A 1B6HA 1SW2A 1FJ9A 2REGA 3T96B 1P1QA 4NF6A 4PP0A 5EQAA 3DELB 4X1DA 1O7TA 3HSTA 3TODA 2KLFA 3S9MC 3K1PA 4WEPA 1YPNA 2Z23A 3N6UA 3ODBA 3HHGA 4ONYA 4BLAA 1JVYA 4N15A 1FPGA 1H43A 2F6PA 1PBPA 1LBZA 3NOHA 4QXDA 4R9FA 4Q8RA 1Y4TA 1G0HA 1TFDA 4MNIA 1ELJA 4THIA 3DM0A 5TPAB 2P3NA 4P56A 3TAJA 4YMAA 1JETA 1UIUA 3CFXA 2H25A 1P1NA 4X04A 4F31B 1Y20A 1FBFA 1DBZA 2GQ1A 3TTLA 1FJ6A 4G8HA 3SZPA 4KPTA 4R9GA 2P3VA 2PFYA 2QS3A 4F3GA 3L6HA 3KOSA 3PMXA 3KFMA 4O3BA 3PD8A 4F3PA 1RDYA 1BK4A 3ZKLA 2IA4A 4YKJA 3RGYA 3OENA 4N6PA 3CFLA 4MJOA 1SVXB 3IOUA 2DE4A 5H8QA 1B1XA 3EHTA 2V3TA 3I3VA 4KR5A 4NTLA 3H6WA 3TEPA 4YKPA 4HCWA 4LZ5A 4Q0CA 3OSRA 2FNCA 5DTBA 4YB5A 2OX3A 4MIJA 4FIMA 1M5FA 1MXYA 1FTLA 4IGRA 2CMOA 5CMCA 1I6AA 2WKYA
chains in the Genus database with same CATH topology
3LUZA 3MYUA 5LTCA 1INPA 2CZKA 4MNPA 1QGXA 1AWBA 4PTKA 3FXBA 4PCDA 2HHMA 4PETA 2VPOA 2XXKA 3LV0A 4XFEA 2FIXA 1EYIA 4GX3A 2WBDA 5IZ1A 4HXVA 2HXRA 4LN5A 2HZLA 2XWKA 4I3EA 3QMFA 1EYJA 1FBGA 2B4LA 4PAFA 4DI3D 2QVVA 2HZKA 2CEYA 2QVRA 3PTYA 1FBDA 2JJKA 3MSTA 4AS4A 4PBQA 3RPLA 1NI9A 4JVCA 4N8GA 4NX1A 4O8MA 4PE3A 2DVZA 2V3QA 4PDDA 4NHBA 1FPLA 4OVRA 2FHYA 3KBZA 2KR0A 1NV3A 1NUZA 2WX9A 4PFIA 2FIEA 4MAGA 4O94A 3BIGA 2DE3A 3W9WA 3T0JA 2QPQA 1LEVA 1Q9DA 2VT5A 5EQ7A 2R8TA 4GWXA 3ROJA 2Q9TA 5EQ8A 4N81A 1FBPA 1NV5A 1IMCA 5T3JA 4MCOA 4GX4A 5I5PA 4NQ8A 4N91A 5CM6A 4FBPA 4H46A 2QVUA 4M1VA 1FPBA 1D9QA 1YYZA 4XF5A 4NG7A 4PAKA 5JK4A 4H45A 2WYPA 1XI6A 5ET6A 4N4UA 1FPKA 1CNQA 1FPEA 1NUWA 2CZHA 4I3YA 4NF0A 2Q8MA 4P8BA 4HCYA 4IR8A 1FTAA 3FBPA 2VPNA 2F3BA 1FBHA 2WYKA 2ZZVA 4OVSA 5ESYA 1IMAA 1NV7A 3IFAA 4DI4B 4GWUA 4AS5A 1FBCA 1RDZA 2DE2A 2DDKA 5FBPA 4X8RA 2ZZWA 3BIHA 5LDZA 2PFZA 2L5VA 4MNCA 1KA1A 5EYHA 4PF8A 2CEXA 4OANA 4UABA 4NN3A 4GWWA 1NV0A 1G0IA 3T1BA 2B4MA 1YZ0A 1KZ8A 2XWOA 3RYDA 3IFCA 1YXIA 4JVIA 2F5XA 1LBXA 4GWYA 2Q74A 1EYKA 2FVZA 5IZ3B 3U65A 3W9VA 4PC9A 1NV1A 4GWZA 2WBBA 3D1RA 4MEVA 4N17A 4PDHA 3E79A 2MKZA 1FPFA 2Y5KA 1IMFA 4F19A 5J1DA 4YICA 2V4CA 3ISPA 4PF6A 4OVPA 5ET5A 1LBWA 2CZIA 4P47A 4JVDA 3GYYA 4XEQA 3E78A 1DCUA 1JP4A 4O7IA 5I3SA 5EQ9A 1IMDA 4PFBA 4F18A 4MX6A 2ZZXA 4GBVA 2OWZA 1NUXA 2XWVA 1IMEA 4GBWA 5IZZA 1NUYA 1NV2A 4OA4A 4PGPA 4F1VA 5A5LA 5IZ3A 3A29A 1FPJA 1K9YA 3B50A 1FPDA 3B8BA 5EYGA 1FPIA 1K9ZA 1VDWA 2F3DA 3HFUA 1FSAA 4KXPA 4GWSA 4N6KA 4P3LA 4PBHA 4PGNA 5DW8A 4G61A 1NV6A 1FJ9A 2Y5LA 4PFRA 4O7MA 5EQAA 4NAPA 4OVQA 3CHGA 5J16A 2QFLA 5ET8A 4HE1A 4GX6A 4N15A 1FPGA 1LBZA 3NOHA 1NV4A 4QXDA 4P9KA 2PCRA 1G0HA 1LBYA 4MNIA 2P3NA 4P56A 3KC1A 4F1UA 3KC0A 2WEFA 5ET7A 3EKIA 5IGAA 1IMBA 1DK4A 4X04A 5F24A 1FRPA 1SPIA 1LBVA 4MHFA 1FBFA 1DBZA 2FBPA 2GQ1A 1FJ6A 4X9TA 3SZPA 2P3VA 2PFYA 4N6DA 1FBEA 4PAIA 4P1LA 2XWIA 2HPGA 4MMPA 4QBAA 5I7IA 1RDYA 1BK4A 4HE2A 4YZZA 1RDXA 4N8YA 4HE0A 5IM2A 4MJOA 2KQZA 2DE4A 1KA0A 2XA5A 2BJIA 3RPLB 4HCWA 4I40A 2OX3A 4MIJA 4P1EA 4NGUA 4OVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBP A;  3LUZ A;  1NV1 A;  1NV5 A;  4GWZ A;  1IMC A;  1INP A;  2WBB A;  3D1R A;  2CZK A;  5T3J A;  5J16 A;  1FPF A;  1QGX A;  1AWB A;  2Y5K A;  2QFL A;  4GX4 A;  4PTK A;  1IMF A;  5ET8 A;  4HE1 A;  4GX6 A;  1FPG A;  4FBP A;  4H46 A;  2QVU A;  1LBZ A;  2HHM A;  1NV4 A;  4QXD A;  1FPB A;  2PCR A;  1D9Q A;  1G0H A;  1YYZ A;  1LBY A;  3LV0 A;  2FIX A;  1EYI A;  5ET5 A;  2P3N A;  1LBW A;  2CZI A;  4GX3 A;  2WBD A;  3KC1 A;  5IZ1 A;  4HXV A;  1DCU A;  3KC0 A;  1JP4 A;  4O7I A;  2WEF A;  5ET7 A;  5EQ9 A;  4I3E A;  1IMD A;  5I3S A;  3QMF A;  1EYJ A;  4H45 A;  1IMB A;  1FBG A;  1XI6 A;  5ET6 A;  1DK4 A;  5F24 A;  1FRP A;  1FPK A;  1SPI A;  1CNQ A;  1FPE A;  1LBV A;  1NUW A;  2CZH A;  4I3Y A;  2QVV A;  2Q8M A;  1FBF A;  2QVR A;  1DBZ A;  2FBP A;  4GBV A;  4IR8 A;  2GQ1 A;  1FBD A;  2JJK A;  1FTA A;  3FBP A;  2OWZ A;  1FJ6 A;  2F3B A;  1FBH A;  1NUX A;  4AS4 A;  1IME A;  2P3V A;  3RPL A;  4GBW A;  1NUY A;  1NV2 A;  5ESY A;  1NI9 A;  1IMA A;  1FBE A;  1NV7 A;  3IFA A;  4GWU A;  4AS5 A;  5A5L A;  1FBC A;  1RDZ A;  2DDK A;  5FBP A;  1RDY A;  1BK4 A;  3BIH A;  5LDZ A;  5IZ3 A;  4HE2 A;  1KA1 A;  3A29 A;  1RDX A;  5EYH A;  1FPL A;  1FPJ A;  2FHY A;  3KBZ A;  1K9Y A;  4HE0 A;  4GWW A;  1NV3 A;  1NUZ A;  2FIE A;  3BIG A;  1FPD A;  4MJO A;  3B8B A;  1KA0 A;  5EYG A;  3T0J A;  1NV0 A;  1G0I A;  1FPI A;  1K9Z A;  1LEV A;  1VDW A;  1Q9D A;  1YZ0 A;  2VT5 A;  2F3D A;  1KZ8 A;  1FSA A;  2BJI A;  3RYD A;  3RPL B;  3IFC A;  5EQ7 A;  1YXI A;  4KXP A;  4GWS A;  4I40 A;  5DW8 A;  2OX3 A;  4G61 A;  2R8T A;  1NV6 A;  1FJ9 A;  2Y5L A;  4GWX A;  1LBX A;  4GWY A;  2Q74 A;  5EQA A;  1EYK A;  2FVZ A;  5IZ3 B;  3ROJ A;  5EQ8 A;  4N81 A; 
#chains in the Genus database with same CATH topology
 1II5 A;  2XX9 A;  1EZ9 A;  3G3K A;  1N0T A;  1INP A;  3R7X A;  3FVG A;  1P1W A;  1B5I A;  3GZG A;  1QGX A;  5CMK A;  3FVN A;  2I3V A;  2XD2 A;  3IOR A;  3V89 B;  1N3W A;  2DWI A;  4OEU A;  4N07 A;  2Z8E A;  1EYI A;  1JW5 A;  2WBD A;  2PT1 A;  5ISU A;  3FXQ A;  1UTH B;  3QUJ A;  3RNN A;  2F6G A;  1A40 A;  4ZEK A;  4EQ7 A;  4DI3 D;  2QVV A;  2JJK A;  3MST A;  4GIZ A;  4NMY A;  4PBQ A;  4TLL B;  3KJT A;  1N04 A;  4LZ7 A;  3H6U A;  4N8G A;  4OER A;  3K00 A;  3N26 A;  4TOZ A;  2HFB A;  3HCQ A;  2FHY A;  3M3L A;  3FUZ A;  3TCF A;  4O94 A;  4PE5 B;  3WAF A;  2Y7I A;  1EU8 A;  2NWJ A;  4RXL A;  5ICQ A;  2OK2 A;  3MZB A;  3TTR A;  1MDP 1;  1DPP A;  1PEB A;  1O63 A;  2DYX A;  1VFE A;  5KDT B;  4DXC A;  3CI8 A;  4WED A;  5L9S A;  2H99 A;  1LBC A;  4ZEI A;  5EQ8 A;  2HAV A;  3C34 A;  3PPQ A;  2NXO A;  4RA1 A;  4MCO A;  3MZ1 A;  3UOR A;  1QUJ A;  2D3I A;  1LFH A;  1XHY A;  5A5X B;  5JTY A;  4MLV A;  3P7I A;  4NWD A;  2QVU A;  2XXU A;  3KN3 A;  4G68 A;  1LFI A;  1FTM A;  1PB8 A;  1SBP A;  1LGB C;  3KSJ A;  5M2V A;  4BDR A;  1B4Z A;  2HAU A;  1YTV A;  4PAK A;  4RPO A;  1A55 A;  1B32 A;  2UYE A;  3SEU A;  2VD3 A;  1CNQ A;  2ALU A;  3KN8 A;  1Y3Q A;  3FBP A;  2O84 X;  1VFD A;  5H8H B;  4F3B A;  4KQP A;  3KG2 A;  2RC8 A;  3PV0 E;  1IMA A;  3IFA A;  4GWU A;  4AS5 A;  1RDZ A;  3S9L C;  2DE2 A;  2DDK A;  3T9H B;  1OLC A;  3PUW E;  4ISU A;  1NNF A;  1JEU A;  3SEW A;  3LR1 A;  4UAB A;  1SW5 A;  2O6A A;  3PPO A;  1IXC A;  5TU0 A;  2PT2 A;  3BBR A;  1NV0 A;  1G0I A;  1B4H A;  1MDQ A;  1WOD A;  2XXT A;  4H5G A;  4JVI A;  3IO4 A;  3LSL A;  4XKP A;  4QRZ A;  1MM7 A;  3MVY A;  1QKB A;  2RCA A;  4P0G A;  1A54 A;  4PC9 A;  4FEC A;  4X1B A;  2OWT A;  4F29 A;  3G3J A;  1QKA A;  2H9B A;  4EDP A;  2H5Y A;  2MKZ A;  4BDQ A;  1FPF A;  2I48 A;  2Y5K A;  1WVJ A;  4C0R A;  1NH8 A;  3H6T A;  3KOT A;  5FHN A;  1Z7N E;  4ESX A;  2V4C A;  4U4S A;  1B5H A;  5ET5 A;  1NH7 A;  3C35 A;  2Q89 A;  2YPN A;  4MH5 A;  1DOT A;  3E9X A;  2F7C A;  4F18 A;  1DTZ A;  3OSQ A;  2ZZX A;  4MF3 A;  3U92 A;  2M8C A;  2QRY A;  1OLA A;  1VSO A;  1B46 A;  4H5F A;  1S9T A;  1NV2 A;  2AYS A;  3HPI A;  2DOJ A;  5IZ3 A;  2ANJ A;  5ELV A;  2PX1 A;  4GL8 A;  4X48 A;  4K3F A;  1K9Y A;  2ZYM A;  3VE1 B;  4QFO A;  2B65 A;  3IX1 A;  3B8B A;  5EYG A;  4QHQ A;  2G93 A;  1VDW A;  5KCJ A;  4ZZA A;  4O3A A;  2VHA A;  1FSA A;  4H8I A;  4P3L A;  4PGN A;  3TCH A;  2HQ0 A;  4ZED A;  5K2X A;  2OPD A;  4LA9 A;  5DYH A;  2O51 A;  5H8N B;  1XT8 A;  2Y7W A;  1NNT A;  3VV5 A;  5B70 A;  4GD5 A;  2I58 A;  1SW1 A;  4NAP A;  1N7W A;  4OVQ A;  3CHG A;  3QXM A;  2QS1 A;  5I56 B;  1LB8 A;  1BP5 A;  4HE1 A;  1JNF A;  3FZV A;  3CG1 A;  4DCX A;  1H76 A;  3PUV E;  2H98 A;  4DCY A;  1MY3 A;  5IKB A;  1TFA A;  1XS5 A;  2RKM A;  1NV4 A;  3HO7 A;  3VXB A;  1IXI A;  1IEJ A;  1LBY A;  2QJE A;  1LBB A;  3UA8 A;  3S9E A;  3KC1 A;  4FAT A;  3KC0 A;  3K6U A;  3C31 A;  3EKI A;  5IGA A;  4JSD A;  1IMB A;  1B52 A;  4RY1 A;  1DK4 A;  2XHD A;  2E1S A;  4MHF A;  4DXU A;  5JEI A;  4R74 A;  4XTC Q;  2XXP A;  3K02 A;  3SEX A;  4RNS A;  1H44 A;  4X9T A;  1GGG A;  2UXA A;  2ZYK A;  1FBE A;  3DP8 A;  2UVJ A;  1OIB A;  3TDJ A;  1YCJ A;  1FQF A;  3QSL A;  4YZZ A;  1RDX A;  1P1U A;  3V5A A;  4UAC A;  3KEI A;  5K2Y A;  4HE0 A;  1AMF A;  3LUY A;  3TMG A;  5I58 B;  2R9J A;  2Y7K A;  4AQ4 A;  3GXA A;  3ZKK A;  2HXW A;  4GXA A;  4IO6 A;  2DWH A;  2XXY A;  1MPB A;  1MH3 A;  1B40 A;  4HS7 A;  2X26 A;  2X7P A;  4OVT A;  5TPA A;  3KSX A;  4GFR A;  3MYU A;  5LTC A;  5DEX B;  2PMS A;  4YAH X;  1SI1 A;  4BDN A;  5CMB A;  3H6V A;  1JQF A;  1AWB A;  3OO8 A;  4PCD A;  1LAF E;  3TUS A;  2I49 A;  3ONM A;  2VPO A;  4F22 A;  1MXX A;  3FXU A;  4U2R A;  2XXK A;  3GBB A;  1URG A;  3FV1 A;  3IR1 A;  2G29 A;  3MBP A;  3T9X B;  1GVC A;  3T66 A;  2HXR A;  2D21 A;  4I3E A;  1FQB A;  1MPD A;  1FBG A;  2ZMB A;  2V3U A;  4OTE A;  2B4L A;  4PAF A;  3TYH A;  5LOM A;  1LCT A;  1SI0 A;  4NF5 A;  3PTY A;  4I62 A;  3V8X B;  1FBD A;  1QJM A;  1SYH A;  2ONS A;  2NVU B;  4U21 A;  1NI9 A;  4ZS9 A;  3ILU B;  4IO3 A;  4H0W A;  3T9U A;  4AB6 A;  1MY4 A;  4PE3 A;  1TT1 A;  2F35 A;  3IO6 A;  3K0V A;  3E4R A;  2O1L A;  4NHB A;  1FQD A;  4QSE A;  1B7H A;  3B6W A;  3OD7 A;  4PFU A;  2V25 A;  4YKK A;  1NV3 A;  5CBS A;  2WX9 A;  4PFI A;  4ZEC A;  4MAG A;  2DE3 A;  3UIF A;  1MS7 A;  3HV1 A;  4P11 A;  1Q9D A;  3N6T A;  3QUF A;  3PPP A;  3E3K A;  3CIJ A;  4C1U A;  1JVX A;  2XXW A;  4XKN A;  3Q27 A;  5CRY A;  4GWX A;  4RJZ A;  3IOT A;  1FQC A;  3ROJ A;  2Q9T A;  3U72 A;  2BJJ X;  4NF6 B;  1USY H;  4KYD A;  3U1O A;  1MXZ A;  3M8U A;  1IMC A;  4ELO A;  3UP9 A;  3TKD A;  1CB6 A;  1UTH A;  3SET A;  3FXR A;  3PU5 A;  3H06 B;  4PQJ A;  4N91 A;  4FBP A;  5B7D A;  3OO7 A;  1IQ7 A;  3PGF A;  4IY5 A;  1B2H A;  2D5W A;  3H4Z A;  4DE8 A;  3K4U A;  4BDM A;  3CSB A;  2O7U A;  5JK4 A;  3IB0 A;  5ET6 A;  3TTK A;  4H8J A;  4N4U A;  4OFO A;  1FPE A;  1MPC A;  4KCD A;  3C9H A;  5FTH A;  3THI A;  4I3Y A;  4NF0 A;  1R1N A;  4HCY A;  4PFW A;  1FTA A;  2VPN A;  1TWY A;  2Q88 A;  2P1S A;  3FVK A;  2WYK A;  4OVS A;  1UTB A;  3U93 A;  3K6X A;  2RC9 A;  1HSL A;  3RQT A;  1GV8 A;  3C32 A;  4X8R A;  1RYX A;  2Z8F A;  3BIH A;  1Y3P A;  4FJP A;  1B7U A;  4OZ9 A;  3TEL A;  2O1M A;  4GWW A;  3V83 A;  1SYI A;  1MG1 A;  3T1B A;  5A5X A;  5H8Q B;  1MXW A;  4ZEB A;  1YZ0 A;  2XWO A;  1ZLQ A;  4RK2 A;  3C33 A;  3U65 A;  1B3F A;  3IAZ A;  1T0K A;  2WBB A;  3D1R A;  2DS9 A;  4PDH A;  1AL3 A;  2XXI A;  2GH9 A;  1M5C A;  3TPA A;  2W7Y A;  3QAX A;  1Q35 A;  4Q30 B;  2YJP A;  5I2K B;  1N7X A;  3Q29 A;  2DVC A;  5H8H A;  4ELP A;  4PF6 A;  4BDL A;  1RYO A;  4U1Z A;  4XEQ A;  1FCK A;  3MVX A;  5I3S A;  3D4G A;  4NF8 B;  5EQ9 A;  4E0W A;  2X7Q A;  4PFB A;  4QSD A;  3C4M A;  3KBR A;  2I0B A;  4G77 A;  4OXV A;  4MX6 A;  3EN3 A;  2VD2 A;  5FHM A;  4ZE8 A;  1Y9U A;  1MQD A;  3RUM A;  1NUX A;  4KFQ A;  2OLB A;  4GBW A;  1NUY A;  3LSX A;  2QS4 A;  3AXF A;  5IAI A;  3CG3 A;  5ITO A;  3MUQ A;  2QMW A;  2Z8D A;  3LSF B;  2DSF A;  5EHM A;  3HHF A;  2ZNS A;  4EXL A;  3T22 A;  3USD A;  2CZL A;  4PBH A;  3N94 A;  4JWO A;  4H6D A;  2HCA A;  1QW0 A;  2XD3 A;  4EQB A;  2DP8 A;  2VP1 A;  4G8M A;  3OEK A;  1FTK A;  5I57 B;  3MWB A;  1MQJ A;  4LAT A;  1MY0 A;  4F39 A;  1B7Z A;  4P0I A;  1LFG A;  1OVB A;  3IOV A;  1S7Y A;  3B6Q A;  1URD A;  3E13 X;  4P9K A;  3C36 A;  3U94 A;  4QFK A;  3CSG A;  2DXY A;  3O6G A;  1HSE A;  2NUV A;  3O6I A;  3PMV A;  4F1U A;  2A5T B;  2WEF A;  5ET7 A;  1R9Q A;  1US4 A;  2F7B A;  1PB9 A;  3VLU A;  2F97 A;  3FD3 A;  1LAH E;  5F24 A;  1FRP A;  3Q25 A;  1Y3N A;  3RT6 B;  1AH5 A;  5HBC A;  3TZA A;  4LP2 B;  2NOO A;  3EHU A;  3OO9 A;  4EF1 A;  5DVF A;  4P1L A;  3DP6 A;  2DXR A;  5I7I A;  5H8N A;  1OQH A;  4HE2 A;  2Y84 A;  4N8Y A;  5AA4 A;  3FJ7 A;  5EHS A;  5IM2 A;  1B3L A;  5TP9 B;  2F8D A;  3MVW A;  4DXB A;  4POW A;  5I56 A;  3MAM A;  4GRK A;  2XA5 A;  2VGQ A;  4WKM A;  3RPL B;  5CI5 A;  3O2A A;  1DPE A;  4F1Y A;  1EZP A;  4I40 A;  4OFJ A;  1LST A;  1NL5 A;  1LAX A;  4NGU A;  2F36 A;  1NFT A;  4R6Y A;  4Z0I A;  5I2N B;  1JEV A;  3LUZ A;  4QFL A;  1Y4C A;  3VXC A;  3VDF A;  4RYA A;  1IIT A;  5BUU A;  2AIX A;  4MNP A;  2O68 A;  4OHN A;  3WAE A;  2ZYO A;  3FXB A;  3O97 A;  1A7L A;  3K2D A;  4FE8 A;  4FOR A;  3OO6 A;  4XKR A;  1FTO A;  2OCU A;  4LON B;  4H1X A;  3RT8 A;  5H8F A;  1UIV A;  1TXF A;  2ZNU A;  2AL4 A;  3TTN A;  3CRB A;  4IO7 A;  5FTI A;  1URS A;  3MC2 A;  3TQW A;  4IY6 A;  2Q8J A;  4YMB A;  1BTJ A;  5AA2 B;  5I58 A;  3SEV A;  2QVR A;  2E0S A;  4U23 A;  4GF8 A;  1ZJL A;  3D4C A;  3CR9 A;  4IO2 A;  4IO4 A;  4JVC A;  1SW4 A;  4O8M A;  3FAT A;  3K6W A;  1QUK A;  2DVZ A;  2V3Q A;  3SEY A;  4PDD A;  3OEM A;  4QF9 A;  5F7V A;  5I59 B;  3KBZ A;  4GQO A;  3SDF A;  2KR0 A;  1NUZ A;  2FIE A;  4NWC A;  3BIG A;  1N84 A;  3T0J A;  1OMP A;  2REJ A;  3K1N A;  3TCG A;  1BIY A;  2HEU A;  5KCJ B;  2Y7P A;  4L17 A;  4EXK A;  3ECR A;  3M3K A;  3G3G A;  1H3D A;  1ANF A;  1FQE A;  2OZZ A;  1IIW A;  4QFN A;  2DWJ A;  2ZXT A;  4NF4 B;  4PFT A;  1JW4 A;  1QVS A;  2O69 A;  4GX4 A;  4KD5 A;  5I5P A;  4NQ8 A;  5BWJ A;  4Q5T A;  3KZG A;  4LUB A;  5CM6 A;  4M1V A;  1LCF A;  5KZT A;  3IK6 B;  1FPB A;  3TFL A;  1L5T A;  1YYZ A;  4G4P A;  5ITP A;  3O6H A;  4XF5 A;  1NKX A;  4QSC A;  3H3G A;  3O28 A;  1XI6 A;  1R9L A;  1FPK A;  1FTJ A;  3S2V A;  1NUW A;  2CZH A;  4FAJ A;  4POX A;  4IR8 A;  2OPE A;  3K1M A;  4ELR A;  1FBH A;  1FW0 A;  4G68 C;  2ZZV A;  1N3X A;  1POY 1;  1NNK A;  3PUY E;  4O3C A;  3RLF E;  4ECF A;  5LDZ A;  2VOZ A;  2PFZ A;  3QIM A;  2L5V A;  1SQY A;  1KA1 A;  5EYH A;  1D3K A;  2CEX A;  3VVD A;  3Q28 A;  3VVE A;  3R6U A;  2V84 A;  5CC2 A;  2RC7 A;  3MP6 A;  4ELQ A;  4R6H A;  1DMB A;  1MM6 A;  1B9J A;  3M3F A;  3IJX B;  2F5X A;  4OMB A;  1USY E;  4EF2 A;  2ZNT A;  3PUZ E;  4R2B A;  3PUX E;  3QK6 A;  2Q74 A;  3LSW A;  2FVZ A;  1D9Y A;  3W9V A;  2THI A;  1H45 A;  3PMW A;  1MY1 A;  1NV1 A;  1D4N A;  1S50 A;  4H65 A;  1N76 A;  4MEV A;  4N17 A;  2XXQ A;  2DWA A;  2IEE A;  1IMF A;  4JWX A;  1MRP A;  4F19 A;  5AA3 A;  3TTM A;  3B7D A;  4LQ5 A;  1A8E A;  4NE4 A;  4Z7E A;  3G7W A;  4OVP A;  1LBW A;  2CZI A;  4P47 A;  1RKM A;  2QL3 A;  3E78 A;  1DCU A;  1JP4 A;  3ZS6 A;  1M5E A;  1P1O A;  1IMD A;  2XX7 A;  3DP4 A;  5HM4 B;  4OES A;  1MXV A;  1B1H A;  5CMM A;  4JDF A;  2Q2C A;  3SES A;  2OJT A;  4ZEF A;  4ZZE A;  1OVT A;  4GBV A;  4NF5 B;  2ONR A;  2OWZ A;  1Z7M E;  3JV9 A;  1IME A;  1MQH A;  4XIG Q;  5IZZ A;  1R6Z A;  4OA4 A;  3JYR A;  4PGP A;  4F1V A;  1MY2 A;  1CE2 A;  3G3I A;  1B3E A;  1LB9 A;  3G3F A;  3RN8 A;  1MXU A;  3QYT A;  4JB7 A;  3A29 A;  4BDO A;  4U1O A;  4NED A;  2XXX A;  3B50 A;  1FPD A;  3FVO A;  4IO5 A;  4HW8 A;  1K9Z A;  4M4G A;  2ZYN A;  3HFU A;  5KDT A;  5I2K A;  1IXH A;  4GWS A;  4KYS A;  5L8D A;  1NV6 A;  1I6B A;  4ND9 A;  2Y5L A;  4PFR A;  4O7M A;  3IJO B;  3B6T A;  2QMX A;  2O7I A;  1IZ1 A;  4R73 A;  2QSX A;  3OMB A;  4NF8 A;  1GR2 A;  3G3H A;  3R26 A;  4JWY A;  5J16 A;  4TQU Q;  3N5L A;  1IXG A;  2QFL A;  5ET8 A;  3T93 B;  4GX6 A;  4N13 A;  2GFE A;  4XXU A;  5AA2 D;  3OXN A;  2DQV A;  3IB2 A;  2PCR A;  2QS2 A;  3EF7 A;  1PDA A;  4U22 A;  2FYI A;  3RY3 A;  1A8F A;  4KCC A;  1SPI A;  1LBV A;  1J1N A;  4AB5 A;  2FBP A;  3MP8 A;  1NMU A;  3CFZ A;  2OBG A;  5AA1 A;  3LBS A;  3ZSF A;  4ESW A;  1ZU0 A;  1MQI A;  4UA8 A;  1ZKB A;  3BKI B;  3RPW A;  4OYV A;  3U8Q A;  4N6D A;  4PAI A;  2XWI A;  1UTB B;  4MLQ A;  2HPG A;  3K6V A;  4MMP A;  4QBA A;  4R2F A;  2LAO A;  2PYY A;  4GOT A;  1B51 A;  2RIN A;  5I57 A;  3MQ9 A;  2KQZ A;  1KA0 A;  2UVI A;  3O29 A;  3I6V A;  2BJI A;  1EH3 A;  1AIV A;  4I1D A;  2PBW A;  4DLD A;  4DDD A;  1VE4 A;  4OVJ A;  3MVZ A;  4P1E A;  3FIR A;  2P2A A;  3KJ7 A;  2H4I A;  1P99 A;  3GLB A;  2A5T A;  4F3S A;  4JXI A;  1UQW A;  3SER A;  2CZK A;  3S4U A;  3UN6 A;  2F78 A;  1QUL A;  3HN0 A;  2UYF A;  4R6K A;  4PTK A;  3PPN A;  4YB6 A;  1D9V A;  3ILT B;  4R72 A;  2HHM A;  4PET A;  3RTF B;  2FA7 A;  4R75 A;  2UVG A;  1BKA A;  1ZIU A;  4G8N A;  2GHA A;  4OFL A;  4I9D A;  3LV0 A;  4XFE A;  2FIX A;  3A3U A;  4GX3 A;  4U4X A;  5IZ1 A;  4HXV A;  3T9V A;  4LN5 A;  2HZL A;  4JSO A;  2F34 A;  2XWK A;  1Y1M A;  3QMF A;  1B58 A;  1EYJ A;  3H03 A;  1MH4 A;  1B3H A;  3IOW A;  4LQ2 A;  4RPN A;  1B3G A;  1XOC A;  4OET A;  5JTY B;  2XX8 A;  2RCB A;  2HZK A;  5TP9 A;  2CEY A;  4XKQ A;  3EPE A;  4F2Q A;  4G68 B;  1B5J A;  4AS4 A;  4FED A;  4FEB A;  1AOV A;  3MPL A;  2GRV A;  3RPL A;  4DIG A;  2R6G E;  4PFY A;  3UGW A;  4NX1 A;  2GHB A;  1DTG A;  1KWH A;  4IB2 A;  4OEN A;  1Q1K A;  3FJG A;  5I2N A;  1FPL A;  4OVR A;  1JW1 A;  3VVF A;  3MJN A;  3W9W A;  3VLV A;  3FGS A;  3KN7 A;  3TQL A;  2QPQ A;  1LEV A;  2XXR A;  1ZMG A;  2VT5 A;  2XXH A;  2I3W A;  4ZE9 A;  2R71 A;  5EQ7 A;  4YKI A;  5HPQ A;  3A09 A;  4KI0 E;  2R8T A;  1LLS A;  4LVQ A;  3VFJ A;  1NNP A;  1PC3 A;  3OOA A;  4N81 A;  4TLM B;  1FBP A;  4I8C A;  1SD3 A;  3UK4 A;  1NV5 A;  3O9P A;  2AL5 A;  2Y7R A;  5ICT A;  5EYF A;  5T3J A;  3KGC A;  2I0C A;  4QFP A;  4OWD A;  5FHO A;  5AA2 A;  4EUO A;  4RK9 A;  4H46 A;  4OQO A;  4EQ9 A;  1D9Q A;  1I6Q A;  2I4B A;  4NG7 A;  1US5 A;  4KYE A;  4HTG A;  4MBP A;  1MQG A;  5I84 A;  4GL0 A;  4H45 A;  3H7M A;  2WYP A;  1B0L A;  3S9N C;  1M5D A;  2A5S A;  5I59 A;  3GBA A;  1B05 A;  3A3C A;  2Q8M A;  4P8B A;  3Q26 A;  2F3B A;  1PB7 A;  1XVX A;  4YB7 A;  2P0S A;  1FQA A;  5ESY A;  4MFI A;  1XC1 A;  5L9M A;  2I6E A;  1NV7 A;  1I69 A;  3OEL A;  4DI4 B;  1FBC A;  5FBP A;  2V93 A;  3SKP A;  2B3F A;  2ZZW A;  3MZ9 A;  4MNC A;  4PF8 A;  3FJM A;  5F1Q A;  4GVO A;  4OAN A;  4NN3 A;  2B3B A;  5AA4 B;  4NF4 A;  5DT6 A;  1Y1Z A;  1M5B A;  3LC8 A;  1EZO A;  2Q2A A;  2B4M A;  3JZJ A;  2XXV A;  2OWS A;  1KZ8 A;  1YAE A;  2ABH A;  3RYD A;  3IFC A;  1YXI A;  1OQG A;  1VR5 A;  3IB1 A;  3BFU A;  4DZ1 A;  5DVJ A;  1LBX A;  4GWY A;  1EYK A;  5IZ3 B;  1QUI A;  5DEX A;  4GLI A;  4GWZ A;  3F11 A;  2I4C A;  1GTK A;  3E79 A;  5AE4 A;  1O64 A;  1LAG E;  1B0H A;  3IL1 B;  2ESN A;  5J1D A;  3RTW B;  3I5O A;  4YIC A;  3ISP A;  3FV2 A;  4JBZ A;  4GWO A;  3EQ1 A;  5L9O A;  5H8F B;  4JVD A;  3GYY A;  4OEV A;  1BLF A;  2F7A A;  4O7I A;  2PVU A;  1IUD A;  4KHZ E;  3MP1 A;  1POT A;  4LZ8 A;  1XVY A;  3PPR A;  5H8S A;  2RF1 A;  1DSN A;  3CVG A;  2YLN A;  5CBR A;  1PBQ A;  1WDN A;  1F9B A;  2Z22 A;  1SDX A;  2XWV A;  4YU0 A;  1HSJ A;  4E0X A;  3PD9 A;  4GXS B;  5A5L A;  3K01 A;  3MW0 A;  1ATG A;  3BFT A;  4H67 A;  3W15 C;  2ONK E;  1A99 A;  1FPJ A;  4F2O A;  5DVI A;  1ZTY A;  3L6G A;  3O66 A;  3EHS A;  4ZDM A;  3VLW A;  1FPI A;  1ZBM A;  3MPK A;  4WXJ A;  3FAS A;  2F3D A;  2UVH A;  3DLN A;  4IGT A;  4KXP A;  4N6K A;  4G2Z A;  4C1T A;  5DW8 A;  4G61 A;  1B6H A;  1SW2 A;  1FJ9 A;  2REG A;  3T96 B;  1P1Q A;  4NF6 A;  4PP0 A;  5EQA A;  3DEL B;  4X1D A;  1O7T A;  3HST A;  3TOD A;  2KLF A;  3S9M C;  3K1P A;  4WEP A;  1YPN A;  2Z23 A;  3N6U A;  3ODB A;  3HHG A;  4ONY A;  4BLA A;  1JVY A;  4N15 A;  1FPG A;  1H43 A;  2F6P A;  1PBP A;  1LBZ A;  3NOH A;  4QXD A;  4R9F A;  4Q8R A;  1Y4T A;  1G0H A;  1TFD A;  4MNI A;  1ELJ A;  4THI A;  3DM0 A;  5TPA B;  2P3N A;  4P56 A;  3TAJ A;  4YMA A;  1JET A;  1UIU A;  3CFX A;  2H25 A;  1P1N A;  4X04 A;  4F31 B;  1Y20 A;  1FBF A;  1DBZ A;  2GQ1 A;  3TTL A;  1FJ6 A;  4G8H A;  3SZP A;  4KPT A;  4R9G A;  2P3V A;  2PFY A;  2QS3 A;  4F3G A;  3L6H A;  3KOS A;  3PMX A;  3KFM A;  4O3B A;  3PD8 A;  4F3P A;  1RDY A;  1BK4 A;  3ZKL A;  2IA4 A;  4YKJ A;  3RGY A;  3OEN A;  4N6P A;  3CFL A;  4MJO A;  1SVX B;  3IOU A;  2DE4 A;  5H8Q A;  1B1X A;  3EHT A;  2V3T A;  3I3V A;  4KR5 A;  4NTL A;  3H6W A;  3TEP A;  4YKP A;  4HCW A;  4LZ5 A;  4Q0C A;  3OSR A;  2FNC A;  5DTB A;  4YB5 A;  2OX3 A;  4MIJ A;  4FIM A;  1M5F A;  1MXY A;  1FTL A;  4IGR A;  2CMO A;  5CMC A;  1I6A A;  2WKY A; 
#chains in the Genus database with same CATH homology
 3LUZ A;  3MYU A;  5LTC A;  1INP A;  2CZK A;  4MNP A;  1QGX A;  1AWB A;  4PTK A;  3FXB A;  4PCD A;  2HHM A;  4PET A;  2VPO A;  2XXK A;  3LV0 A;  4XFE A;  2FIX A;  1EYI A;  4GX3 A;  2WBD A;  5IZ1 A;  4HXV A;  2HXR A;  4LN5 A;  2HZL A;  2XWK A;  4I3E A;  3QMF A;  1EYJ A;  1FBG A;  2B4L A;  4PAF A;  4DI3 D;  2QVV A;  2HZK A;  2CEY A;  2QVR A;  3PTY A;  1FBD A;  2JJK A;  3MST A;  4AS4 A;  4PBQ A;  3RPL A;  1NI9 A;  4JVC A;  4N8G A;  4NX1 A;  4O8M A;  4PE3 A;  2DVZ A;  2V3Q A;  4PDD A;  4NHB A;  1FPL A;  4OVR A;  2FHY A;  3KBZ A;  2KR0 A;  1NV3 A;  1NUZ A;  2WX9 A;  4PFI A;  2FIE A;  4MAG A;  4O94 A;  3BIG A;  2DE3 A;  3W9W A;  3T0J A;  2QPQ A;  1LEV A;  1Q9D A;  2VT5 A;  5EQ7 A;  2R8T A;  4GWX A;  3ROJ A;  2Q9T A;  5EQ8 A;  4N81 A;  1FBP A;  1NV5 A;  1IMC A;  5T3J A;  4MCO A;  4GX4 A;  5I5P A;  4NQ8 A;  4N91 A;  5CM6 A;  4FBP A;  4H46 A;  2QVU A;  4M1V A;  1FPB A;  1D9Q A;  1YYZ A;  4XF5 A;  4NG7 A;  4PAK A;  5JK4 A;  4H45 A;  2WYP A;  1XI6 A;  5ET6 A;  4N4U A;  1FPK A;  1CNQ A;  1FPE A;  1NUW A;  2CZH A;  4I3Y A;  4NF0 A;  2Q8M A;  4P8B A;  4HCY A;  4IR8 A;  1FTA A;  3FBP A;  2VPN A;  2F3B A;  1FBH A;  2WYK A;  2ZZV A;  4OVS A;  5ESY A;  1IMA A;  1NV7 A;  3IFA A;  4DI4 B;  4GWU A;  4AS5 A;  1FBC A;  1RDZ A;  2DE2 A;  2DDK A;  5FBP A;  4X8R A;  2ZZW A;  3BIH A;  5LDZ A;  2PFZ A;  2L5V A;  4MNC A;  1KA1 A;  5EYH A;  4PF8 A;  2CEX A;  4OAN A;  4UAB A;  4NN3 A;  4GWW A;  1NV0 A;  1G0I A;  3T1B A;  2B4M A;  1YZ0 A;  1KZ8 A;  2XWO A;  3RYD A;  3IFC A;  1YXI A;  4JVI A;  2F5X A;  1LBX A;  4GWY A;  2Q74 A;  1EYK A;  2FVZ A;  5IZ3 B;  3U65 A;  3W9V A;  4PC9 A;  1NV1 A;  4GWZ A;  2WBB A;  3D1R A;  4MEV A;  4N17 A;  4PDH A;  3E79 A;  2MKZ A;  1FPF A;  2Y5K A;  1IMF A;  4F19 A;  5J1D A;  4YIC A;  2V4C A;  3ISP A;  4PF6 A;  4OVP A;  5ET5 A;  1LBW A;  2CZI A;  4P47 A;  4JVD A;  3GYY A;  4XEQ A;  3E78 A;  1DCU A;  1JP4 A;  4O7I A;  5I3S A;  5EQ9 A;  1IMD A;  4PFB A;  4F18 A;  4MX6 A;  2ZZX A;  4GBV A;  2OWZ A;  1NUX A;  2XWV A;  1IME A;  4GBW A;  5IZZ A;  1NUY A;  1NV2 A;  4OA4 A;  4PGP A;  4F1V A;  5A5L A;  5IZ3 A;  3A29 A;  1FPJ A;  1K9Y A;  3B50 A;  1FPD A;  3B8B A;  5EYG A;  1FPI A;  1K9Z A;  1VDW A;  2F3D A;  3HFU A;  1FSA A;  4KXP A;  4GWS A;  4N6K A;  4P3L A;  4PBH A;  4PGN A;  5DW8 A;  4G61 A;  1NV6 A;  1FJ9 A;  2Y5L A;  4PFR A;  4O7M A;  5EQA A;  4NAP A;  4OVQ A;  3CHG A;  5J16 A;  2QFL A;  5ET8 A;  4HE1 A;  4GX6 A;  4N15 A;  1FPG A;  1LBZ A;  3NOH A;  1NV4 A;  4QXD A;  4P9K A;  2PCR A;  1G0H A;  1LBY A;  4MNI A;  2P3N A;  4P56 A;  3KC1 A;  4F1U A;  3KC0 A;  2WEF A;  5ET7 A;  3EKI A;  5IGA A;  1IMB A;  1DK4 A;  4X04 A;  5F24 A;  1FRP A;  1SPI A;  1LBV A;  4MHF A;  1FBF A;  1DBZ A;  2FBP A;  2GQ1 A;  1FJ6 A;  4X9T A;  3SZP A;  2P3V A;  2PFY A;  4N6D A;  1FBE A;  4PAI A;  4P1L A;  2XWI A;  2HPG A;  4MMP A;  4QBA A;  5I7I A;  1RDY A;  1BK4 A;  4HE2 A;  4YZZ A;  1RDX A;  4N8Y A;  4HE0 A;  5IM2 A;  4MJO A;  2KQZ A;  2DE4 A;  1KA0 A;  2XA5 A;  2BJI A;  3RPL B;  4HCW A;  4I40 A;  2OX3 A;  4MIJ A;  4P1E A;  4NGU A;  4OVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...