5DW8A

Crystal structure of 2'amp bound saimpase-ii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
269
structure length
260
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Crystal structure of 2'AMP bound SaIMPase-II
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 76
structure length 260
sequence length 269
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5dw8A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5dw8A02
4GX6A 1EYIA 2R8TA 1JP4A 1FPBA 2QVVA 1NV1A 1FPGA 5A5LA 5IZ3B 5I3SA 4AS4A 2Y5KA 3RPLA 1IMAA 1FRPA 2P3VA 4IR8A 5EQ7A 5ESYA 1KA1A 1YXIA 1FJ9A 4GBVA 4HE2A 5DW8A 4GBWA 1FBHA 5EYHA 3ROJA 3FBPA 1FBDA 1LEVA 3IFAA 1FBPA 1NV3A 1NUZA 1NUXA 5EQ8A 2CZIA 1IMEA 1FPKA 1SPIA 5T3JA 5EQAA 2FHYA 3BIGA 1BK4A 1FSAA 4GWYA 1FPFA 5ET5A 2OX3A 4FBPA 5ET7A 1FPIA 1RDXA 2DDKA 4I40A 5J16A 1FBEA 4GWUA 2WBBA 1NI9A 1EYKA 5IZ1A 3T0JA 1NV0A 2FBPA 1LBWA 1YZ0A 2GQ1A 1NV6A 2QVUA 4H45A 3RPLB 1DK4A 2FVZA 1XI6A 4O7IA 1Q9DA 1IMCA 2Y5LA 1LBVA 4HE1A 2HHMA 1D9QA 1YYZA 2WBDA 3QMFA 4HE0A 1LBYA 1IMFA 5F24A 5LDZA 4N81A 4KXPA 1NV7A 2VT5A 1G0IA 4GX3A 4I3EA 1FTAA 1DBZA 1NV4A 1KA0A 2F3DA 1FPLA 1DCUA 1FPJA 1RDYA 1K9YA 2WEFA 3IFCA 3LV0A 5ET6A 4G61A 1CNQA 2QFLA 1NV2A 1FJ6A 5EQ9A 2OWZA 1INPA 4GWZA 5ET8A 3KC1A 1FBGA 1KZ8A 1LBZA 3BIHA 4MJOA 4AS5A 2CZKA 2PCRA 3LUZA 2Q8MA 1NV5A 4HXVA 1NUYA 1RDZA 1EYJA 2CZHA 4GWWA 4GWXA 1K9ZA 1FPDA 2P3NA 4GX4A 1LBXA 2Q74A 1IMDA 3RYDA 2F3BA 3KBZA 2FIXA 4GWSA 4QXDA 2FIEA 3B8BA 2BJIA 2JJKA 1NUWA 4H46A 5EYGA 4PTKA 5IZ3A 1G0HA 3A29A 1AWBA 1QGXA 1FPEA 4I3YA 1VDWA 2QVRA 5FBPA 1FBCA 1IMBA 3KC0A 3D1RA 1FBFA
chains in the Genus database with same CATH superfamily
5JTYB 1SW4A 4KHZE 1IQ7A 4AS4A 4X1DA 1MQDA 1IMAA 4R75A 1XC1A 3KJ7A 1M5CA 3VDFA 4FJPA 3R26A 2OK2A 1A7LA 1VR5A 3E78A 3FJ7A 1MG1A 3HCQA 3JZJA 1NUZA 3GXAA 4JXIA 3FXUA 4H67A 4H5FA 4UABA 4FBPA 5ET7A 1LLSA 5AA2D 1FTMA 4BDNA 3LSLA 4GWUA 3MWBA 4OXVA 1B05A 1QULA 3RN8A 2I49A 1MM7A 2H98A 1MDP1 4PF6A 2WBDA 3AXFA 3OSQA 2F5XA 1NV7A 1A54A 1N3XA 2I48A 2XD2A 4G68A 1KA0A 3MZ1A 2V3TA 3FATA 3W9VA 1B1XA 2YLNA 3PU5A 4UA8A 2B3BA 4R6KA 4LVQA 3N94A 3SEXA 1NUYA 4R9GA 1TFAA 2WX9A 2DVZA 3TTMA 3IK6B 3QUJA 4MCOA 1N76A 1OLAA 1B2HA 2ZNTA 1XVYA 5AE4A 2ANJA 4FECA 4MBPA 1LCTA 4L17A 3A29A 1IXCA 5H8NB 4H8JA 1DK4A 4NWCA 4I8CA 4G68B 2R8TA 2VPNA 4PDHA 2O68A 4YMBA 3CIJA 2NWJA 4QFLA 4IO7A 3K6XA 1MPCA 2PT2A 3H6TA 2PX1A 1ELJA 2I0CA 4XKQA 3T22A 1B58A 2XXYA 1Y3QA 1T0KA 2ONRA 3B6WA 3PPNA 4GBWA 3E9XA 3ZS6A 5CBSA 4N07A 1FBDA 3SEYA 4LP2B 1JVXA 4OFLA 1BIYA 3FD3A 4QSEA 3IOTA 3K1PA 3QUFA 3JV9A 4HTGA 2HFBA 3E4RA 4LONB 2IEEA 1R6ZA 4ZZAA 3TDJA 4ELRA 4YAHX 4NTLA 3H4ZA 3FUZA 3T9VA 4HW8A 1IMCA 2ESNA 3S4UA 3C35A 4RNSA 4QFOA 4DZ1A 4NN3A 5HPQA 3IOWA 2XWKA 5AA3A 1DBZA 3OSRA 2PT1A 4U22A 1B32A 1FPJA 5ET6A 5K2YA 1FJ6A 1B4HA 1LBZA 1M5EA 1Q35A 1FQFA 2YJPA 4H8IA 1TT1A 2VHAA 3C31A 4EF1A 3KBZA 2FIXA 5CMMA 4QXDA 3CFLA 2RC9A 5EYGA 3HPIA 4ELPA 2GHBA 1A40A 3D1RA 3TTNA 1IXIA 1OQGA 3OXNA 1QUKA 2B4LA 1EU8A 2XXHA 4ZE8A 1XT8A 1XHYA 4GXSB 3OO6A 2ZZVA 5I2KA 4ZZEA 3MJNA 1NNFA 3CG3A 1D3KA 3IX1A 3MZBA 3IR1A 4FEDA 1B52A 2REJA 1P1OA 1FSAA 5L9OA 3G3JA 3B50A 4G2ZA 2R9JA 3K6WA 2UVHA 4R73A 1LBWA 2LAOA 3UK4A 1RKMA 4H45A 2Q88A 4ZEKA 1NL5A 2HXRA 4NF4A 2WKYA 3PV0E 3PPQA 4DXUA 2XXVA 4N17A 1Y20A 4KYEA 3Q27A 1UTBA 5FTIA 4X04A 5I2NA 1NV4A 3UP9A 1DCUA 4GQOA 3LV0A 2FA7A 4I9DA 2DS9A 3H6UA 3BIHA 4YICA 1JNFA 1Z7NE 1MQGA 3ILUB 3CG1A 1MS7A 1N7XA 1NNPA 3MYUA 3MQ9A 4NMYA 1LCFA 4NF4B 2AIXA 3ISPA 4BDLA 1LAGE 4NF5B 4ESXA 4N6KA 3FJMA 3SETA 4E0XA 4LQ5A 3KC0A 4G68C 3H6WA 1UTBB 2RF1A 2RCBA 3SEUA 5KCJA 2QVVA 4PFRA 1EH3A 3G3KA 4M1VA 5IZ3B 2I0BA 1PEBA 2ZZXA 2ABHA 4OERA 1FTKA 3TTLA 3NOHA 2QRYA 2F7BA 1A99A 4F3SA 3SESA 3RTWB 1JVYA 4MNCA 3H03A 4NGUA 4MHFA 3C36A 2RC7A 1N7WA 2ZYOA 3LSWA 1JEVA 1LBBA 5ISUA 1FQDA 1B7ZA 3QAXA 1FPIA 1P99A 4NWDA 4WXJA 4TQUQ 3GBAA 3OOAA 4YU0A 1EYKA 1MQJA 5KCJB 2CMOA 3LUYA 1A8EA 2ZYKA 3TQLA 4GD5A 2OCUA 4PFWA 1URGA 4IO6A 2O51A 2I58A 1MY4A 4JBZA 4GL8A 3T66A 5M2VA 4U4SA 1Y1ZA 4H0WA 4YKIA 4GX3A 1QJMA 1S50A 1QUIA 4PAIA 5I59B 2X7PA 2F6PA 3IFCA 1NV2A 1POY1 3IO4A 5TP9A 4KCCA 2I6EA 3GZGA 4MNIA 4IB2A 3O28A 3FGSA 2D5WA 1LBXA 2V25A 4Z7EA 1B7UA 3DP4A 3OEMA 1IIWA 1OMPA 4I3YA 5TPAA 1SVXB 2XXKA 1HSEA 3GLBA 1RYXA 4G8MA 4OVRA 3TPAA 4PFYA 3TCHA 3D4CA 5I3SA 1S9TA 2RINA 1NH8A 2H9BA 3KOSA 1GVCA 4JWXA 3K01A 3DLNA 3ZKKA 4H5GA 1DPPA 1URDA 1FBPA 3KG2A 2QS2A 4FORA 4RY1A 3C34A 5EQ8A 4PETA 1SPIA 1FPFA 1O63A 4NX1A 2V84A 2DDKA 4EXKA 5H8QA 1O64A 3K2DA 2ONSA 2X26A 2DE4A 3PUZE 4JDFA 1JEUA 2Y7WA 1P1WA 3IAZA 1Q9DA 2E0SA 4PAFA 2Q8JA 1URSA 3TZAA 4G4PA 4RK9A 3MVZA 3V83A 3IO6A 1MXWA 4ZE9A 3KC1A 3MVWA 4BDRA 5H8QB 2O69A 3CHGA 2D21A 2DXYA 4GWWA 4GWXA 3OENA 3TEPA 2XWIA 3TAJA 4KYDA 1ZBMA 3IOVA 4ZEFA 5JTYA 1FW0A 5LTCA 3I3VA 5DEXB 4POWA 3G3FA 1VDWA 1JQFA 4IO5A 4MIJA 4JVCA 3CR9A 1ATGA 2Z8DA 1YPNA 4QRZA 2Y7IA 3W9WA 4P9KA 5I5PA 2QPQA 2DYXA 3KBRA 2ZZWA 5L9MA 3RT8A 4LZ7A 1IXGA 3OO8A 3ZKLA 3KSXA 1R9QA 1D9YA 4QSCA 1J1NA 2BJJX 3BIGA 2OX3A 1DPEA 2F8DA 1Z7ME 3W15C 5DVJA 3SZPA 5IZ1A 2GQ1A 4PQJA 4OMBA 3A3UA 4NE4A 5HM4B 3IJOB 4G77A 1D9QA 3RUMA 1B4ZA 4OFJA 2F35A 2UVIA 4LN5A 2XXXA 3I6VA 4H65A 2X7QA 4M4GA 3IJXB 3HHGA 4Q30B 4PBHA 2HEUA 5CC2A 1FBGA 2CZKA 3IB2A 5EHSA 2XXWA 3R7XA 5H8NA 2XXRA 2Q74A 1IMDA 3Q26A 4OESA 3B6QA 2FIEA 2UXAA 2HAVA 1FTJA 4RYAA 5ICTA 2Y7RA 1G0HA 4O8MA 4OA4A 3TODA 3G3GA 4C1TA 3QK6A 1Y1MA 4P0GA 1B5HA 1MXUA 4KFQA 3G7WA 3V89B 1A55A 2F7CA 2F36A 3A09A 3EF7A 5ICQA 1ZLQA 5FTHA 1A8FA 5AA1A 4PCDA 1TWYA 1P1QA 4NQ8A 3SKPA 3N5LA 3O2AA 1FBHA 5ITOA 3K02A 4UACA 3IL1B 1NUXA 4GIZA 1BK4A 4AB6A 1RDXA 4QHQA 2AL4A 5KZTA 1Y3PA 1OQHA 1NNKA 5F1QA 2FBPA 1R9LA 4PFBA 4YKKA 4G8HA 1NKXA 3UORA 3T9HB 1ZKBA 4THIA 3QMFA 3KN3A 3CFZA 4GFRA 1HSLA 2I3WA 4EQ9A 2VT5A 3EPEA 5I57A 4YZZA 2XXPA 1RDYA 4OFOA 2WEFA 1CE2A 3VLUA 2QFLA 1LFIA 4R74A 4MJOA 2Y84A 2UYFA 3MVYA 1I6BA 2ALUA 1RDZA 1SYIA 2F34A 1LAXA 4RPNA 4O3AA 2HQ0A 2QMWA 3V5AA 1PB7A 1IUDA 3C4MA 1KWHA 3UIFA 4DI3D 2WYKA 1US4A 4U21A 4PP0A 5I57B 2NXOA 5H8FB 4DLDA 4JWOA 2XX7A 3T9XB 2RC8A 3IORA 3D4GA 2V93A 5B70A 2VOZA 4N4UA 5A5XA 4R9FA 4P11A 3ROJA 4ECFA 1B3LA 3EHTA 2Y7KA 2DSFA 1OVBA 1UQWA 3PUVE 2ONKE 3L6HA 4F3PA 5FHNA 1MY2A 4N91A 1FPKA 3M3LA 2QSXA 2FHYA 2YPNA 3HV1A 5ET5A 4OEUA 1ZJLA 3USDA 3IB1A 2P0SA 2DVCA 5J16A 4BLAA 3U94A 3O97A 3H3GA 3T0JA 4IGTA 1UTHA 2B4MA 2QVUA 3WAFA 5F7VA 4HCWA 4PFUA 2QS1A 1N3WA 2XXTA 3U93A 1CB6A 2HZKA 4H6DA 5A5XB 4FIMA 1WODA 4OETA 2DWJA 4JSDA 1I69A 3I5OA 2XD3A 3MBPA 3VVFA 4Q0CA 4KPTA 4DE8A 1QKAA 3KEIA 3R6UA 5EQ9A 1H3DA 4F3BA 1VFDA 1KZ8A 1MM6A 4XTCQ 1TFDA 4ONYA 1D9VA 3QXMA 4HXVA 3SEWA 3DM0A 4NF5A 4WKMA 1FTLA 3OO7A 1BP5A 2RKMA 1UTHB 4AB5A 3UN6A 5CRYA 1SYHA 4JWYA 5IAIA 4ISUA 5IZ3A 1JW4A 4YB6A 2DWAA 3S9MC 2QVRA 5FBPA 4QFPA 5AA4A 5IKBA 2DOJA 2F7AA 1B9JA 4OENA 2Z22A 4PAKA 3EQ1A 4RPOA 4NF6B 3MPKA 2DXRA 2CEXA 3PPRA 5ESYA 4N15A 3PMWA 3M3FA 3A3CA 1SBPA 1YXIA 2H99A 3SERA 4ZEIA 1S7YA 3KN8A 3DELB 3MVXA 4MNPA 5EYHA 3FBPA 4IO2A 4OVPA 2UVJA 2B65A 2DP8A 2OWSA 1R1NA 2CZIA 1JETA 4NHBA 1B51A 2Q89A 5AA4B 4X9TA 3T9UA 2Q9TA 4PFTA 3TKDA 4O7IA 2G29A 1ANFA 1PDAA 1ZTYA 2HHMA 5I59A 3TCGA 1JW5A 1MY3A 4XEQA 1OVTA 1MY1A 3P7IA 3OELA 4I3EA 1LGBC 2VD3A 4F1VA 2QMXA 4HCYA 2G93A 3LSFB 2F78A 5I56A 1LAHE 4I62A 3OO9A 4Q8RA 1FCKA 4GL0A 4Z0IA 4KYSA 1MQIA 1LB9A 1RYOA 4RK2A 3HSTA 3VVEA 4MF3A 2W7YA 4OQOA 3KOTA 1B0LA 4EXLA 1NNTA 3S9NC 2KR0A 4I1DA 3UA8A 1PBPA 1UIUA 3KFMA 2A5TB 2PYYA 1SDXA 1M5FA 2F6GA 1EZ9A 4IY6A 3RPLA 5EYFA 2P3VA 4IR8A 5I56B 5BWJA 3MP8A 3OEKA 1B3GA 4OVTA 2VPOA 3PUXE 3EKIA 4PE3A 3K6VA 1NV3A 5L9SA 1Y4TA 3PTYA 1DSNA 2L5VA 4H1XA 4F18A 5EQAA 3TCFA 5ITPA 1M5DA 4KD5A 3Q25A 1FQBA 4LATA 1B40A 1DTGA 5I84A 3RPLB 2XA5A 4PGPA 2O1LA 1P1UA 4OTEA 5LDZA 2B3FA 4KXPA 3M8UA 5J1DA 3THIA 1G0IA 1MH3A 2XX9A 1LFGA 1ZMGA 4BDOA 4N6PA 4LZ5A 3MZ9A 4R6YA 3VXCA 1H44A 2D3IA 3O29A 5ET8A 2AL5A 3LUZA 4DDDA 3EN3A 1EYJA 2QJEA 5DEXA 3TQWA 4R2BA 3IOUA 2BJIA 2JJKA 4XKRA 5BUUA 2MKZA 3HN0A 2OWTA 4P3LA 5DVIA 1FPEA 2CZLA 1N84A 3LSXA 4U1ZA 4GX6A 1O7TA 3FVGA 3FV1A 4PC9A 4F1UA 1QKBA 2OJTA 3FIRA 2HXWA 1L5TA 5FHOA 2OLBA 3MPLA 4GXAA 4ZS9A 3CI8A 4GBVA 3PD8A 4POXA 4R6HA 4MEVA 1NMUA 1MXYA 4EF2A 4F22A 4LUBA 3DP6A 4OANA 4QF9A 3KSJA 5IM2A 3CSGA 4XKPA 3VXBA 1YTVA 4PE5B 4U2RA 4PDDA 2ZYMA 5HBCA 1YZ0A 2R71A 4E0WA 4JSOA 4GOTA 2IA4A 4P1LA 1EZPA 3FZVA 2NVUB 5CMBA 1GR2A 5CMKA 2OPDA 3B7DA 1SI0A 5AA2A 4NF8B 1ZU0A 4U23A 1FTAA 5DVFA 4IO4A 4GRKA 1Y9UA 2NUVA 2ZNSA 2OWZA 1D4NA 1B3FA 2XHDA 1I6QA 2O1MA 1B3HA 5I58A 3FASA 4P8BA 3H06B 4KR5A 4YMAA 4KCDA 1LFHA 1BKAA 3K0VA 1MXXA 1XS5A 2PVUA 3VLWA 3FVOA 4ZEBA 1II5A 1AWBA 3T1BA 4TOZA 3PPPA 4OHNA 5AA2B 1MDQA 2VP1A 4QFKA 3V8XB 4ZECA 1EYIA 4N13A 4N8GA 3PMVA 4XXUA 2Y5KA 1B0HA 4RXLA 1FRPA 4U1OA 4ZDMA 1KA1A 4MMPA 1AIVA 2THIA 4C1UA 5I58B 4K3FA 1LEVA 5KDTA 2UYEA 5K2XA 4BDMA 1USYE 3EHUA 4YKJA 2XWOA 5EHMA 2DE3A 2P2AA 1MPBA 1FQCA 1SI1A 3ODBA 4F2OA 2ZMBA 1AMFA 5H8SA 3FXRA 3RTFB 1AOVA 2Y7PA 1EZOA 1YYZA 4HE0A 3MC2A 4WEDA 4GVOA 1Y4CA 4IY5A 4ELOA 3RY3A 4ZEDA 5LOMA 3VV5A 5KDTB 3PGFA 1LBCA 1QVSA 1K9YA 4LA9A 3O6HA 2Z8EA 1INPA 4AS5A 2Q2CA 4DIGA 3EHSA 3MUQA 4F19A 4EQ7A 3K00A 3VVDA 4XKNA 3UGWA 3MP6A 4P0IA 2QS3A 3KN7A 5CI5A 2F3BA 4O7MA 2PBWA 3E3KA 3LC8A 2XXIA 5H8FA 4PTKA 4R2FA 4OVQA 3GYYA 4N8YA 2XXQA 4EUOA 2DWHA 1GGGA 3VE1B 5JK4A 4OEVA 4TLMB 3T96B 1SW2A 1H76A 3PMXA 4XFEA 4EDPA 4O3BA 1SW5A 3IFAA 4YKPA 1YCJA 1BTJA 4OVJA 1Y3NA 4GWYA 1TXFA 5CM6A 2I3VA 4I40A 3PD9A 1B7HA 2WBBA 1VFEA 1AH5A 3QYTA 2OBGA 3H6VA 2F97A 4DCYA 2O84X 3HFUA 4N6DA 3S9EA 3N6UA 4JB7A 1IMFA 5F24A 1LAFE 2R6GE 4F3GA 4AQ4A 3CFXA 4GWOA 3U72A 1WVJA 5L8DA 1CNQA 2GFEA 4P47A 2QL3A 2Q2AA 1SD3A 4U4XA 2Z8FA 3PUYE 2XWVA 3TFLA 4IO3A 3FVKA 3VLVA 2ZNUA 1MQHA 2CEYA 3G3HA 3LR1A 3O9PA 3FV2A 4GX4A 4QSDA 1I6AA 1IXHA 1B1HA 2QS4A 3B6TA 5B7DA 3ILTB 1QGXA 4FAJA 4F31B 4NF6A 3MP1A 1XVXA 3OD7A 4FE8A 1IMBA 1FBFA 5CMCA 3TUSA 1FPBA 4JVDA 3HHFA 1FPGA 5A5LA 4F2QA 3K1MA 1QUJA 3ONMA 3FXQA 3F11A 3KGCA 4KQPA 3TELA 5DTBA 3QIMA 1IITA 2FNCA 2A5SA 5H8HA 3DP8A 2REGA 3MW0A 2ZYNA 2AYSA 2KLFA 4P1EA 1USYH 2M8CA 2O6AA 3BBRA 5I2KB 2RCAA 3L6GA 1FBEA 1MPDA 1NI9A 4DI4B 3RLFE 1NV0A 2DQVA 2O7UA 4NAPA 4X1BA 4YB7A 4EQBA 3TTRA 1UIVA 4OWDA 2DE2A 1MY0A 3FXBA 4XIGQ 4HE1A 1US5A 2V3UA 2HZLA 4RJZA 1B5IA 4BDQA 4MX6A 3ZSFA 3SDFA 5H8HB 3CVGA 3WAEA 3LBSA 1FTOA 2V3QA 4G61A 2KQZA 4GWZA 1MXZA 3MAMA 2PCRA 5I2NB 4GF8A 4LZ8A 2Q8MA 1P1NA 1PBQA 4MAGA 4X48A 1M5BA 2O7IA 1N04A 4JVIA 3CSBA 1VE4A 3RYDA 4NEDA 2FYIA 1NFTA 1F9BA 2A5TA 2GHAA 4YB5A 3Q28A 3RGYA 3KJTA 2GRVA 4C0RA 3BFUA 4G8NA 1NV1A 3K4UA 3U8QA 3G3IA 2PMSA 3JYRA 2VD2A 4R72A 4MFIA 2PFZA 2UVGA 3M3KA 4NF0A 4OZ9A 1JW1A 2I4BA 3T93B 2OPEA 3FJGA 2HCAA 1FJ9A 1GTKA 3BFTA 5DW8A 4KI0E 3TYHA 4DXBA 3N6TA 1H43A 3QSLA 4DXCA 3CRBA 1IEJA 3KZGA 4O3CA 1IMEA 3RNNA 4PFIA 4PBQA 2HAUA 3FVNA 2DWIA 4F29A 3S9LC 4DCXA 2E1SA 1MH4A 4PGNA 1Q1KA 5ELVA 4QFNA 1LBYA 3VFJA 2HPGA 3RT6B 5DYHA 5FHMA 1FQAA 1FPLA 3H7MA 1B5JA 1XOCA 4OYVA 4PF8A 4XF5A 1PC3A 5IZZA 3ECRA 2GH9A 4HS7A 3C33A 5CBRA 2V4CA 1NV5A 2WYPA 4LQ2A 3RPWA 3TTKA 1LB8A 1PB8A 2CZHA 1K9ZA 5JEIA 4WEPA 3E13X 3PPOA 1SQYA 4ESWA 5TP9B 4GWSA 3B8BA 3Q29A 1NUWA 4H46A 2NOOA 1SW1A 2VGQA 3C9HA 4P56A 1MRPA 3S2VA 1FQEA 1PB9A 1DOTA 5IGAA 1FBCA 2ZXTA 1JP4A 3GBBA 2PFYA 1OIBA 3MSTA 3BKIB 4X8RA 4F1YA 1GV8A 1LSTA 4QBAA 5TPAB 1DMBA 5EQ7A 3PUWE 4HE2A 4FEBA 1MXVA 1AL3A 5DT6A 3OMBA 4MH5A 2H5YA 2H25A 5T3JA 4NG7A 3K1NA 3IB0A 1B46A 4GLIA 3O66A 3SEVA 3N26A 3U1OA 1H45A 4O94A 1NH7A 1NV6A 2I4CA 4FATA 5I7IA 2FVZA 1XI6A 1QW0A 4NF8A 4OVSA 2Y5LA 1LBVA 2XXUA 1N0TA 1B6HA 5TU0A 4N81A 3RQTA 4RA1A 1IZ1A 3K6UA 2F3DA 2XX8A 1BLFA 4MLQA 2P1SA 1POTA 1VSOA 3HO7A 3U92A 2OZZA 1YAEA 4MLVA 4TLLB 4ND9A 1OLCA 1ZIUA 3O6IA 3TMGA 3C32A 2H4IA 2Z23A 1FPDA 3U65A 1WDNA 2P3NA 4ELQA 4F39A 1HSJA 3E79A 1B3EA 4IGRA 1DTZA 4Q5TA 3O6GA
chains in the Genus database with same CATH topology
4OVRA 5JK4A 5I3SA 4AS4A 4PAKA 1IMAA 2CEXA 5ESYA 4N15A 1YXIA 4MNPA 5EYHA 4XFEA 3E78A 3FBPA 3IFAA 4OVPA 1FBPA 1NUZA 5EQ8A 2CZIA 4PETA 1SPIA 4GWYA 4UABA 5CM6A 1FPFA 4FBPA 5ET7A 4NX1A 2DDKA 4I40A 4NHBA 4GWUA 2WBBA 4X9TA 2Q9TA 2DE4A 4O7IA 1Q9DA 3HFUA 2HHMA 4PAFA 4N6DA 4PF6A 2WBDA 1IMFA 5F24A 2F5XA 4XEQA 1NV7A 4I3EA 1KA0A 4F1VA 4HCYA 3W9VA 1CNQA 4P47A 3KC1A 2XWVA 3CHGA 1NUYA 2CEYA 2WX9A 4GWWA 4GWXA 2DVZA 2XWIA 4GX4A 4MCOA 2KR0A 5LTCA 3A29A 1QGXA 1VDWA 4MIJA 1DK4A 1IMBA 4JVCA 1FBFA 2R8TA 2VPNA 4PDHA 1FPBA 4JVDA 1FPGA 5A5LA 3RPLA 2P3VA 4IR8A 3W9WA 4P9KA 5I5PA 2QPQA 4OVTA 2ZZWA 2VPOA 3EKIA 4PE3A 4GBWA 1FBDA 1NV3A 3PTYA 4P1EA 2L5VA 4F18A 5EQAA 3BIGA 2OX3A 1FBEA 1NI9A 3SZPA 5IZ1A 4DI4B 1NV0A 4NAPA 2GQ1A 2DE2A 3RPLB 2XA5A 4PGPA 1IMCA 3FXBA 4HE1A 1D9QA 2HZLA 4MX6A 5LDZA 4KXPA 4LN5A 5J1DA 1G0IA 4NN3A 2XWKA 1DBZA 4PBHA 1FPJA 5ET6A 2V3QA 4G61A 2KQZA 5ET8A 1FJ6A 4GWZA 1FBGA 1LBZA 2CZKA 2PCRA 3LUZA 2Q8MA 4MAGA 1EYJA 4JVIA 2Q74A 1IMDA 3RYDA 3KBZA 2FIXA 4QXDA 2FIEA 2BJIA 2JJKA 2MKZA 5EYGA 1G0HA 4P3LA 4O8MA 4OA4A 1FPEA 3D1RA 4GX6A 1NV1A 4PC9A 4F1UA 2PFZA 2B4LA 4NF0A 4PCDA 1FJ9A 4NQ8A 4GBVA 5DW8A 2ZZVA 4MEVA 1FBHA 4OANA 1NUXA 1IMEA 5IM2A 1BK4A 1FSAA 4PFIA 4PBQA 3B50A 1RDXA 4PDDA 2FBPA 1LBWA 1YZ0A 4PFBA 4H45A 4P1LA 2HXRA 4PGNA 3QMFA 1LBYA 4N17A 2HPGA 2VT5A 4X04A 1FTAA 1NV4A 4YZZA 1FPLA 1DCUA 1RDYA 2WEFA 3LV0A 2QFLA 4PF8A 2OWZA 4XF5A 5IZZA 3BIHA 4MJOA 2V4CA 4YICA 1NV5A 2WYPA 1RDZA 2CZHA 1K9ZA 4P8BA 3MYUA 3ISPA 4GWSA 3B8BA 1NUWA 4H46A 4N6KA 4DI3D 4P56A 2WYKA 1AWBA 3T1BA 5IGAA 1FBCA 1EYIA 1JP4A 2PFYA 3MSTA 2QVVA 4PFRA 4N8GA 4X8RA 4M1VA 5IZ3B 2Y5KA 2ZZXA 1FRPA 4QBAA 5EQ7A 3NOHA 4N4UA 1KA1A 4MMPA 4HE2A 4MNCA 3ROJA 1LEVA 4NGUA 4MHFA 4N91A 1FPKA 5T3JA 2FHYA 4NG7A 5ET5A 1FPIA 5J16A 2XWOA 2DE3A 1EYKA 3T0JA 2B4MA 4O94A 1NV6A 2QVUA 4HCWA 5I7IA 2FVZA 1XI6A 4OVSA 2Y5LA 1LBVA 2HZKA 1YYZA 4HE0A 4N81A 4GX3A 4PAIA 2F3DA 1K9YA 3IFCA 1NV2A 5EQ9A 1INPA 1KZ8A 4AS5A 4F19A 4HXVA 4MNIA 1FPDA 3U65A 2P3NA 1LBXA 2F3BA 4O7MA 3E79A 4PTKA 5IZ3A 4OVQA 3GYYA 4N8YA 4I3YA 2QVRA 5FBPA 2XXKA 3KC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX6 A;  1EYI A;  2R8T A;  1JP4 A;  1FPB A;  2QVV A;  1NV1 A;  1FPG A;  5A5L A;  5IZ3 B;  5I3S A;  4AS4 A;  2Y5K A;  3RPL A;  1IMA A;  1FRP A;  2P3V A;  4IR8 A;  5EQ7 A;  5ESY A;  1KA1 A;  1YXI A;  1FJ9 A;  4GBV A;  4HE2 A;  5DW8 A;  4GBW A;  1FBH A;  5EYH A;  3ROJ A;  3FBP A;  1FBD A;  1LEV A;  3IFA A;  1FBP A;  1NV3 A;  1NUZ A;  1NUX A;  5EQ8 A;  2CZI A;  1IME A;  1FPK A;  1SPI A;  5T3J A;  5EQA A;  2FHY A;  3BIG A;  1BK4 A;  1FSA A;  4GWY A;  1FPF A;  5ET5 A;  2OX3 A;  4FBP A;  5ET7 A;  1FPI A;  1RDX A;  2DDK A;  4I40 A;  5J16 A;  1FBE A;  4GWU A;  2WBB A;  1NI9 A;  1EYK A;  5IZ1 A;  3T0J A;  1NV0 A;  2FBP A;  1LBW A;  1YZ0 A;  2GQ1 A;  1NV6 A;  2QVU A;  4H45 A;  3RPL B;  1DK4 A;  2FVZ A;  1XI6 A;  4O7I A;  1Q9D A;  1IMC A;  2Y5L A;  1LBV A;  4HE1 A;  2HHM A;  1D9Q A;  1YYZ A;  2WBD A;  3QMF A;  4HE0 A;  1LBY A;  1IMF A;  5F24 A;  5LDZ A;  4N81 A;  4KXP A;  1NV7 A;  2VT5 A;  1G0I A;  4GX3 A;  4I3E A;  1FTA A;  1DBZ A;  1NV4 A;  1KA0 A;  2F3D A;  1FPL A;  1DCU A;  1FPJ A;  1RDY A;  1K9Y A;  2WEF A;  3IFC A;  3LV0 A;  5ET6 A;  4G61 A;  1CNQ A;  2QFL A;  1NV2 A;  1FJ6 A;  5EQ9 A;  2OWZ A;  1INP A;  4GWZ A;  5ET8 A;  3KC1 A;  1FBG A;  1KZ8 A;  1LBZ A;  3BIH A;  4MJO A;  4AS5 A;  2CZK A;  2PCR A;  3LUZ A;  2Q8M A;  1NV5 A;  4HXV A;  1NUY A;  1RDZ A;  1EYJ A;  2CZH A;  4GWW A;  4GWX A;  1K9Z A;  1FPD A;  2P3N A;  4GX4 A;  1LBX A;  2Q74 A;  1IMD A;  3RYD A;  2F3B A;  3KBZ A;  2FIX A;  4GWS A;  4QXD A;  2FIE A;  3B8B A;  2BJI A;  2JJK A;  1NUW A;  4H46 A;  5EYG A;  4PTK A;  5IZ3 A;  1G0H A;  3A29 A;  1AWB A;  1QGX A;  1FPE A;  4I3Y A;  1VDW A;  2QVR A;  5FBP A;  1FBC A;  1IMB A;  3KC0 A;  3D1R A;  1FBF A; 
#chains in the Genus database with same CATH topology
 5JTY B;  1SW4 A;  4KHZ E;  1IQ7 A;  4AS4 A;  4X1D A;  1MQD A;  1IMA A;  4R75 A;  1XC1 A;  3KJ7 A;  1M5C A;  3VDF A;  4FJP A;  3R26 A;  2OK2 A;  1A7L A;  1VR5 A;  3E78 A;  3FJ7 A;  1MG1 A;  3HCQ A;  3JZJ A;  1NUZ A;  3GXA A;  4JXI A;  3FXU A;  4H67 A;  4H5F A;  4UAB A;  4FBP A;  5ET7 A;  1LLS A;  5AA2 D;  1FTM A;  4BDN A;  3LSL A;  4GWU A;  3MWB A;  4OXV A;  1B05 A;  1QUL A;  3RN8 A;  2I49 A;  1MM7 A;  2H98 A;  1MDP 1;  4PF6 A;  2WBD A;  3AXF A;  3OSQ A;  2F5X A;  1NV7 A;  1A54 A;  1N3X A;  2I48 A;  2XD2 A;  4G68 A;  1KA0 A;  3MZ1 A;  2V3T A;  3FAT A;  3W9V A;  1B1X A;  2YLN A;  3PU5 A;  4UA8 A;  2B3B A;  4R6K A;  4LVQ A;  3N94 A;  3SEX A;  1NUY A;  4R9G A;  1TFA A;  2WX9 A;  2DVZ A;  3TTM A;  3IK6 B;  3QUJ A;  4MCO A;  1N76 A;  1OLA A;  1B2H A;  2ZNT A;  1XVY A;  5AE4 A;  2ANJ A;  4FEC A;  4MBP A;  1LCT A;  4L17 A;  3A29 A;  1IXC A;  5H8N B;  4H8J A;  1DK4 A;  4NWC A;  4I8C A;  4G68 B;  2R8T A;  2VPN A;  4PDH A;  2O68 A;  4YMB A;  3CIJ A;  2NWJ A;  4QFL A;  4IO7 A;  3K6X A;  1MPC A;  2PT2 A;  3H6T A;  2PX1 A;  1ELJ A;  2I0C A;  4XKQ A;  3T22 A;  1B58 A;  2XXY A;  1Y3Q A;  1T0K A;  2ONR A;  3B6W A;  3PPN A;  4GBW A;  3E9X A;  3ZS6 A;  5CBS A;  4N07 A;  1FBD A;  3SEY A;  4LP2 B;  1JVX A;  4OFL A;  1BIY A;  3FD3 A;  4QSE A;  3IOT A;  3K1P A;  3QUF A;  3JV9 A;  4HTG A;  2HFB A;  3E4R A;  4LON B;  2IEE A;  1R6Z A;  4ZZA A;  3TDJ A;  4ELR A;  4YAH X;  4NTL A;  3H4Z A;  3FUZ A;  3T9V A;  4HW8 A;  1IMC A;  2ESN A;  3S4U A;  3C35 A;  4RNS A;  4QFO A;  4DZ1 A;  4NN3 A;  5HPQ A;  3IOW A;  2XWK A;  5AA3 A;  1DBZ A;  3OSR A;  2PT1 A;  4U22 A;  1B32 A;  1FPJ A;  5ET6 A;  5K2Y A;  1FJ6 A;  1B4H A;  1LBZ A;  1M5E A;  1Q35 A;  1FQF A;  2YJP A;  4H8I A;  1TT1 A;  2VHA A;  3C31 A;  4EF1 A;  3KBZ A;  2FIX A;  5CMM A;  4QXD A;  3CFL A;  2RC9 A;  5EYG A;  3HPI A;  4ELP A;  2GHB A;  1A40 A;  3D1R A;  3TTN A;  1IXI A;  1OQG A;  3OXN A;  1QUK A;  2B4L A;  1EU8 A;  2XXH A;  4ZE8 A;  1XT8 A;  1XHY A;  4GXS B;  3OO6 A;  2ZZV A;  5I2K A;  4ZZE A;  3MJN A;  1NNF A;  3CG3 A;  1D3K A;  3IX1 A;  3MZB A;  3IR1 A;  4FED A;  1B52 A;  2REJ A;  1P1O A;  1FSA A;  5L9O A;  3G3J A;  3B50 A;  4G2Z A;  2R9J A;  3K6W A;  2UVH A;  4R73 A;  1LBW A;  2LAO A;  3UK4 A;  1RKM A;  4H45 A;  2Q88 A;  4ZEK A;  1NL5 A;  2HXR A;  4NF4 A;  2WKY A;  3PV0 E;  3PPQ A;  4DXU A;  2XXV A;  4N17 A;  1Y20 A;  4KYE A;  3Q27 A;  1UTB A;  5FTI A;  4X04 A;  5I2N A;  1NV4 A;  3UP9 A;  1DCU A;  4GQO A;  3LV0 A;  2FA7 A;  4I9D A;  2DS9 A;  3H6U A;  3BIH A;  4YIC A;  1JNF A;  1Z7N E;  1MQG A;  3ILU B;  3CG1 A;  1MS7 A;  1N7X A;  1NNP A;  3MYU A;  3MQ9 A;  4NMY A;  1LCF A;  4NF4 B;  2AIX A;  3ISP A;  4BDL A;  1LAG E;  4NF5 B;  4ESX A;  4N6K A;  3FJM A;  3SET A;  4E0X A;  4LQ5 A;  3KC0 A;  4G68 C;  3H6W A;  1UTB B;  2RF1 A;  2RCB A;  3SEU A;  5KCJ A;  2QVV A;  4PFR A;  1EH3 A;  3G3K A;  4M1V A;  5IZ3 B;  2I0B A;  1PEB A;  2ZZX A;  2ABH A;  4OER A;  1FTK A;  3TTL A;  3NOH A;  2QRY A;  2F7B A;  1A99 A;  4F3S A;  3SES A;  3RTW B;  1JVY A;  4MNC A;  3H03 A;  4NGU A;  4MHF A;  3C36 A;  2RC7 A;  1N7W A;  2ZYO A;  3LSW A;  1JEV A;  1LBB A;  5ISU A;  1FQD A;  1B7Z A;  3QAX A;  1FPI A;  1P99 A;  4NWD A;  4WXJ A;  4TQU Q;  3GBA A;  3OOA A;  4YU0 A;  1EYK A;  1MQJ A;  5KCJ B;  2CMO A;  3LUY A;  1A8E A;  2ZYK A;  3TQL A;  4GD5 A;  2OCU A;  4PFW A;  1URG A;  4IO6 A;  2O51 A;  2I58 A;  1MY4 A;  4JBZ A;  4GL8 A;  3T66 A;  5M2V A;  4U4S A;  1Y1Z A;  4H0W A;  4YKI A;  4GX3 A;  1QJM A;  1S50 A;  1QUI A;  4PAI A;  5I59 B;  2X7P A;  2F6P A;  3IFC A;  1NV2 A;  1POY 1;  3IO4 A;  5TP9 A;  4KCC A;  2I6E A;  3GZG A;  4MNI A;  4IB2 A;  3O28 A;  3FGS A;  2D5W A;  1LBX A;  2V25 A;  4Z7E A;  1B7U A;  3DP4 A;  3OEM A;  1IIW A;  1OMP A;  4I3Y A;  5TPA A;  1SVX B;  2XXK A;  1HSE A;  3GLB A;  1RYX A;  4G8M A;  4OVR A;  3TPA A;  4PFY A;  3TCH A;  3D4C A;  5I3S A;  1S9T A;  2RIN A;  1NH8 A;  2H9B A;  3KOS A;  1GVC A;  4JWX A;  3K01 A;  3DLN A;  3ZKK A;  4H5G A;  1DPP A;  1URD A;  1FBP A;  3KG2 A;  2QS2 A;  4FOR A;  4RY1 A;  3C34 A;  5EQ8 A;  4PET A;  1SPI A;  1FPF A;  1O63 A;  4NX1 A;  2V84 A;  2DDK A;  4EXK A;  5H8Q A;  1O64 A;  3K2D A;  2ONS A;  2X26 A;  2DE4 A;  3PUZ E;  4JDF A;  1JEU A;  2Y7W A;  1P1W A;  3IAZ A;  1Q9D A;  2E0S A;  4PAF A;  2Q8J A;  1URS A;  3TZA A;  4G4P A;  4RK9 A;  3MVZ A;  3V83 A;  3IO6 A;  1MXW A;  4ZE9 A;  3KC1 A;  3MVW A;  4BDR A;  5H8Q B;  2O69 A;  3CHG A;  2D21 A;  2DXY A;  4GWW A;  4GWX A;  3OEN A;  3TEP A;  2XWI A;  3TAJ A;  4KYD A;  1ZBM A;  3IOV A;  4ZEF A;  5JTY A;  1FW0 A;  5LTC A;  3I3V A;  5DEX B;  4POW A;  3G3F A;  1VDW A;  1JQF A;  4IO5 A;  4MIJ A;  4JVC A;  3CR9 A;  1ATG A;  2Z8D A;  1YPN A;  4QRZ A;  2Y7I A;  3W9W A;  4P9K A;  5I5P A;  2QPQ A;  2DYX A;  3KBR A;  2ZZW A;  5L9M A;  3RT8 A;  4LZ7 A;  1IXG A;  3OO8 A;  3ZKL A;  3KSX A;  1R9Q A;  1D9Y A;  4QSC A;  1J1N A;  2BJJ X;  3BIG A;  2OX3 A;  1DPE A;  2F8D A;  1Z7M E;  3W15 C;  5DVJ A;  3SZP A;  5IZ1 A;  2GQ1 A;  4PQJ A;  4OMB A;  3A3U A;  4NE4 A;  5HM4 B;  3IJO B;  4G77 A;  1D9Q A;  3RUM A;  1B4Z A;  4OFJ A;  2F35 A;  2UVI A;  4LN5 A;  2XXX A;  3I6V A;  4H65 A;  2X7Q A;  4M4G A;  3IJX B;  3HHG A;  4Q30 B;  4PBH A;  2HEU A;  5CC2 A;  1FBG A;  2CZK A;  3IB2 A;  5EHS A;  2XXW A;  3R7X A;  5H8N A;  2XXR A;  2Q74 A;  1IMD A;  3Q26 A;  4OES A;  3B6Q A;  2FIE A;  2UXA A;  2HAV A;  1FTJ A;  4RYA A;  5ICT A;  2Y7R A;  1G0H A;  4O8M A;  4OA4 A;  3TOD A;  3G3G A;  4C1T A;  3QK6 A;  1Y1M A;  4P0G A;  1B5H A;  1MXU A;  4KFQ A;  3G7W A;  3V89 B;  1A55 A;  2F7C A;  2F36 A;  3A09 A;  3EF7 A;  5ICQ A;  1ZLQ A;  5FTH A;  1A8F A;  5AA1 A;  4PCD A;  1TWY A;  1P1Q A;  4NQ8 A;  3SKP A;  3N5L A;  3O2A A;  1FBH A;  5ITO A;  3K02 A;  4UAC A;  3IL1 B;  1NUX A;  4GIZ A;  1BK4 A;  4AB6 A;  1RDX A;  4QHQ A;  2AL4 A;  5KZT A;  1Y3P A;  1OQH A;  1NNK A;  5F1Q A;  2FBP A;  1R9L A;  4PFB A;  4YKK A;  4G8H A;  1NKX A;  3UOR A;  3T9H B;  1ZKB A;  4THI A;  3QMF A;  3KN3 A;  3CFZ A;  4GFR A;  1HSL A;  2I3W A;  4EQ9 A;  2VT5 A;  3EPE A;  5I57 A;  4YZZ A;  2XXP A;  1RDY A;  4OFO A;  2WEF A;  1CE2 A;  3VLU A;  2QFL A;  1LFI A;  4R74 A;  4MJO A;  2Y84 A;  2UYF A;  3MVY A;  1I6B A;  2ALU A;  1RDZ A;  1SYI A;  2F34 A;  1LAX A;  4RPN A;  4O3A A;  2HQ0 A;  2QMW A;  3V5A A;  1PB7 A;  1IUD A;  3C4M A;  1KWH A;  3UIF A;  4DI3 D;  2WYK A;  1US4 A;  4U21 A;  4PP0 A;  5I57 B;  2NXO A;  5H8F B;  4DLD A;  4JWO A;  2XX7 A;  3T9X B;  2RC8 A;  3IOR A;  3D4G A;  2V93 A;  5B70 A;  2VOZ A;  4N4U A;  5A5X A;  4R9F A;  4P11 A;  3ROJ A;  4ECF A;  1B3L A;  3EHT A;  2Y7K A;  2DSF A;  1OVB A;  1UQW A;  3PUV E;  2ONK E;  3L6H A;  4F3P A;  5FHN A;  1MY2 A;  4N91 A;  1FPK A;  3M3L A;  2QSX A;  2FHY A;  2YPN A;  3HV1 A;  5ET5 A;  4OEU A;  1ZJL A;  3USD A;  3IB1 A;  2P0S A;  2DVC A;  5J16 A;  4BLA A;  3U94 A;  3O97 A;  3H3G A;  3T0J A;  4IGT A;  1UTH A;  2B4M A;  2QVU A;  3WAF A;  5F7V A;  4HCW A;  4PFU A;  2QS1 A;  1N3W A;  2XXT A;  3U93 A;  1CB6 A;  2HZK A;  4H6D A;  5A5X B;  4FIM A;  1WOD A;  4OET A;  2DWJ A;  4JSD A;  1I69 A;  3I5O A;  2XD3 A;  3MBP A;  3VVF A;  4Q0C A;  4KPT A;  4DE8 A;  1QKA A;  3KEI A;  3R6U A;  5EQ9 A;  1H3D A;  4F3B A;  1VFD A;  1KZ8 A;  1MM6 A;  4XTC Q;  1TFD A;  4ONY A;  1D9V A;  3QXM A;  4HXV A;  3SEW A;  3DM0 A;  4NF5 A;  4WKM A;  1FTL A;  3OO7 A;  1BP5 A;  2RKM A;  1UTH B;  4AB5 A;  3UN6 A;  5CRY A;  1SYH A;  4JWY A;  5IAI A;  4ISU A;  5IZ3 A;  1JW4 A;  4YB6 A;  2DWA A;  3S9M C;  2QVR A;  5FBP A;  4QFP A;  5AA4 A;  5IKB A;  2DOJ A;  2F7A A;  1B9J A;  4OEN A;  2Z22 A;  4PAK A;  3EQ1 A;  4RPO A;  4NF6 B;  3MPK A;  2DXR A;  2CEX A;  3PPR A;  5ESY A;  4N15 A;  3PMW A;  3M3F A;  3A3C A;  1SBP A;  1YXI A;  2H99 A;  3SER A;  4ZEI A;  1S7Y A;  3KN8 A;  3DEL B;  3MVX A;  4MNP A;  5EYH A;  3FBP A;  4IO2 A;  4OVP A;  2UVJ A;  2B65 A;  2DP8 A;  2OWS A;  1R1N A;  2CZI A;  1JET A;  4NHB A;  1B51 A;  2Q89 A;  5AA4 B;  4X9T A;  3T9U A;  2Q9T A;  4PFT A;  3TKD A;  4O7I A;  2G29 A;  1ANF A;  1PDA A;  1ZTY A;  2HHM A;  5I59 A;  3TCG A;  1JW5 A;  1MY3 A;  4XEQ A;  1OVT A;  1MY1 A;  3P7I A;  3OEL A;  4I3E A;  1LGB C;  2VD3 A;  4F1V A;  2QMX A;  4HCY A;  2G93 A;  3LSF B;  2F78 A;  5I56 A;  1LAH E;  4I62 A;  3OO9 A;  4Q8R A;  1FCK A;  4GL0 A;  4Z0I A;  4KYS A;  1MQI A;  1LB9 A;  1RYO A;  4RK2 A;  3HST A;  3VVE A;  4MF3 A;  2W7Y A;  4OQO A;  3KOT A;  1B0L A;  4EXL A;  1NNT A;  3S9N C;  2KR0 A;  4I1D A;  3UA8 A;  1PBP A;  1UIU A;  3KFM A;  2A5T B;  2PYY A;  1SDX A;  1M5F A;  2F6G A;  1EZ9 A;  4IY6 A;  3RPL A;  5EYF A;  2P3V A;  4IR8 A;  5I56 B;  5BWJ A;  3MP8 A;  3OEK A;  1B3G A;  4OVT A;  2VPO A;  3PUX E;  3EKI A;  4PE3 A;  3K6V A;  1NV3 A;  5L9S A;  1Y4T A;  3PTY A;  1DSN A;  2L5V A;  4H1X A;  4F18 A;  5EQA A;  3TCF A;  5ITP A;  1M5D A;  4KD5 A;  3Q25 A;  1FQB A;  4LAT A;  1B40 A;  1DTG A;  5I84 A;  3RPL B;  2XA5 A;  4PGP A;  2O1L A;  1P1U A;  4OTE A;  5LDZ A;  2B3F A;  4KXP A;  3M8U A;  5J1D A;  3THI A;  1G0I A;  1MH3 A;  2XX9 A;  1LFG A;  1ZMG A;  4BDO A;  4N6P A;  4LZ5 A;  3MZ9 A;  4R6Y A;  3VXC A;  1H44 A;  2D3I A;  3O29 A;  5ET8 A;  2AL5 A;  3LUZ A;  4DDD A;  3EN3 A;  1EYJ A;  2QJE A;  5DEX A;  3TQW A;  4R2B A;  3IOU A;  2BJI A;  2JJK A;  4XKR A;  5BUU A;  2MKZ A;  3HN0 A;  2OWT A;  4P3L A;  5DVI A;  1FPE A;  2CZL A;  1N84 A;  3LSX A;  4U1Z A;  4GX6 A;  1O7T A;  3FVG A;  3FV1 A;  4PC9 A;  4F1U A;  1QKB A;  2OJT A;  3FIR A;  2HXW A;  1L5T A;  5FHO A;  2OLB A;  3MPL A;  4GXA A;  4ZS9 A;  3CI8 A;  4GBV A;  3PD8 A;  4POX A;  4R6H A;  4MEV A;  1NMU A;  1MXY A;  4EF2 A;  4F22 A;  4LUB A;  3DP6 A;  4OAN A;  4QF9 A;  3KSJ A;  5IM2 A;  3CSG A;  4XKP A;  3VXB A;  1YTV A;  4PE5 B;  4U2R A;  4PDD A;  2ZYM A;  5HBC A;  1YZ0 A;  2R71 A;  4E0W A;  4JSO A;  4GOT A;  2IA4 A;  4P1L A;  1EZP A;  3FZV A;  2NVU B;  5CMB A;  1GR2 A;  5CMK A;  2OPD A;  3B7D A;  1SI0 A;  5AA2 A;  4NF8 B;  1ZU0 A;  4U23 A;  1FTA A;  5DVF A;  4IO4 A;  4GRK A;  1Y9U A;  2NUV A;  2ZNS A;  2OWZ A;  1D4N A;  1B3F A;  2XHD A;  1I6Q A;  2O1M A;  1B3H A;  5I58 A;  3FAS A;  4P8B A;  3H06 B;  4KR5 A;  4YMA A;  4KCD A;  1LFH A;  1BKA A;  3K0V A;  1MXX A;  1XS5 A;  2PVU A;  3VLW A;  3FVO A;  4ZEB A;  1II5 A;  1AWB A;  3T1B A;  4TOZ A;  3PPP A;  4OHN A;  5AA2 B;  1MDQ A;  2VP1 A;  4QFK A;  3V8X B;  4ZEC A;  1EYI A;  4N13 A;  4N8G A;  3PMV A;  4XXU A;  2Y5K A;  1B0H A;  4RXL A;  1FRP A;  4U1O A;  4ZDM A;  1KA1 A;  4MMP A;  1AIV A;  2THI A;  4C1U A;  5I58 B;  4K3F A;  1LEV A;  5KDT A;  2UYE A;  5K2X A;  4BDM A;  1USY E;  3EHU A;  4YKJ A;  2XWO A;  5EHM A;  2DE3 A;  2P2A A;  1MPB A;  1FQC A;  1SI1 A;  3ODB A;  4F2O A;  2ZMB A;  1AMF A;  5H8S A;  3FXR A;  3RTF B;  1AOV A;  2Y7P A;  1EZO A;  1YYZ A;  4HE0 A;  3MC2 A;  4WED A;  4GVO A;  1Y4C A;  4IY5 A;  4ELO A;  3RY3 A;  4ZED A;  5LOM A;  3VV5 A;  5KDT B;  3PGF A;  1LBC A;  1QVS A;  1K9Y A;  4LA9 A;  3O6H A;  2Z8E A;  1INP A;  4AS5 A;  2Q2C A;  4DIG A;  3EHS A;  3MUQ A;  4F19 A;  4EQ7 A;  3K00 A;  3VVD A;  4XKN A;  3UGW A;  3MP6 A;  4P0I A;  2QS3 A;  3KN7 A;  5CI5 A;  2F3B A;  4O7M A;  2PBW A;  3E3K A;  3LC8 A;  2XXI A;  5H8F A;  4PTK A;  4R2F A;  4OVQ A;  3GYY A;  4N8Y A;  2XXQ A;  4EUO A;  2DWH A;  1GGG A;  3VE1 B;  5JK4 A;  4OEV A;  4TLM B;  3T96 B;  1SW2 A;  1H76 A;  3PMX A;  4XFE A;  4EDP A;  4O3B A;  1SW5 A;  3IFA A;  4YKP A;  1YCJ A;  1BTJ A;  4OVJ A;  1Y3N A;  4GWY A;  1TXF A;  5CM6 A;  2I3V A;  4I40 A;  3PD9 A;  1B7H A;  2WBB A;  1VFE A;  1AH5 A;  3QYT A;  2OBG A;  3H6V A;  2F97 A;  4DCY A;  2O84 X;  3HFU A;  4N6D A;  3S9E A;  3N6U A;  4JB7 A;  1IMF A;  5F24 A;  1LAF E;  2R6G E;  4F3G A;  4AQ4 A;  3CFX A;  4GWO A;  3U72 A;  1WVJ A;  5L8D A;  1CNQ A;  2GFE A;  4P47 A;  2QL3 A;  2Q2A A;  1SD3 A;  4U4X A;  2Z8F A;  3PUY E;  2XWV A;  3TFL A;  4IO3 A;  3FVK A;  3VLV A;  2ZNU A;  1MQH A;  2CEY A;  3G3H A;  3LR1 A;  3O9P A;  3FV2 A;  4GX4 A;  4QSD A;  1I6A A;  1IXH A;  1B1H A;  2QS4 A;  3B6T A;  5B7D A;  3ILT B;  1QGX A;  4FAJ A;  4F31 B;  4NF6 A;  3MP1 A;  1XVX A;  3OD7 A;  4FE8 A;  1IMB A;  1FBF A;  5CMC A;  3TUS A;  1FPB A;  4JVD A;  3HHF A;  1FPG A;  5A5L A;  4F2Q A;  3K1M A;  1QUJ A;  3ONM A;  3FXQ A;  3F11 A;  3KGC A;  4KQP A;  3TEL A;  5DTB A;  3QIM A;  1IIT A;  2FNC A;  2A5S A;  5H8H A;  3DP8 A;  2REG A;  3MW0 A;  2ZYN A;  2AYS A;  2KLF A;  4P1E A;  1USY H;  2M8C A;  2O6A A;  3BBR A;  5I2K B;  2RCA A;  3L6G A;  1FBE A;  1MPD A;  1NI9 A;  4DI4 B;  3RLF E;  1NV0 A;  2DQV A;  2O7U A;  4NAP A;  4X1B A;  4YB7 A;  4EQB A;  3TTR A;  1UIV A;  4OWD A;  2DE2 A;  1MY0 A;  3FXB A;  4XIG Q;  4HE1 A;  1US5 A;  2V3U A;  2HZL A;  4RJZ A;  1B5I A;  4BDQ A;  4MX6 A;  3ZSF A;  3SDF A;  5H8H B;  3CVG A;  3WAE A;  3LBS A;  1FTO A;  2V3Q A;  4G61 A;  2KQZ A;  4GWZ A;  1MXZ A;  3MAM A;  2PCR A;  5I2N B;  4GF8 A;  4LZ8 A;  2Q8M A;  1P1N A;  1PBQ A;  4MAG A;  4X48 A;  1M5B A;  2O7I A;  1N04 A;  4JVI A;  3CSB A;  1VE4 A;  3RYD A;  4NED A;  2FYI A;  1NFT A;  1F9B A;  2A5T A;  2GHA A;  4YB5 A;  3Q28 A;  3RGY A;  3KJT A;  2GRV A;  4C0R A;  3BFU A;  4G8N A;  1NV1 A;  3K4U A;  3U8Q A;  3G3I A;  2PMS A;  3JYR A;  2VD2 A;  4R72 A;  4MFI A;  2PFZ A;  2UVG A;  3M3K A;  4NF0 A;  4OZ9 A;  1JW1 A;  2I4B A;  3T93 B;  2OPE A;  3FJG A;  2HCA A;  1FJ9 A;  1GTK A;  3BFT A;  5DW8 A;  4KI0 E;  3TYH A;  4DXB A;  3N6T A;  1H43 A;  3QSL A;  4DXC A;  3CRB A;  1IEJ A;  3KZG A;  4O3C A;  1IME A;  3RNN A;  4PFI A;  4PBQ A;  2HAU A;  3FVN A;  2DWI A;  4F29 A;  3S9L C;  4DCX A;  2E1S A;  1MH4 A;  4PGN A;  1Q1K A;  5ELV A;  4QFN A;  1LBY A;  3VFJ A;  2HPG A;  3RT6 B;  5DYH A;  5FHM A;  1FQA A;  1FPL A;  3H7M A;  1B5J A;  1XOC A;  4OYV A;  4PF8 A;  4XF5 A;  1PC3 A;  5IZZ A;  3ECR A;  2GH9 A;  4HS7 A;  3C33 A;  5CBR A;  2V4C A;  1NV5 A;  2WYP A;  4LQ2 A;  3RPW A;  3TTK A;  1LB8 A;  1PB8 A;  2CZH A;  1K9Z A;  5JEI A;  4WEP A;  3E13 X;  3PPO A;  1SQY A;  4ESW A;  5TP9 B;  4GWS A;  3B8B A;  3Q29 A;  1NUW A;  4H46 A;  2NOO A;  1SW1 A;  2VGQ A;  3C9H A;  4P56 A;  1MRP A;  3S2V A;  1FQE A;  1PB9 A;  1DOT A;  5IGA A;  1FBC A;  2ZXT A;  1JP4 A;  3GBB A;  2PFY A;  1OIB A;  3MST A;  3BKI B;  4X8R A;  4F1Y A;  1GV8 A;  1LST A;  4QBA A;  5TPA B;  1DMB A;  5EQ7 A;  3PUW E;  4HE2 A;  4FEB A;  1MXV A;  1AL3 A;  5DT6 A;  3OMB A;  4MH5 A;  2H5Y A;  2H25 A;  5T3J A;  4NG7 A;  3K1N A;  3IB0 A;  1B46 A;  4GLI A;  3O66 A;  3SEV A;  3N26 A;  3U1O A;  1H45 A;  4O94 A;  1NH7 A;  1NV6 A;  2I4C A;  4FAT A;  5I7I A;  2FVZ A;  1XI6 A;  1QW0 A;  4NF8 A;  4OVS A;  2Y5L A;  1LBV A;  2XXU A;  1N0T A;  1B6H A;  5TU0 A;  4N81 A;  3RQT A;  4RA1 A;  1IZ1 A;  3K6U A;  2F3D A;  2XX8 A;  1BLF A;  4MLQ A;  2P1S A;  1POT A;  1VSO A;  3HO7 A;  3U92 A;  2OZZ A;  1YAE A;  4MLV A;  4TLL B;  4ND9 A;  1OLC A;  1ZIU A;  3O6I A;  3TMG A;  3C32 A;  2H4I A;  2Z23 A;  1FPD A;  3U65 A;  1WDN A;  2P3N A;  4ELQ A;  4F39 A;  1HSJ A;  3E79 A;  1B3E A;  4IGR A;  1DTZ A;  4Q5T A;  3O6G A; 
#chains in the Genus database with same CATH homology
 4OVR A;  5JK4 A;  5I3S A;  4AS4 A;  4PAK A;  1IMA A;  2CEX A;  5ESY A;  4N15 A;  1YXI A;  4MNP A;  5EYH A;  4XFE A;  3E78 A;  3FBP A;  3IFA A;  4OVP A;  1FBP A;  1NUZ A;  5EQ8 A;  2CZI A;  4PET A;  1SPI A;  4GWY A;  4UAB A;  5CM6 A;  1FPF A;  4FBP A;  5ET7 A;  4NX1 A;  2DDK A;  4I40 A;  4NHB A;  4GWU A;  2WBB A;  4X9T A;  2Q9T A;  2DE4 A;  4O7I A;  1Q9D A;  3HFU A;  2HHM A;  4PAF A;  4N6D A;  4PF6 A;  2WBD A;  1IMF A;  5F24 A;  2F5X A;  4XEQ A;  1NV7 A;  4I3E A;  1KA0 A;  4F1V A;  4HCY A;  3W9V A;  1CNQ A;  4P47 A;  3KC1 A;  2XWV A;  3CHG A;  1NUY A;  2CEY A;  2WX9 A;  4GWW A;  4GWX A;  2DVZ A;  2XWI A;  4GX4 A;  4MCO A;  2KR0 A;  5LTC A;  3A29 A;  1QGX A;  1VDW A;  4MIJ A;  1DK4 A;  1IMB A;  4JVC A;  1FBF A;  2R8T A;  2VPN A;  4PDH A;  1FPB A;  4JVD A;  1FPG A;  5A5L A;  3RPL A;  2P3V A;  4IR8 A;  3W9W A;  4P9K A;  5I5P A;  2QPQ A;  4OVT A;  2ZZW A;  2VPO A;  3EKI A;  4PE3 A;  4GBW A;  1FBD A;  1NV3 A;  3PTY A;  4P1E A;  2L5V A;  4F18 A;  5EQA A;  3BIG A;  2OX3 A;  1FBE A;  1NI9 A;  3SZP A;  5IZ1 A;  4DI4 B;  1NV0 A;  4NAP A;  2GQ1 A;  2DE2 A;  3RPL B;  2XA5 A;  4PGP A;  1IMC A;  3FXB A;  4HE1 A;  1D9Q A;  2HZL A;  4MX6 A;  5LDZ A;  4KXP A;  4LN5 A;  5J1D A;  1G0I A;  4NN3 A;  2XWK A;  1DBZ A;  4PBH A;  1FPJ A;  5ET6 A;  2V3Q A;  4G61 A;  2KQZ A;  5ET8 A;  1FJ6 A;  4GWZ A;  1FBG A;  1LBZ A;  2CZK A;  2PCR A;  3LUZ A;  2Q8M A;  4MAG A;  1EYJ A;  4JVI A;  2Q74 A;  1IMD A;  3RYD A;  3KBZ A;  2FIX A;  4QXD A;  2FIE A;  2BJI A;  2JJK A;  2MKZ A;  5EYG A;  1G0H A;  4P3L A;  4O8M A;  4OA4 A;  1FPE A;  3D1R A;  4GX6 A;  1NV1 A;  4PC9 A;  4F1U A;  2PFZ A;  2B4L A;  4NF0 A;  4PCD A;  1FJ9 A;  4NQ8 A;  4GBV A;  5DW8 A;  2ZZV A;  4MEV A;  1FBH A;  4OAN A;  1NUX A;  1IME A;  5IM2 A;  1BK4 A;  1FSA A;  4PFI A;  4PBQ A;  3B50 A;  1RDX A;  4PDD A;  2FBP A;  1LBW A;  1YZ0 A;  4PFB A;  4H45 A;  4P1L A;  2HXR A;  4PGN A;  3QMF A;  1LBY A;  4N17 A;  2HPG A;  2VT5 A;  4X04 A;  1FTA A;  1NV4 A;  4YZZ A;  1FPL A;  1DCU A;  1RDY A;  2WEF A;  3LV0 A;  2QFL A;  4PF8 A;  2OWZ A;  4XF5 A;  5IZZ A;  3BIH A;  4MJO A;  2V4C A;  4YIC A;  1NV5 A;  2WYP A;  1RDZ A;  2CZH A;  1K9Z A;  4P8B A;  3MYU A;  3ISP A;  4GWS A;  3B8B A;  1NUW A;  4H46 A;  4N6K A;  4DI3 D;  4P56 A;  2WYK A;  1AWB A;  3T1B A;  5IGA A;  1FBC A;  1EYI A;  1JP4 A;  2PFY A;  3MST A;  2QVV A;  4PFR A;  4N8G A;  4X8R A;  4M1V A;  5IZ3 B;  2Y5K A;  2ZZX A;  1FRP A;  4QBA A;  5EQ7 A;  3NOH A;  4N4U A;  1KA1 A;  4MMP A;  4HE2 A;  4MNC A;  3ROJ A;  1LEV A;  4NGU A;  4MHF A;  4N91 A;  1FPK A;  5T3J A;  2FHY A;  4NG7 A;  5ET5 A;  1FPI A;  5J16 A;  2XWO A;  2DE3 A;  1EYK A;  3T0J A;  2B4M A;  4O94 A;  1NV6 A;  2QVU A;  4HCW A;  5I7I A;  2FVZ A;  1XI6 A;  4OVS A;  2Y5L A;  1LBV A;  2HZK A;  1YYZ A;  4HE0 A;  4N81 A;  4GX3 A;  4PAI A;  2F3D A;  1K9Y A;  3IFC A;  1NV2 A;  5EQ9 A;  1INP A;  1KZ8 A;  4AS5 A;  4F19 A;  4HXV A;  4MNI A;  1FPD A;  3U65 A;  2P3N A;  1LBX A;  2F3B A;  4O7M A;  3E79 A;  4PTK A;  5IZ3 A;  4OVQ A;  3GYY A;  4N8Y A;  4I3Y A;  2QVR A;  5FBP A;  2XXK A;  3KC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...