1LBYA

Crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 manganese ions, fructose-6-phosphate, and phosphate ion
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 83
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbyA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbyA02
3IFCA 1RDYA 3LV0A 2FHYA 5I3SA 5LDZA 2VT5A 1NV3A 5EQ9A 1NV6A 3D1RA 2WBDA 1DK4A 1IMCA 5A5LA 1FPBA 2OWZA 4I3YA 4I40A 2GQ1A 2F3DA 2WBBA 3ROJA 3T0JA 1FPKA 1LBVA 1FBPA 1LBYA 5ET5A 1DBZA 2CZIA 1YYZA 4GBVA 1SPIA 1BK4A 2CZKA 1DCUA 5J16A 1AWBA 4GX4A 1FRPA 2FVZA 1FBGA 4GX6A 2OX3A 2F3BA 1LBWA 2JJKA 3KC1A 1CNQA 2FIXA 1KA1A 1NUWA 1EYKA 1LEVA 1NV5A 1LBXA 4KXPA 2WEFA 4MJOA 4N81A 4G61A 1FJ6A 1NI9A 4H45A 4PTKA 1EYIA 2BJIA 1K9YA 4AS5A 1FPEA 4GWXA 1NV7A 4GWZA 2PCRA 5ESYA 4H46A 1NV4A 1NV2A 2FIEA 5IZ1A 3RPLA 2Q74A 1FPGA 2P3VA 1RDZA 1G0IA 3RYDA 3KC0A 4GBWA 2QVRA 1EYJA 5EQ8A 5IZ3B 5IZ3A 5ET8A 3BIHA 2Q8MA 1FJ9A 5EYGA 1NV0A 1INPA 1FBFA 2DDKA 1IMFA 1FPLA 3B8BA 2HHMA 1FBHA 1NUYA 4GWUA 4IR8A 1FBCA 5ET7A 1FPIA 1LBZA 2Y5KA 4GWSA 1QGXA 4GWWA 1FBDA 1RDXA 5FBPA 3BIGA 1K9ZA 4HE1A 1Q9DA 1FSAA 1IMDA 3QMFA 5EQ7A 1IMAA 2CZHA 3RPLB 1FBEA 4FBPA 4HE0A 4QXDA 1JP4A 2QFLA 1KA0A 4O7IA 1FPFA 1VDWA 1YZ0A 4GX3A 5DW8A 1NUZA 5EQAA 4I3EA 3KBZA 2QVVA 1KZ8A 2QVUA 1D9QA 1FTAA 1FPJA 2R8TA 2P3NA 1FPDA 3LUZA 3FBPA 4HXVA 1YXIA 1NUXA 5ET6A 5F24A 2Y5LA 4HE2A 4AS4A 1IMEA 3A29A 5T3JA 4GWYA 2FBPA 5EYHA 1IMBA 1XI6A 1NV1A 3IFAA 1G0HA
chains in the Genus database with same CATH superfamily
4MLVA 4LQ2A 3RN8A 1DK4A 3OOAA 2AL4A 3A3UA 1POY1 1BTJA 3HN0A 1MY1A 3HHGA 4XFEA 1II5A 2HZLA 4BDMA 2O69A 1FTJA 1DCUA 3MJNA 2HZKA 1MQDA 2OBGA 3MPKA 1P99A 4DZ1A 1ZJLA 1FW0A 3IB2A 4MF3A 3H6UA 5B7DA 1TT1A 4ECFA 4NWDA 1LBXA 2XX8A 2PVUA 1UQWA 5FTHA 3E4RA 1OQGA 1K9YA 3UGWA 1WODA 2PCRA 1B2HA 3IORA 3JYRA 4OZ9A 5I56A 2V84A 1JEUA 4F2OA 4UABA 5IZ3B 3TCGA 1H44A 1JNFA 3ONMA 3O6IA 3PGFA 1GV8A 3U8QA 2Y7PA 4DXUA 3U72A 4QHQA 4OETA 4HE1A 5AA2B 1LAXA 1P1OA 5EQ7A 3K2DA 5JK4A 1SW1A 4RXLA 2XXWA 4DXBA 2Y7WA 1VDWA 4F22A 3O66A 3T93B 2THIA 1KZ8A 1QKBA 1D9QA 4R9FA 3U94A 2DE3A 4PDHA 1LB8A 3TYHA 3PUWE 3VE1B 2DXRA 2DXYA 1VFEA 3FXQA 5HBCA 4OXVA 2GQ1A 1LAFE 1B7UA 2WX9A 3LSXA 4I8CA 3O97A 3VDFA 1GGGA 4TQUQ 5FTIA 2VD2A 1URGA 1LGBC 2WYPA 5F7VA 1FBGA 3O9PA 1JVYA 4KPTA 2REJA 1PC3A 3MVXA 2AIXA 3ILTB 4N81A 2OCUA 2LAOA 1FJ6A 1IIWA 4GVOA 4Q8RA 5I2KB 3Q27A 4HS7A 4QF9A 5H8HB 5DEXA 2V4CA 1IXGA 4POXA 1QJMA 1FQDA 3KFMA 4X1DA 2QVRA 1B58A 5EQ8A 4I62A 5ET8A 4QFLA 1QUJA 3OO8A 4BDNA 1INPA 4XKRA 4NMYA 4GWUA 2UVIA 1QW0A 4OFLA 4PE5B 4OA4A 4MNPA 3GXAA 3CFZA 3TTLA 4N13A 4F18A 4FBPA 3E79A 3MUQA 4YKIA 3H6WA 4ZZAA 1FPFA 2PT1A 3M3LA 4PGNA 4OVQA 2ZYKA 3VLWA 1FPJA 3SZPA 2UYEA 2Y7IA 5ET6A 4MHFA 3V89B 5T3JA 2FBPA 2Q74A 1XI6A 1D9VA 3EQ1A 4FAJA 3IFCA 3D4GA 2RKMA 4IGTA 3O6GA 3TDJA 2M8CA 2HCAA 4M4GA 1MDP1 3MP1A 4C0RA 2ONRA 2Q88A 4LUBA 2ALUA 1SPIA 1MG1A 2GFEA 3EHUA 2D21A 3MC2A 1FQAA 2OJTA 5F1QA 4THIA 4NF5A 3OD7A 4G68A 1MPDA 2OX3A 3KJTA 2F3BA 4XIGQ 5JTYB 4LVQA 2ABHA 3GLBA 1B46A 4K3FA 5DVFA 2NUVA 2Y7KA 3OMBA 4N91A 2PT2A 1UTBB 4H8JA 5I59A 5AA2D 4WKMA 2QS4A 4KD5A 1J1NA 3PPNA 3FIRA 1Y1MA 3Q26A 3PUVE 3PMXA 2R71A 5CMMA 5M2VA 2ZNTA 4IR8A 4F3SA 3EHSA 4E0WA 5ISUA 4YMAA 4DE8A 4PFYA 1B7HA 2F35A 4HE0A 1I6QA 5L8DA 1Y9UA 3PMWA 1MM7A 1JP4A 4WEDA 4ONYA 4R6HA 1HSEA 1LLSA 2Q89A 1IXIA 1HSJA 1NNKA 2Z8EA 5FHMA 2V3QA 3FVNA 4JXIA 2XXRA 3T1BA 1VFDA 1MY3A 2QMWA 4N4UA 4YZZA 1UTHA 1IMEA 3ZKKA 2XWKA 1ZIUA 4WEPA 4GXSB 3C4MA 4YICA 4HCYA 4U1OA 3QUJA 4O94A 4ZECA 1FPBA 2RCAA 2P2AA 1M5EA 3ILUB 3ZS6A 3CIJA 1H43A 1LBVA 2RC8A 5ELVA 1LB9A 3MQ9A 2FVZA 5I5PA 1OVTA 1ATGA 3V5AA 1LBWA 2Q9TA 1B3GA 3E3KA 3FGSA 2RC9A 2PFZA 3IOVA 3FXBA 1B3LA 3FXRA 1VE4A 2HAVA 5J1DA 1EH3A 1EYIA 2PX1A 2DWIA 4NF6B 1FPEA 3IO4A 2H9BA 1M5DA 4RJZA 2ZNUA 4OENA 2GRVA 3CVGA 4RPOA 3PUXE 3FXUA 5KDTA 4JB7A 2O51A 3T66A 3IO6A 5ET7A 2Y5KA 4RYAA 1P1NA 3QAXA 5H8NA 3IOTA 3DP8A 4F31B 3SEYA 5CBRA 2FYIA 4H65A 2ZNSA 3WAEA 1DMBA 2PBWA 4NQ8A 4PETA 2E1SA 3VFJA 4UA8A 3WAFA 4LZ7A 1NMUA 4O3AA 4E0XA 1B32A 1FTAA 1JVXA 1PDAA 1QKAA 3EHTA 3UORA 1YXIA 3TQLA 2OWTA 2QL3A 3G3HA 4PFBA 4JSDA 3TTRA 4O7MA 3CHGA 2O1LA 3FD3A 5I3SA 1ZBMA 3RLFE 5LDZA 4PFWA 4QFOA 3TKDA 1RYOA 3FASA 4R74A 1LBYA 1PBPA 2CZIA 5LOMA 4HCWA 1US5A 1SD3A 3LC8A 4NF4B 3VLUA 3HFUA 3R7XA 3A09A 4KXPA 1Y3QA 4MJOA 3P7IA 4ISUA 3HO7A 3C32A 3LBSA 4ELRA 1SBPA 2O7UA 3GBBA 5AA2A 5DVJA 5AA4A 4H67A 5CMBA 2FIEA 3QSLA 1JW5A 3KC0A 4GBWA 1H3DA 1DPEA 3Q28A 1PB8A 2PFYA 2Q8MA 2RF1A 1FJ9A 1AOVA 1A8FA 4TLLB 4GWSA 1FBDA 2ZYOA 3BIGA 1B0LA 3HSTA 3CFXA 4AB6A 1BP5A 4GOTA 2G93A 1B5IA 4PFTA 4KFQA 1FBEA 4JWYA 2H4IA 2F8DA 4DCYA 1LSTA 2QFLA 2I0CA 3EKIA 2XHDA 2ZZXA 1O63A 3K6UA 4GL8A 4NTLA 4HE2A 3KSJA 4ELOA 1JW4A 4ZDMA 2XWVA 1Y3PA 2VGQA 4NWCA 3TELA 2XXIA 1B0HA 3T9XB 5EQ9A 2XA5A 1AL3A 1PEBA 3UIFA 3SEUA 5AA3A 4MIJA 1B1XA 5I2KA 2DWHA 3PD8A 3EF7A 2W7YA 3PUZE 5H8HA 3DP4A 1MH3A 1MXXA 4YMBA 1OQHA 1EU8A 2FIXA 3CG1A 1LEVA 3O29A 1IUDA 1M5BA 3PUYE 3VLVA 1NI9A 2AYSA 4PF6A 3SESA 4ZE9A 4YU0A 3JV9A 4ZZEA 4XTCQ 5FHNA 4WXJA 3S9EA 1ZTYA 4FATA 4ELPA 4OQOA 3RTWB 3V8XB 4G68C 1Q1KA 1B51A 5BUUA 2VPNA 3G3FA 1CE2A 5HM4B 4ZE8A 3UP9A 2KQZA 3MVYA 3H06B 3FV1A 2Q2AA 1USYH 2WYKA 1A99A 1GVCA 1M5CA 3T9VA 1B3EA 4PAIA 1YZ0A 1TFAA 3DP6A 3IB1A 4OFOA 3T9UA 1B9JA 3HV1A 4NN3A 1IMBA 3I6VA 3G3IA 4N15A 1BK4A 2FHYA 2GHAA 4FJPA 2VT5A 5JTYA 3KOTA 2DOJA 2XXYA 4I40A 3ROJA 1UTBA 2XXTA 3I5OA 3SETA 1OVBA 1WVJA 2CZKA 1O7TA 2XXVA 4JWXA 3MP6A 1FRPA 2XXQA 2I3VA 4U1ZA 1NUWA 4OVTA 1UIUA 3H7MA 2I3WA 2OZZA 4OEUA 4DCXA 1JQFA 2HXWA 4PAFA 4P47A 5AE4A 5CMCA 5B70A 1URSA 1MY4A 5AA1A 2V3TA 3G7WA 4JBZA 1LCTA 3JZJA 3PV0E 4Z0IA 4DIGA 1NV0A 1OIBA 2O7IA 3LSWA 1B52A 1LBZA 4GIZA 2UVHA 1O64A 1RDXA 1FTKA 4NF8B 4OVRA 3IB0A 4MEVA 3U92A 2HEUA 2QSXA 3TPAA 4KHZE 3UN6A 2H98A 2OLBA 5TP9B 4MMPA 5TPAA 2YLNA 1PB9A 3ISPA 1SW2A 4KYSA 4AS4A 1MXVA 4U22A 3G3KA 3TEPA 1B3FA 3W9VA 4RPNA 4ZS9A 1IMCA 1NNTA 3KN3A 1MY0A 1BIYA 4G8HA 3TCFA 3KN8A 2OPDA 4P1EA 3L6HA 3VVFA 1OMPA 4PQJA 5EYFA 4R6KA 2DE4A 4RNSA 1T0KA 2ZZVA 4H5GA 1SYHA 1EYKA 1ELJA 1AH5A 1BKAA 5CBSA 2WEFA 1H76A 3FVGA 4C1TA 3LR1A 4EXKA 1M5FA 4GWZA 4H46A 1NV4A 1B4HA 5CC2A 3LSLA 5IZ1A 2QMXA 3H4ZA 1GTKA 3FJMA 3TMGA 3MW0A 3VV5A 1YAEA 1S50A 4OANA 5ITOA 2F5XA 3B8BA 4ZEFA 1OLAA 1Z7ME 1FPIA 3CG3A 4PFIA 1N76A 2I58A 3KOSA 1FSAA 2ZYMA 4PF8A 2V93A 4GRKA 5IZZA 3K6XA 2UXAA 5IAIA 2YJPA 1LFGA 3SKPA 2CEXA 4DDDA 1AMFA 4N8GA 2Y5LA 3K1NA 4JSOA 1P1UA 3TCHA 2Q2CA 4P56A 3B7DA 1LFHA 3PU5A 4EQ9A 3RGYA 1SVXB 3OEKA 3FVOA 1P1WA 5J16A 2HAUA 4MNIA 1HSLA 2PYYA 1NV6A 3N94A 4NF4A 5I58B 3OXNA 3IX1A 5A5XB 4BDRA 4I3YA 2F3DA 2I6EA 1GR2A 2O6AA 2Z8FA 2XXKA 3TODA 1FBPA 3UA8A 4OESA 3MZBA 4YAHX 3C31A 4YKJA 3GBAA 3IR1A 4MAGA 1TFDA 2HPGA 3SERA 3QIMA 5H8SA 3BFUA 3KC1A 2RINA 1IITA 1NV5A 2XX7A 1I6AA 4P0IA 5KCJB 4NF0A 1SDXA 4PTKA 3V83A 2O68A 4RA1A 2DE2A 5ESYA 1XVXA 3L6GA 5DEXB 2O84X 2R9JA 1MXWA 4BDOA 2A5SA 3KEIA 3K6VA 5DVIA 5EYGA 4O3CA 3RQTA 3FV2A 3FZVA 4P11A 4JVDA 4PC9A 3B50A 3M3FA 3CRBA 1Q9DA 4ZEKA 1DTZA 2ESNA 3K00A 1B40A 4QXDA 4PFRA 1TWYA 4MH5A 4AB5A 3H3GA 5H8QB 1KA0A 4UACA 3GZGA 1PBQA 4EQBA 5EQAA 3F11A 3S9LC 3KGCA 4KCCA 3FBPA 5LTCA 2Y7RA 3VVDA 4OVPA 3ZSFA 1D4NA 2QJEA 4GWYA 1MH4A 1MQJA 2D3IA 3K01A 3MYUA 3SEWA 4FEDA 4RY1A 2QPQA 4KI0E 1R1NA 3FVKA 3T0JA 2XD2A 2B4LA 4OERA 2ZXTA 1L5TA 4R75A 5ET5A 2F78A 1YYZA 1DPPA 4NE4A 3RTFB 1SW5A 2YPNA 4XKNA 3NOHA 4YB7A 2CEYA 4NF5B 2RCBA 1H45A 3QXMA 4YKKA 1FTOA 4PP0A 4P8BA 1FTMA 1VR5A 5I7IA 3KBRA 3N26A 1LAHE 5I59B 2DQVA 2ONSA 2DWAA 1TXFA 2XX9A 1CB6A 3KG2A 2H25A 1DSNA 2X7QA 4N17A 2UYFA 4AQ4A 1Y1ZA 2XXXA 3FJGA 4EXLA 3K1PA 4L17A 4R2FA 5IZ3A 1RKMA 5I84A 1B3HA 2PMSA 3MZ9A 4LZ8A 4LONB 1IMFA 3Q25A 1MXYA 2B65A 1MQHA 1B05A 2A5TB 3MVZA 5I57B 1QULA 1NFTA 3VXCA 4FORA 3O28A 3KBZA 4ESXA 1FQBA 1B6HA 1BLFA 4HXVA 2I4BA 2H5YA 3SEVA 2BJJX 4QFNA 2DSFA 3MPLA 1P1QA 1NV1A 4H8IA 3LV0A 3T9HB 3M3KA 4PAKA 1D9YA 2Z23A 4JVCA 2HXRA 2OWZA 1LBBA 2FA7A 4NEDA 3VVEA 3T96B 1RYXA 1USYE 4BDQA 4G4PA 4OMBA 4MNCA 4Q30B 4Q0CA 3DLNA 3RUMA 2F7AA 5K2YA 3OO6A 3DM0A 4ZEBA 3CFLA 2I49A 3R6UA 1CNQA 5CMKA 2VHAA 4MFIA 3IL1B 3H6VA 1Y4TA 1R9QA 4H45A 3T22A 3FUZA 4PBQA 1NV7A 4MCOA 4NF8A 1EZOA 1QVSA 2F6GA 1FPGA 2XWIA 3O2AA 1RDZA 3RYDA 3CSBA 2UVGA 3U65A 4N07A 5L9OA 5TP9A 5ITPA 2NXOA 1ZU0A 1Y3NA 2VPOA 4P1LA 4X04A 4G8MA 5EHSA 5KZTA 1POTA 2GHBA 1IQ7A 3IK6B 1R6ZA 3OENA 2R6GE 5ICTA 4DXCA 3MAMA 1MQGA 4GX3A 1URDA 4LP2B 5DYHA 4X1BA 3G3GA 3S4UA 2UVJA 4QBAA 2X26A 1IEJA 1YTVA 4H0WA 2I48A 3K4UA 1F9BA 3KN7A 1RDYA 5EHMA 1SQYA 4GD5A 2CZLA 3PPQA 2DVZA 1XS5A 1N7WA 5TU0A 4LA9A 2OK2A 4PE3A 3VXBA 2F7CA 3E78A 3TAJA 3RT8A 2QS2A 3KSXA 1SI1A 2HQ0A 4R72A 3TUSA 4OYVA 3BFTA 1S9TA 4G61A 1Y4CA 3K0VA 2QS1A 5K2XA 1KWHA 1D3KA 5AA4B 4OTEA 3C34A 3IOUA 5BWJA 4R2BA 3MBPA 1Q35A 3RPWA 4P3LA 4QSCA 5FHOA 1A8EA 4F1YA 4NX1A 1A7LA 2P0SA 5DT6A 2VOZA 4TLMB 5I2NB 1NUYA 4GWWA 5FBPA 1K9ZA 4I1DA 3B6TA 4GFRA 4Z7EA 2F7BA 3QMFA 2O1MA 3RPLB 4X48A 4DI4B 4RK2A 2XXUA 3USDA 2X7PA 5I58A 3N5LA 5A5XA 4XEQA 1N7XA 4F29A 1B1HA 4XKQA 2B4MA 2R8TA 1FPDA 3LUZA 2V3UA 3S9NC 1NUXA 5F24A 5DTBA 3TFLA 1MXZA 2DVCA 3C9HA 4IO6A 4HTGA 1A54A 3Q29A 3C33A 3OO7A 1QUIA 4KYEA 5H8FB 1QUKA 4OVSA 2NVUB 5KCJA 2I4CA 3LSFB 5CM6A 1I69A 2ZZWA 4ELQA 3KZGA 4GXAA 3G3JA 1FQFA 3K1MA 5IKBA 5CRYA 2JJKA 1XHYA 4FEBA 3ECRA 4KR5A 3HCQA 4GL0A 1DOTA 1IZ1A 4GQOA 4LZ5A 1NKXA 4PDDA 4N6PA 5CI5A 4AS5A 4NF6A 5IGAA 4GWXA 1MS7A 2FNCA 4PGPA 4IO2A 2KR0A 4X9TA 4N6KA 5H8QA 1EYJA 2E0SA 4MBPA 4NGUA 4RK9A 1UIVA 3OELA 3A3CA 1FPLA 5L9MA 2HHMA 1FBHA 3LUYA 2H99A 1N84A 4U2RA 3CSGA 4YB6A 4EF2A 5HPQA 4F39A 1SI0A 4O3BA 4OVJA 2CZHA 4NG7A 5I56B 1PB7A 1XC1A 4ZEIA 4IY5A 4O7IA 4G77A 1Z7NE 2P1SA 4MLQA 3IJOB 4MX6A 1MXUA 2P3NA 4ESWA 1N3XA 4NAPA 1JETA 4IGRA 4C1UA 1NNPA 2D5WA 2MKZA 3ODBA 3A29A 5EYHA 2QRYA 1XVYA 4R9GA 1G0HA 1DTGA 3BBRA 3D4CA 1Y20A 1NV3A 1B4ZA 4F1UA 3FATA 2XXPA 2B3FA 4PFUA 4EDPA 5A5LA 3TZAA 4F19A 4F3GA 1FPKA 1NH7A 2DP8A 1ZMGA 2G29A 2OPEA 3OSQA 1LCFA 2Q8JA 4EF1A 2DS9A 5L9SA 1NNFA 1US4A 4P9KA 3RNNA 4ND9A 4LN5A 4N6DA 2QS3A 1N3WA 3W9WA 3O6HA 4Q5TA 4F3BA 2A5TA 1SYIA 5I57A 4IO3A 4U21A 2HFBA 3AXFA 3DELB 4QRZA 1N04A 2NWJA 4YB5A 2ZMBA 4H1XA 1ZLQA 2DDKA 4XF5A 2ZYNA 2RC7A 3CI8A 1YCJA 4GF8A 4QFKA 3PPRA 4BDLA 3OSRA 3E9XA 2I0BA 3EPEA 3PMVA 1SW4A 4EUOA 3GYYA 1XOCA 1JEVA 1R9LA 4R73A 4ZEDA 3CR9A 4IO7A 2XD3A 4YKPA 4PBHA 5DW8A 4EQ7A 4I3EA 1NL5A 1MRPA 5TPAB 3QUFA 1FQCA 4HW8A 4JVIA 2GH9A 4XKPA 2ANJA 4GLIA 4U4SA 4G8NA 3IFAA 3H6TA 1OLCA 3H03A 1ANFA 4JWOA 4U4XA 2WBBA 1MQIA 2XWOA 3MVWA 2AL5A 1AWBA 3HPIA 4KQPA 2XXHA 2WKYA 3THIA 3UK4A 1LBCA 3RY3A 2CMOA 1FCKA 1FTLA 1YPNA 4F3PA 1LAGE 4BLAA 3C36A 2F34A 2BJIA 4XXUA 1S7YA 3SEXA 1EZPA 2REGA 3IAZA 2P3VA 4G68B 2KLFA 3N6UA 1ZKBA 3MP8A 3TTMA 2Z8DA 4LATA 4TOZA 1MPCA 3M8UA 3QYTA 4IO4A 4OHNA 3MSTA 4IB2A 3R26A 2IEEA 1MY2A 1LFIA 1FBCA 5ICQA 4POWA 4KCDA 3QK6A 3K02A 1N0TA 3RT6B 4R6YA 1IMAA 1MPBA 3SDFA 2OWSA 3U1OA 2F6PA 3PTYA 2Z22A 4OWDA 3S9MC 1NUZA 2ONKE 1EZ9A 1B5HA 4O8MA 3B6QA 4X8RA 3S2VA 2QVUA 3W15C 2VD3A 3E13X 4NHBA 3KJ7A 3IJXB 4P0GA 3D1RA 2WBDA 3ZKLA 4OEVA 4H5FA 1FQEA 1VSOA 4IO5A 2DWJA 1B7ZA 3U93A 1DBZA 3FJ7A 4GBVA 4H6DA 1A55A 4GX4A 1UTHB 1MM6A 4GX6A 4FIMA 1KA1A 2V25A 1MDQA 4FE8A 1A40A 5I2NA 3TQWA 5IM2A 3IOWA 4FECA 1NH8A 4GWOA 4QFPA 1NV2A 4U23A 4I9DA 3RPLA 4QSEA 4DLDA 3N6TA 4JDFA 3PD9A 1G0IA 2L5VA 4QSDA 4N8YA 1AIVA 3MZ1A 3BIHA 2IA4A 4F2QA 1I6BA 1FBFA 3PPPA 2Y84A 1IXHA 3OO9A 4PCDA 3MWBA 1QGXA 3TTKA 3TTNA 3I3VA 2NOOA 1IMDA 5JEIA 3EN3A 2F97A 1IXCA 2F36A 2VP1A 4F1VA 5H8FA 4DI3D 3BKIB 2QVVA 4KYDA 5KDTB 1JW1A 2B3BA 4M1VA 1B5JA 4G2ZA 3C35A 2DYXA 3HHFA 3OEMA 1XT8A 3K6WA 5H8NB 3PPOA 4OFJA 3B6WA 4LQ5A 1WDNA 4IY6A
chains in the Genus database with same CATH topology
5I3SA 5LDZA 1NV6A 1DK4A 4OVSA 4I3YA 2F3DA 2XXKA 1FBPA 1LBYA 5CM6A 2ZZWA 2CZIA 4XFEA 2HZLA 4HCWA 1DCUA 2HZKA 4MAGA 2HPGA 2JJKA 3KC1A 3HFUA 1NV5A 1LBXA 4KXPA 4MJOA 4NF0A 4PTKA 4PDDA 1K9YA 4AS5A 5IGAA 4GWXA 2DE2A 2PCRA 5ESYA 2FIEA 4PGPA 2KR0A 3KC0A 4X9TA 4GBWA 4N6KA 1EYJA 4UABA 5IZ3B 4NGUA 2PFYA 2Q8MA 1FJ9A 5EYGA 1FPLA 2HHMA 1FBHA 4GWSA 1FBDA 4JVDA 4PC9A 3B50A 3BIGA 4HE1A 1Q9DA 5EQ7A 2CZHA 4NG7A 1FBEA 4QXDA 4PFRA 5JK4A 2QFLA 1KA0A 4O7IA 3EKIA 1VDWA 5EQAA 2ZZXA 1KZ8A 4MX6A 1D9QA 2P3NA 3FBPA 5LTCA 4NAPA 2DE3A 4OVPA 4PDHA 4HE2A 2MKZA 2XWVA 3A29A 4GWYA 5EYHA 3MYUA 1G0HA 1NV3A 5EQ9A 2XA5A 4F1UA 2QPQA 5A5LA 4F19A 2GQ1A 2WX9A 4MIJA 3T0JA 1FPKA 2B4LA 5ET5A 1YYZA 3NOHA 2CEYA 2WYPA 1FBGA 4P9KA 2FIXA 4P8BA 1LEVA 4LN5A 4N81A 4N6DA 5I7IA 1FJ6A 1NI9A 4PF6A 3W9WA 2V4CA 4N17A 2QVRA 5EQ8A 5IZ3A 5ET8A 1INPA 2DDKA 1IMFA 4XF5A 4GWUA 2VPNA 2KQZA 4OA4A 4MNPA 2WYKA 4F18A 3GYYA 4FBPA 3E79A 4PAIA 1FPFA 1YZ0A 4PBHA 5DW8A 4I3EA 4PGNA 3KBZA 4OVQA 1FPJA 3SZPA 4HXVA 5ET6A 4JVIA 4MHFA 5T3JA 2FBPA 4NN3A 1IMBA 2Q74A 1XI6A 1NV1A 3IFAA 1BK4A 4N15A 3IFCA 3LV0A 2FHYA 4PAKA 4JVCA 2VT5A 2HXRA 2OWZA 4I40A 2WBBA 3ROJA 2XWOA 1SPIA 2CZKA 4MNCA 1AWBA 1FRPA 2OX3A 2F3BA 1CNQA 1NUWA 4OVTA 4H45A 4N91A 2BJIA 4PAFA 4P47A 4PBQA 1NV7A 4MCOA 1FPGA 2XWIA 2P3VA 1RDZA 3RYDA 3U65A 1NV0A 3MSTA 4IR8A 1FBCA 1LBZA 1RDXA 2VPOA 4P1LA 4X04A 1IMAA 4OVRA 4HE0A 4MEVA 3PTYA 1JP4A 4GX3A 1NUZA 4O8MA 4MMPA 4X8RA 2QVUA 2V3QA 3ISPA 3T1BA 4AS4A 4QBAA 4N4UA 4YZZA 1IMEA 4NHBA 2XWKA 1RDYA 4YICA 4HCYA 4O94A 3W9VA 3D1RA 2WBDA 2DVZA 1IMCA 1FPBA 1LBVA 4P1EA 1DBZA 4GBVA 4PE3A 4GX4A 2FVZA 4GX6A 5I5PA 3E78A 2DE4A 1LBWA 2ZZVA 2Q9TA 1KA1A 1EYKA 2PFZA 3FXBA 2WEFA 5IM2A 5J1DA 4G61A 1EYIA 1FPEA 4GWZA 4H46A 1NV4A 1NV2A 5IZ1A 3RPLA 1G0IA 2L5VA 4N8YA 4P3LA 4OANA 3BIHA 4NX1A 2F5XA 1FBFA 3B8BA 1NUYA 4PCDA 5ET7A 1FPIA 2Y5KA 1QGXA 4GWWA 5FBPA 1K9ZA 4PFIA 1FSAA 1IMDA 3QMFA 4NQ8A 3RPLB 4DI4B 4PF8A 4PETA 4F1VA 5IZZA 4DI3D 4XEQA 2QVVA 4M1VA 1FTAA 2B4MA 2R8TA 1FPDA 3LUZA 2CEXA 1YXIA 1NUXA 5F24A 4N8GA 2Y5LA 4PFBA 4P56A 4O7MA 3CHGA 5J16A 4MNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFC A;  1RDY A;  3LV0 A;  2FHY A;  5I3S A;  5LDZ A;  2VT5 A;  1NV3 A;  5EQ9 A;  1NV6 A;  3D1R A;  2WBD A;  1DK4 A;  1IMC A;  5A5L A;  1FPB A;  2OWZ A;  4I3Y A;  4I40 A;  2GQ1 A;  2F3D A;  2WBB A;  3ROJ A;  3T0J A;  1FPK A;  1LBV A;  1FBP A;  1LBY A;  5ET5 A;  1DBZ A;  2CZI A;  1YYZ A;  4GBV A;  1SPI A;  1BK4 A;  2CZK A;  1DCU A;  5J16 A;  1AWB A;  4GX4 A;  1FRP A;  2FVZ A;  1FBG A;  4GX6 A;  2OX3 A;  2F3B A;  1LBW A;  2JJK A;  3KC1 A;  1CNQ A;  2FIX A;  1KA1 A;  1NUW A;  1EYK A;  1LEV A;  1NV5 A;  1LBX A;  4KXP A;  2WEF A;  4MJO A;  4N81 A;  4G61 A;  1FJ6 A;  1NI9 A;  4H45 A;  4PTK A;  1EYI A;  2BJI A;  1K9Y A;  4AS5 A;  1FPE A;  4GWX A;  1NV7 A;  4GWZ A;  2PCR A;  5ESY A;  4H46 A;  1NV4 A;  1NV2 A;  2FIE A;  5IZ1 A;  3RPL A;  2Q74 A;  1FPG A;  2P3V A;  1RDZ A;  1G0I A;  3RYD A;  3KC0 A;  4GBW A;  2QVR A;  1EYJ A;  5EQ8 A;  5IZ3 B;  5IZ3 A;  5ET8 A;  3BIH A;  2Q8M A;  1FJ9 A;  5EYG A;  1NV0 A;  1INP A;  1FBF A;  2DDK A;  1IMF A;  1FPL A;  3B8B A;  2HHM A;  1FBH A;  1NUY A;  4GWU A;  4IR8 A;  1FBC A;  5ET7 A;  1FPI A;  1LBZ A;  2Y5K A;  4GWS A;  1QGX A;  4GWW A;  1FBD A;  1RDX A;  5FBP A;  3BIG A;  1K9Z A;  4HE1 A;  1Q9D A;  1FSA A;  1IMD A;  3QMF A;  5EQ7 A;  1IMA A;  2CZH A;  3RPL B;  1FBE A;  4FBP A;  4HE0 A;  4QXD A;  1JP4 A;  2QFL A;  1KA0 A;  4O7I A;  1FPF A;  1VDW A;  1YZ0 A;  4GX3 A;  5DW8 A;  1NUZ A;  5EQA A;  4I3E A;  3KBZ A;  2QVV A;  1KZ8 A;  2QVU A;  1D9Q A;  1FTA A;  1FPJ A;  2R8T A;  2P3N A;  1FPD A;  3LUZ A;  3FBP A;  4HXV A;  1YXI A;  1NUX A;  5ET6 A;  5F24 A;  2Y5L A;  4HE2 A;  4AS4 A;  1IME A;  3A29 A;  5T3J A;  4GWY A;  2FBP A;  5EYH A;  1IMB A;  1XI6 A;  1NV1 A;  3IFA A;  1G0H A; 
#chains in the Genus database with same CATH topology
 4MLV A;  4LQ2 A;  3RN8 A;  1DK4 A;  3OOA A;  2AL4 A;  3A3U A;  1POY 1;  1BTJ A;  3HN0 A;  1MY1 A;  3HHG A;  4XFE A;  1II5 A;  2HZL A;  4BDM A;  2O69 A;  1FTJ A;  1DCU A;  3MJN A;  2HZK A;  1MQD A;  2OBG A;  3MPK A;  1P99 A;  4DZ1 A;  1ZJL A;  1FW0 A;  3IB2 A;  4MF3 A;  3H6U A;  5B7D A;  1TT1 A;  4ECF A;  4NWD A;  1LBX A;  2XX8 A;  2PVU A;  1UQW A;  5FTH A;  3E4R A;  1OQG A;  1K9Y A;  3UGW A;  1WOD A;  2PCR A;  1B2H A;  3IOR A;  3JYR A;  4OZ9 A;  5I56 A;  2V84 A;  1JEU A;  4F2O A;  4UAB A;  5IZ3 B;  3TCG A;  1H44 A;  1JNF A;  3ONM A;  3O6I A;  3PGF A;  1GV8 A;  3U8Q A;  2Y7P A;  4DXU A;  3U72 A;  4QHQ A;  4OET A;  4HE1 A;  5AA2 B;  1LAX A;  1P1O A;  5EQ7 A;  3K2D A;  5JK4 A;  1SW1 A;  4RXL A;  2XXW A;  4DXB A;  2Y7W A;  1VDW A;  4F22 A;  3O66 A;  3T93 B;  2THI A;  1KZ8 A;  1QKB A;  1D9Q A;  4R9F A;  3U94 A;  2DE3 A;  4PDH A;  1LB8 A;  3TYH A;  3PUW E;  3VE1 B;  2DXR A;  2DXY A;  1VFE A;  3FXQ A;  5HBC A;  4OXV A;  2GQ1 A;  1LAF E;  1B7U A;  2WX9 A;  3LSX A;  4I8C A;  3O97 A;  3VDF A;  1GGG A;  4TQU Q;  5FTI A;  2VD2 A;  1URG A;  1LGB C;  2WYP A;  5F7V A;  1FBG A;  3O9P A;  1JVY A;  4KPT A;  2REJ A;  1PC3 A;  3MVX A;  2AIX A;  3ILT B;  4N81 A;  2OCU A;  2LAO A;  1FJ6 A;  1IIW A;  4GVO A;  4Q8R A;  5I2K B;  3Q27 A;  4HS7 A;  4QF9 A;  5H8H B;  5DEX A;  2V4C A;  1IXG A;  4POX A;  1QJM A;  1FQD A;  3KFM A;  4X1D A;  2QVR A;  1B58 A;  5EQ8 A;  4I62 A;  5ET8 A;  4QFL A;  1QUJ A;  3OO8 A;  4BDN A;  1INP A;  4XKR A;  4NMY A;  4GWU A;  2UVI A;  1QW0 A;  4OFL A;  4PE5 B;  4OA4 A;  4MNP A;  3GXA A;  3CFZ A;  3TTL A;  4N13 A;  4F18 A;  4FBP A;  3E79 A;  3MUQ A;  4YKI A;  3H6W A;  4ZZA A;  1FPF A;  2PT1 A;  3M3L A;  4PGN A;  4OVQ A;  2ZYK A;  3VLW A;  1FPJ A;  3SZP A;  2UYE A;  2Y7I A;  5ET6 A;  4MHF A;  3V89 B;  5T3J A;  2FBP A;  2Q74 A;  1XI6 A;  1D9V A;  3EQ1 A;  4FAJ A;  3IFC A;  3D4G A;  2RKM A;  4IGT A;  3O6G A;  3TDJ A;  2M8C A;  2HCA A;  4M4G A;  1MDP 1;  3MP1 A;  4C0R A;  2ONR A;  2Q88 A;  4LUB A;  2ALU A;  1SPI A;  1MG1 A;  2GFE A;  3EHU A;  2D21 A;  3MC2 A;  1FQA A;  2OJT A;  5F1Q A;  4THI A;  4NF5 A;  3OD7 A;  4G68 A;  1MPD A;  2OX3 A;  3KJT A;  2F3B A;  4XIG Q;  5JTY B;  4LVQ A;  2ABH A;  3GLB A;  1B46 A;  4K3F A;  5DVF A;  2NUV A;  2Y7K A;  3OMB A;  4N91 A;  2PT2 A;  1UTB B;  4H8J A;  5I59 A;  5AA2 D;  4WKM A;  2QS4 A;  4KD5 A;  1J1N A;  3PPN A;  3FIR A;  1Y1M A;  3Q26 A;  3PUV E;  3PMX A;  2R71 A;  5CMM A;  5M2V A;  2ZNT A;  4IR8 A;  4F3S A;  3EHS A;  4E0W A;  5ISU A;  4YMA A;  4DE8 A;  4PFY A;  1B7H A;  2F35 A;  4HE0 A;  1I6Q A;  5L8D A;  1Y9U A;  3PMW A;  1MM7 A;  1JP4 A;  4WED A;  4ONY A;  4R6H A;  1HSE A;  1LLS A;  2Q89 A;  1IXI A;  1HSJ A;  1NNK A;  2Z8E A;  5FHM A;  2V3Q A;  3FVN A;  4JXI A;  2XXR A;  3T1B A;  1VFD A;  1MY3 A;  2QMW A;  4N4U A;  4YZZ A;  1UTH A;  1IME A;  3ZKK A;  2XWK A;  1ZIU A;  4WEP A;  4GXS B;  3C4M A;  4YIC A;  4HCY A;  4U1O A;  3QUJ A;  4O94 A;  4ZEC A;  1FPB A;  2RCA A;  2P2A A;  1M5E A;  3ILU B;  3ZS6 A;  3CIJ A;  1H43 A;  1LBV A;  2RC8 A;  5ELV A;  1LB9 A;  3MQ9 A;  2FVZ A;  5I5P A;  1OVT A;  1ATG A;  3V5A A;  1LBW A;  2Q9T A;  1B3G A;  3E3K A;  3FGS A;  2RC9 A;  2PFZ A;  3IOV A;  3FXB A;  1B3L A;  3FXR A;  1VE4 A;  2HAV A;  5J1D A;  1EH3 A;  1EYI A;  2PX1 A;  2DWI A;  4NF6 B;  1FPE A;  3IO4 A;  2H9B A;  1M5D A;  4RJZ A;  2ZNU A;  4OEN A;  2GRV A;  3CVG A;  4RPO A;  3PUX E;  3FXU A;  5KDT A;  4JB7 A;  2O51 A;  3T66 A;  3IO6 A;  5ET7 A;  2Y5K A;  4RYA A;  1P1N A;  3QAX A;  5H8N A;  3IOT A;  3DP8 A;  4F31 B;  3SEY A;  5CBR A;  2FYI A;  4H65 A;  2ZNS A;  3WAE A;  1DMB A;  2PBW A;  4NQ8 A;  4PET A;  2E1S A;  3VFJ A;  4UA8 A;  3WAF A;  4LZ7 A;  1NMU A;  4O3A A;  4E0X A;  1B32 A;  1FTA A;  1JVX A;  1PDA A;  1QKA A;  3EHT A;  3UOR A;  1YXI A;  3TQL A;  2OWT A;  2QL3 A;  3G3H A;  4PFB A;  4JSD A;  3TTR A;  4O7M A;  3CHG A;  2O1L A;  3FD3 A;  5I3S A;  1ZBM A;  3RLF E;  5LDZ A;  4PFW A;  4QFO A;  3TKD A;  1RYO A;  3FAS A;  4R74 A;  1LBY A;  1PBP A;  2CZI A;  5LOM A;  4HCW A;  1US5 A;  1SD3 A;  3LC8 A;  4NF4 B;  3VLU A;  3HFU A;  3R7X A;  3A09 A;  4KXP A;  1Y3Q A;  4MJO A;  3P7I A;  4ISU A;  3HO7 A;  3C32 A;  3LBS A;  4ELR A;  1SBP A;  2O7U A;  3GBB A;  5AA2 A;  5DVJ A;  5AA4 A;  4H67 A;  5CMB A;  2FIE A;  3QSL A;  1JW5 A;  3KC0 A;  4GBW A;  1H3D A;  1DPE A;  3Q28 A;  1PB8 A;  2PFY A;  2Q8M A;  2RF1 A;  1FJ9 A;  1AOV A;  1A8F A;  4TLL B;  4GWS A;  1FBD A;  2ZYO A;  3BIG A;  1B0L A;  3HST A;  3CFX A;  4AB6 A;  1BP5 A;  4GOT A;  2G93 A;  1B5I A;  4PFT A;  4KFQ A;  1FBE A;  4JWY A;  2H4I A;  2F8D A;  4DCY A;  1LST A;  2QFL A;  2I0C A;  3EKI A;  2XHD A;  2ZZX A;  1O63 A;  3K6U A;  4GL8 A;  4NTL A;  4HE2 A;  3KSJ A;  4ELO A;  1JW4 A;  4ZDM A;  2XWV A;  1Y3P A;  2VGQ A;  4NWC A;  3TEL A;  2XXI A;  1B0H A;  3T9X B;  5EQ9 A;  2XA5 A;  1AL3 A;  1PEB A;  3UIF A;  3SEU A;  5AA3 A;  4MIJ A;  1B1X A;  5I2K A;  2DWH A;  3PD8 A;  3EF7 A;  2W7Y A;  3PUZ E;  5H8H A;  3DP4 A;  1MH3 A;  1MXX A;  4YMB A;  1OQH A;  1EU8 A;  2FIX A;  3CG1 A;  1LEV A;  3O29 A;  1IUD A;  1M5B A;  3PUY E;  3VLV A;  1NI9 A;  2AYS A;  4PF6 A;  3SES A;  4ZE9 A;  4YU0 A;  3JV9 A;  4ZZE A;  4XTC Q;  5FHN A;  4WXJ A;  3S9E A;  1ZTY A;  4FAT A;  4ELP A;  4OQO A;  3RTW B;  3V8X B;  4G68 C;  1Q1K A;  1B51 A;  5BUU A;  2VPN A;  3G3F A;  1CE2 A;  5HM4 B;  4ZE8 A;  3UP9 A;  2KQZ A;  3MVY A;  3H06 B;  3FV1 A;  2Q2A A;  1USY H;  2WYK A;  1A99 A;  1GVC A;  1M5C A;  3T9V A;  1B3E A;  4PAI A;  1YZ0 A;  1TFA A;  3DP6 A;  3IB1 A;  4OFO A;  3T9U A;  1B9J A;  3HV1 A;  4NN3 A;  1IMB A;  3I6V A;  3G3I A;  4N15 A;  1BK4 A;  2FHY A;  2GHA A;  4FJP A;  2VT5 A;  5JTY A;  3KOT A;  2DOJ A;  2XXY A;  4I40 A;  3ROJ A;  1UTB A;  2XXT A;  3I5O A;  3SET A;  1OVB A;  1WVJ A;  2CZK A;  1O7T A;  2XXV A;  4JWX A;  3MP6 A;  1FRP A;  2XXQ A;  2I3V A;  4U1Z A;  1NUW A;  4OVT A;  1UIU A;  3H7M A;  2I3W A;  2OZZ A;  4OEU A;  4DCX A;  1JQF A;  2HXW A;  4PAF A;  4P47 A;  5AE4 A;  5CMC A;  5B70 A;  1URS A;  1MY4 A;  5AA1 A;  2V3T A;  3G7W A;  4JBZ A;  1LCT A;  3JZJ A;  3PV0 E;  4Z0I A;  4DIG A;  1NV0 A;  1OIB A;  2O7I A;  3LSW A;  1B52 A;  1LBZ A;  4GIZ A;  2UVH A;  1O64 A;  1RDX A;  1FTK A;  4NF8 B;  4OVR A;  3IB0 A;  4MEV A;  3U92 A;  2HEU A;  2QSX A;  3TPA A;  4KHZ E;  3UN6 A;  2H98 A;  2OLB A;  5TP9 B;  4MMP A;  5TPA A;  2YLN A;  1PB9 A;  3ISP A;  1SW2 A;  4KYS A;  4AS4 A;  1MXV A;  4U22 A;  3G3K A;  3TEP A;  1B3F A;  3W9V A;  4RPN A;  4ZS9 A;  1IMC A;  1NNT A;  3KN3 A;  1MY0 A;  1BIY A;  4G8H A;  3TCF A;  3KN8 A;  2OPD A;  4P1E A;  3L6H A;  3VVF A;  1OMP A;  4PQJ A;  5EYF A;  4R6K A;  2DE4 A;  4RNS A;  1T0K A;  2ZZV A;  4H5G A;  1SYH A;  1EYK A;  1ELJ A;  1AH5 A;  1BKA A;  5CBS A;  2WEF A;  1H76 A;  3FVG A;  4C1T A;  3LR1 A;  4EXK A;  1M5F A;  4GWZ A;  4H46 A;  1NV4 A;  1B4H A;  5CC2 A;  3LSL A;  5IZ1 A;  2QMX A;  3H4Z A;  1GTK A;  3FJM A;  3TMG A;  3MW0 A;  3VV5 A;  1YAE A;  1S50 A;  4OAN A;  5ITO A;  2F5X A;  3B8B A;  4ZEF A;  1OLA A;  1Z7M E;  1FPI A;  3CG3 A;  4PFI A;  1N76 A;  2I58 A;  3KOS A;  1FSA A;  2ZYM A;  4PF8 A;  2V93 A;  4GRK A;  5IZZ A;  3K6X A;  2UXA A;  5IAI A;  2YJP A;  1LFG A;  3SKP A;  2CEX A;  4DDD A;  1AMF A;  4N8G A;  2Y5L A;  3K1N A;  4JSO A;  1P1U A;  3TCH A;  2Q2C A;  4P56 A;  3B7D A;  1LFH A;  3PU5 A;  4EQ9 A;  3RGY A;  1SVX B;  3OEK A;  3FVO A;  1P1W A;  5J16 A;  2HAU A;  4MNI A;  1HSL A;  2PYY A;  1NV6 A;  3N94 A;  4NF4 A;  5I58 B;  3OXN A;  3IX1 A;  5A5X B;  4BDR A;  4I3Y A;  2F3D A;  2I6E A;  1GR2 A;  2O6A A;  2Z8F A;  2XXK A;  3TOD A;  1FBP A;  3UA8 A;  4OES A;  3MZB A;  4YAH X;  3C31 A;  4YKJ A;  3GBA A;  3IR1 A;  4MAG A;  1TFD A;  2HPG A;  3SER A;  3QIM A;  5H8S A;  3BFU A;  3KC1 A;  2RIN A;  1IIT A;  1NV5 A;  2XX7 A;  1I6A A;  4P0I A;  5KCJ B;  4NF0 A;  1SDX A;  4PTK A;  3V83 A;  2O68 A;  4RA1 A;  2DE2 A;  5ESY A;  1XVX A;  3L6G A;  5DEX B;  2O84 X;  2R9J A;  1MXW A;  4BDO A;  2A5S A;  3KEI A;  3K6V A;  5DVI A;  5EYG A;  4O3C A;  3RQT A;  3FV2 A;  3FZV A;  4P11 A;  4JVD A;  4PC9 A;  3B50 A;  3M3F A;  3CRB A;  1Q9D A;  4ZEK A;  1DTZ A;  2ESN A;  3K00 A;  1B40 A;  4QXD A;  4PFR A;  1TWY A;  4MH5 A;  4AB5 A;  3H3G A;  5H8Q B;  1KA0 A;  4UAC A;  3GZG A;  1PBQ A;  4EQB A;  5EQA A;  3F11 A;  3S9L C;  3KGC A;  4KCC A;  3FBP A;  5LTC A;  2Y7R A;  3VVD A;  4OVP A;  3ZSF A;  1D4N A;  2QJE A;  4GWY A;  1MH4 A;  1MQJ A;  2D3I A;  3K01 A;  3MYU A;  3SEW A;  4FED A;  4RY1 A;  2QPQ A;  4KI0 E;  1R1N A;  3FVK A;  3T0J A;  2XD2 A;  2B4L A;  4OER A;  2ZXT A;  1L5T A;  4R75 A;  5ET5 A;  2F78 A;  1YYZ A;  1DPP A;  4NE4 A;  3RTF B;  1SW5 A;  2YPN A;  4XKN A;  3NOH A;  4YB7 A;  2CEY A;  4NF5 B;  2RCB A;  1H45 A;  3QXM A;  4YKK A;  1FTO A;  4PP0 A;  4P8B A;  1FTM A;  1VR5 A;  5I7I A;  3KBR A;  3N26 A;  1LAH E;  5I59 B;  2DQV A;  2ONS A;  2DWA A;  1TXF A;  2XX9 A;  1CB6 A;  3KG2 A;  2H25 A;  1DSN A;  2X7Q A;  4N17 A;  2UYF A;  4AQ4 A;  1Y1Z A;  2XXX A;  3FJG A;  4EXL A;  3K1P A;  4L17 A;  4R2F A;  5IZ3 A;  1RKM A;  5I84 A;  1B3H A;  2PMS A;  3MZ9 A;  4LZ8 A;  4LON B;  1IMF A;  3Q25 A;  1MXY A;  2B65 A;  1MQH A;  1B05 A;  2A5T B;  3MVZ A;  5I57 B;  1QUL A;  1NFT A;  3VXC A;  4FOR A;  3O28 A;  3KBZ A;  4ESX A;  1FQB A;  1B6H A;  1BLF A;  4HXV A;  2I4B A;  2H5Y A;  3SEV A;  2BJJ X;  4QFN A;  2DSF A;  3MPL A;  1P1Q A;  1NV1 A;  4H8I A;  3LV0 A;  3T9H B;  3M3K A;  4PAK A;  1D9Y A;  2Z23 A;  4JVC A;  2HXR A;  2OWZ A;  1LBB A;  2FA7 A;  4NED A;  3VVE A;  3T96 B;  1RYX A;  1USY E;  4BDQ A;  4G4P A;  4OMB A;  4MNC A;  4Q30 B;  4Q0C A;  3DLN A;  3RUM A;  2F7A A;  5K2Y A;  3OO6 A;  3DM0 A;  4ZEB A;  3CFL A;  2I49 A;  3R6U A;  1CNQ A;  5CMK A;  2VHA A;  4MFI A;  3IL1 B;  3H6V A;  1Y4T A;  1R9Q A;  4H45 A;  3T22 A;  3FUZ A;  4PBQ A;  1NV7 A;  4MCO A;  4NF8 A;  1EZO A;  1QVS A;  2F6G A;  1FPG A;  2XWI A;  3O2A A;  1RDZ A;  3RYD A;  3CSB A;  2UVG A;  3U65 A;  4N07 A;  5L9O A;  5TP9 A;  5ITP A;  2NXO A;  1ZU0 A;  1Y3N A;  2VPO A;  4P1L A;  4X04 A;  4G8M A;  5EHS A;  5KZT A;  1POT A;  2GHB A;  1IQ7 A;  3IK6 B;  1R6Z A;  3OEN A;  2R6G E;  5ICT A;  4DXC A;  3MAM A;  1MQG A;  4GX3 A;  1URD A;  4LP2 B;  5DYH A;  4X1B A;  3G3G A;  3S4U A;  2UVJ A;  4QBA A;  2X26 A;  1IEJ A;  1YTV A;  4H0W A;  2I48 A;  3K4U A;  1F9B A;  3KN7 A;  1RDY A;  5EHM A;  1SQY A;  4GD5 A;  2CZL A;  3PPQ A;  2DVZ A;  1XS5 A;  1N7W A;  5TU0 A;  4LA9 A;  2OK2 A;  4PE3 A;  3VXB A;  2F7C A;  3E78 A;  3TAJ A;  3RT8 A;  2QS2 A;  3KSX A;  1SI1 A;  2HQ0 A;  4R72 A;  3TUS A;  4OYV A;  3BFT A;  1S9T A;  4G61 A;  1Y4C A;  3K0V A;  2QS1 A;  5K2X A;  1KWH A;  1D3K A;  5AA4 B;  4OTE A;  3C34 A;  3IOU A;  5BWJ A;  4R2B A;  3MBP A;  1Q35 A;  3RPW A;  4P3L A;  4QSC A;  5FHO A;  1A8E A;  4F1Y A;  4NX1 A;  1A7L A;  2P0S A;  5DT6 A;  2VOZ A;  4TLM B;  5I2N B;  1NUY A;  4GWW A;  5FBP A;  1K9Z A;  4I1D A;  3B6T A;  4GFR A;  4Z7E A;  2F7B A;  3QMF A;  2O1M A;  3RPL B;  4X48 A;  4DI4 B;  4RK2 A;  2XXU A;  3USD A;  2X7P A;  5I58 A;  3N5L A;  5A5X A;  4XEQ A;  1N7X A;  4F29 A;  1B1H A;  4XKQ A;  2B4M A;  2R8T A;  1FPD A;  3LUZ A;  2V3U A;  3S9N C;  1NUX A;  5F24 A;  5DTB A;  3TFL A;  1MXZ A;  2DVC A;  3C9H A;  4IO6 A;  4HTG A;  1A54 A;  3Q29 A;  3C33 A;  3OO7 A;  1QUI A;  4KYE A;  5H8F B;  1QUK A;  4OVS A;  2NVU B;  5KCJ A;  2I4C A;  3LSF B;  5CM6 A;  1I69 A;  2ZZW A;  4ELQ A;  3KZG A;  4GXA A;  3G3J A;  1FQF A;  3K1M A;  5IKB A;  5CRY A;  2JJK A;  1XHY A;  4FEB A;  3ECR A;  4KR5 A;  3HCQ A;  4GL0 A;  1DOT A;  1IZ1 A;  4GQO A;  4LZ5 A;  1NKX A;  4PDD A;  4N6P A;  5CI5 A;  4AS5 A;  4NF6 A;  5IGA A;  4GWX A;  1MS7 A;  2FNC A;  4PGP A;  4IO2 A;  2KR0 A;  4X9T A;  4N6K A;  5H8Q A;  1EYJ A;  2E0S A;  4MBP A;  4NGU A;  4RK9 A;  1UIV A;  3OEL A;  3A3C A;  1FPL A;  5L9M A;  2HHM A;  1FBH A;  3LUY A;  2H99 A;  1N84 A;  4U2R A;  3CSG A;  4YB6 A;  4EF2 A;  5HPQ A;  4F39 A;  1SI0 A;  4O3B A;  4OVJ A;  2CZH A;  4NG7 A;  5I56 B;  1PB7 A;  1XC1 A;  4ZEI A;  4IY5 A;  4O7I A;  4G77 A;  1Z7N E;  2P1S A;  4MLQ A;  3IJO B;  4MX6 A;  1MXU A;  2P3N A;  4ESW A;  1N3X A;  4NAP A;  1JET A;  4IGR A;  4C1U A;  1NNP A;  2D5W A;  2MKZ A;  3ODB A;  3A29 A;  5EYH A;  2QRY A;  1XVY A;  4R9G A;  1G0H A;  1DTG A;  3BBR A;  3D4C A;  1Y20 A;  1NV3 A;  1B4Z A;  4F1U A;  3FAT A;  2XXP A;  2B3F A;  4PFU A;  4EDP A;  5A5L A;  3TZA A;  4F19 A;  4F3G A;  1FPK A;  1NH7 A;  2DP8 A;  1ZMG A;  2G29 A;  2OPE A;  3OSQ A;  1LCF A;  2Q8J A;  4EF1 A;  2DS9 A;  5L9S A;  1NNF A;  1US4 A;  4P9K A;  3RNN A;  4ND9 A;  4LN5 A;  4N6D A;  2QS3 A;  1N3W A;  3W9W A;  3O6H A;  4Q5T A;  4F3B A;  2A5T A;  1SYI A;  5I57 A;  4IO3 A;  4U21 A;  2HFB A;  3AXF A;  3DEL B;  4QRZ A;  1N04 A;  2NWJ A;  4YB5 A;  2ZMB A;  4H1X A;  1ZLQ A;  2DDK A;  4XF5 A;  2ZYN A;  2RC7 A;  3CI8 A;  1YCJ A;  4GF8 A;  4QFK A;  3PPR A;  4BDL A;  3OSR A;  3E9X A;  2I0B A;  3EPE A;  3PMV A;  1SW4 A;  4EUO A;  3GYY A;  1XOC A;  1JEV A;  1R9L A;  4R73 A;  4ZED A;  3CR9 A;  4IO7 A;  2XD3 A;  4YKP A;  4PBH A;  5DW8 A;  4EQ7 A;  4I3E A;  1NL5 A;  1MRP A;  5TPA B;  3QUF A;  1FQC A;  4HW8 A;  4JVI A;  2GH9 A;  4XKP A;  2ANJ A;  4GLI A;  4U4S A;  4G8N A;  3IFA A;  3H6T A;  1OLC A;  3H03 A;  1ANF A;  4JWO A;  4U4X A;  2WBB A;  1MQI A;  2XWO A;  3MVW A;  2AL5 A;  1AWB A;  3HPI A;  4KQP A;  2XXH A;  2WKY A;  3THI A;  3UK4 A;  1LBC A;  3RY3 A;  2CMO A;  1FCK A;  1FTL A;  1YPN A;  4F3P A;  1LAG E;  4BLA A;  3C36 A;  2F34 A;  2BJI A;  4XXU A;  1S7Y A;  3SEX A;  1EZP A;  2REG A;  3IAZ A;  2P3V A;  4G68 B;  2KLF A;  3N6U A;  1ZKB A;  3MP8 A;  3TTM A;  2Z8D A;  4LAT A;  4TOZ A;  1MPC A;  3M8U A;  3QYT A;  4IO4 A;  4OHN A;  3MST A;  4IB2 A;  3R26 A;  2IEE A;  1MY2 A;  1LFI A;  1FBC A;  5ICQ A;  4POW A;  4KCD A;  3QK6 A;  3K02 A;  1N0T A;  3RT6 B;  4R6Y A;  1IMA A;  1MPB A;  3SDF A;  2OWS A;  3U1O A;  2F6P A;  3PTY A;  2Z22 A;  4OWD A;  3S9M C;  1NUZ A;  2ONK E;  1EZ9 A;  1B5H A;  4O8M A;  3B6Q A;  4X8R A;  3S2V A;  2QVU A;  3W15 C;  2VD3 A;  3E13 X;  4NHB A;  3KJ7 A;  3IJX B;  4P0G A;  3D1R A;  2WBD A;  3ZKL A;  4OEV A;  4H5F A;  1FQE A;  1VSO A;  4IO5 A;  2DWJ A;  1B7Z A;  3U93 A;  1DBZ A;  3FJ7 A;  4GBV A;  4H6D A;  1A55 A;  4GX4 A;  1UTH B;  1MM6 A;  4GX6 A;  4FIM A;  1KA1 A;  2V25 A;  1MDQ A;  4FE8 A;  1A40 A;  5I2N A;  3TQW A;  5IM2 A;  3IOW A;  4FEC A;  1NH8 A;  4GWO A;  4QFP A;  1NV2 A;  4U23 A;  4I9D A;  3RPL A;  4QSE A;  4DLD A;  3N6T A;  4JDF A;  3PD9 A;  1G0I A;  2L5V A;  4QSD A;  4N8Y A;  1AIV A;  3MZ1 A;  3BIH A;  2IA4 A;  4F2Q A;  1I6B A;  1FBF A;  3PPP A;  2Y84 A;  1IXH A;  3OO9 A;  4PCD A;  3MWB A;  1QGX A;  3TTK A;  3TTN A;  3I3V A;  2NOO A;  1IMD A;  5JEI A;  3EN3 A;  2F97 A;  1IXC A;  2F36 A;  2VP1 A;  4F1V A;  5H8F A;  4DI3 D;  3BKI B;  2QVV A;  4KYD A;  5KDT B;  1JW1 A;  2B3B A;  4M1V A;  1B5J A;  4G2Z A;  3C35 A;  2DYX A;  3HHF A;  3OEM A;  1XT8 A;  3K6W A;  5H8N B;  3PPO A;  4OFJ A;  3B6W A;  4LQ5 A;  1WDN A;  4IY6 A; 
#chains in the Genus database with same CATH homology
 5I3S A;  5LDZ A;  1NV6 A;  1DK4 A;  4OVS A;  4I3Y A;  2F3D A;  2XXK A;  1FBP A;  1LBY A;  5CM6 A;  2ZZW A;  2CZI A;  4XFE A;  2HZL A;  4HCW A;  1DCU A;  2HZK A;  4MAG A;  2HPG A;  2JJK A;  3KC1 A;  3HFU A;  1NV5 A;  1LBX A;  4KXP A;  4MJO A;  4NF0 A;  4PTK A;  4PDD A;  1K9Y A;  4AS5 A;  5IGA A;  4GWX A;  2DE2 A;  2PCR A;  5ESY A;  2FIE A;  4PGP A;  2KR0 A;  3KC0 A;  4X9T A;  4GBW A;  4N6K A;  1EYJ A;  4UAB A;  5IZ3 B;  4NGU A;  2PFY A;  2Q8M A;  1FJ9 A;  5EYG A;  1FPL A;  2HHM A;  1FBH A;  4GWS A;  1FBD A;  4JVD A;  4PC9 A;  3B50 A;  3BIG A;  4HE1 A;  1Q9D A;  5EQ7 A;  2CZH A;  4NG7 A;  1FBE A;  4QXD A;  4PFR A;  5JK4 A;  2QFL A;  1KA0 A;  4O7I A;  3EKI A;  1VDW A;  5EQA A;  2ZZX A;  1KZ8 A;  4MX6 A;  1D9Q A;  2P3N A;  3FBP A;  5LTC A;  4NAP A;  2DE3 A;  4OVP A;  4PDH A;  4HE2 A;  2MKZ A;  2XWV A;  3A29 A;  4GWY A;  5EYH A;  3MYU A;  1G0H A;  1NV3 A;  5EQ9 A;  2XA5 A;  4F1U A;  2QPQ A;  5A5L A;  4F19 A;  2GQ1 A;  2WX9 A;  4MIJ A;  3T0J A;  1FPK A;  2B4L A;  5ET5 A;  1YYZ A;  3NOH A;  2CEY A;  2WYP A;  1FBG A;  4P9K A;  2FIX A;  4P8B A;  1LEV A;  4LN5 A;  4N81 A;  4N6D A;  5I7I A;  1FJ6 A;  1NI9 A;  4PF6 A;  3W9W A;  2V4C A;  4N17 A;  2QVR A;  5EQ8 A;  5IZ3 A;  5ET8 A;  1INP A;  2DDK A;  1IMF A;  4XF5 A;  4GWU A;  2VPN A;  2KQZ A;  4OA4 A;  4MNP A;  2WYK A;  4F18 A;  3GYY A;  4FBP A;  3E79 A;  4PAI A;  1FPF A;  1YZ0 A;  4PBH A;  5DW8 A;  4I3E A;  4PGN A;  3KBZ A;  4OVQ A;  1FPJ A;  3SZP A;  4HXV A;  5ET6 A;  4JVI A;  4MHF A;  5T3J A;  2FBP A;  4NN3 A;  1IMB A;  2Q74 A;  1XI6 A;  1NV1 A;  3IFA A;  1BK4 A;  4N15 A;  3IFC A;  3LV0 A;  2FHY A;  4PAK A;  4JVC A;  2VT5 A;  2HXR A;  2OWZ A;  4I40 A;  2WBB A;  3ROJ A;  2XWO A;  1SPI A;  2CZK A;  4MNC A;  1AWB A;  1FRP A;  2OX3 A;  2F3B A;  1CNQ A;  1NUW A;  4OVT A;  4H45 A;  4N91 A;  2BJI A;  4PAF A;  4P47 A;  4PBQ A;  1NV7 A;  4MCO A;  1FPG A;  2XWI A;  2P3V A;  1RDZ A;  3RYD A;  3U65 A;  1NV0 A;  3MST A;  4IR8 A;  1FBC A;  1LBZ A;  1RDX A;  2VPO A;  4P1L A;  4X04 A;  1IMA A;  4OVR A;  4HE0 A;  4MEV A;  3PTY A;  1JP4 A;  4GX3 A;  1NUZ A;  4O8M A;  4MMP A;  4X8R A;  2QVU A;  2V3Q A;  3ISP A;  3T1B A;  4AS4 A;  4QBA A;  4N4U A;  4YZZ A;  1IME A;  4NHB A;  2XWK A;  1RDY A;  4YIC A;  4HCY A;  4O94 A;  3W9V A;  3D1R A;  2WBD A;  2DVZ A;  1IMC A;  1FPB A;  1LBV A;  4P1E A;  1DBZ A;  4GBV A;  4PE3 A;  4GX4 A;  2FVZ A;  4GX6 A;  5I5P A;  3E78 A;  2DE4 A;  1LBW A;  2ZZV A;  2Q9T A;  1KA1 A;  1EYK A;  2PFZ A;  3FXB A;  2WEF A;  5IM2 A;  5J1D A;  4G61 A;  1EYI A;  1FPE A;  4GWZ A;  4H46 A;  1NV4 A;  1NV2 A;  5IZ1 A;  3RPL A;  1G0I A;  2L5V A;  4N8Y A;  4P3L A;  4OAN A;  3BIH A;  4NX1 A;  2F5X A;  1FBF A;  3B8B A;  1NUY A;  4PCD A;  5ET7 A;  1FPI A;  2Y5K A;  1QGX A;  4GWW A;  5FBP A;  1K9Z A;  4PFI A;  1FSA A;  1IMD A;  3QMF A;  4NQ8 A;  3RPL B;  4DI4 B;  4PF8 A;  4PET A;  4F1V A;  5IZZ A;  4DI3 D;  4XEQ A;  2QVV A;  4M1V A;  1FTA A;  2B4M A;  2R8T A;  1FPD A;  3LUZ A;  2CEX A;  1YXI A;  1NUX A;  5F24 A;  4N8G A;  2Y5L A;  4PFB A;  4P56 A;  4O7M A;  3CHG A;  5J16 A;  4MNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...