1LBYA

Crystal structure of a complex (p32 crystal form) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with 3 manganese ions, fructose-6-phosphate, and phosphate ion
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 83
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbyA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbyA02
1FJ6A 1D9QA 3T0JA 4GX3A 2PCRA 1FPGA 5A5LA 1DCUA 4GBVA 2DDKA 1FJ9A 3IFCA 1YXIA 5T3JA 1LEVA 3FBPA 4GWWA 5EYGA 5EQ8A 1NUYA 2WEFA 1RDXA 1FTAA 1NV5A 1LBXA 2WBBA 3D1RA 2R8TA 1LBYA 3ROJA 2FIEA 2WBDA 2Y5KA 1KA1A 1FBGA 1XI6A 1FBFA 4G61A 1JP4A 4I3YA 2CZKA 2F3DA 1FBCA 1LBWA 3BIHA 1IMDA 1NUWA 4MJOA 4H45A 4HE0A 1NV6A 1FBPA 2Q8MA 3KC0A 2F3BA 2P3NA 2Y5LA 1IMFA 3IFAA 2FIXA 1FPDA 1NV4A 4GX4A 4AS4A 1K9YA 5EYHA 4IR8A 1LBVA 1SPIA 4N81A 1EYKA 4O7IA 5ET8A 1EYIA 1CNQA 5I3SA 2OWZA 5F24A 2FHYA 4GX6A 1NV1A 1KZ8A 1FPLA 1INPA 1FBDA 1EYJA 5IZ3B 5ET7A 4AS5A 5EQ7A 5FBPA 4FBPA 4HXVA 1FPBA 2JJKA 1NV7A 1Q9DA 1RDZA 1NI9A 1DBZA 4GWUA 3LV0A 4GBWA 1QGXA 4PTKA 4I3EA 3KC1A 5ESYA 5J16A 1NUXA 1FPFA 1FPIA 2GQ1A 2CZIA 1AWBA 3LUZA 2Q74A 1G0HA 5ET6A 1NUZA 3RYDA 1FPEA 4KXPA 5IZ3A 4HE2A 1K9ZA 1FRPA 2OX3A 1IMBA 5DW8A 5EQAA 1KA0A 1FPJA 1FPKA 3B8BA 3RPLB 1YYZA 2FVZA 2QFLA 5ET5A 2QVRA 1LBZA 2QVVA 5IZ1A 1FSAA 1VDWA 1BK4A 2QVUA 4GWSA 1FBEA 5EQ9A 4GWYA 1IMAA 1YZ0A 1NV3A 2FBPA 4QXDA 4HE1A 2P3VA 5LDZA 1DK4A 1RDYA 1G0IA 1NV2A 4I40A 4GWXA 1IMEA 3RPLA 3BIGA 1IMCA 2HHMA 3A29A 3QMFA 2VT5A 3KBZA 2CZHA 2BJIA 1FBHA 4GWZA 4H46A 1NV0A
chains in the Genus database with same CATH superfamily
4G8NA 3FXUA 1QUKA 2XXWA 2UYFA 4LQ5A 3R6UA 1TT1A 5AE4A 1IEJA 1FQAA 3FBPA 1OQGA 2Y7RA 5K2YA 5TPAB 3E4RA 2A5TA 1ZIUA 3FV2A 2WBDA 4NF8B 3KGCA 4G8MA 1N3XA 2NUVA 4GIZA 2HQ0A 3BIHA 1NUWA 5ICTA 1B1HA 4YB6A 4KD5A 4EDPA 2V4CA 4N8YA 3ODBA 1FBPA 3U1OA 4JVCA 1NV4A 1K9YA 5EYHA 3N94A 3IOWA 3SDFA 2YPNA 3FXRA 1Y9UA 1H44A 1MPCA 2D3IA 1KZ8A 2WX9A 1EYJA 3I3VA 5IZ3B 3PV0E 3LBSA 1FPBA 2ONSA 2VOZA 3KEIA 5J16A 3MZ1A 3MZBA 4F29A 3G3FA 4ZEDA 1XC1A 1AWBA 3LUZA 1P1NA 5L9SA 1D9YA 2P2AA 1FPEA 3PGFA 4BDNA 4QFPA 2PT1A 2DWHA 1FTJA 3K4UA 4OWDA 3QYTA 4ZEFA 4P47A 1B32A 4F1YA 4H65A 1SDXA 1YYZA 3N6UA 3FXQA 3TTRA 4MNPA 4OVSA 3H6VA 3CVGA 1Y1ZA 4ESWA 1BTJA 2F7AA 1S7YA 3TYHA 3KN8A 4OFJA 3MZ9A 2A5TB 2PFZA 3CSGA 1EZPA 2DSFA 1FJ6A 1LB9A 3TTLA 3O97A 5A5LA 2Z23A 3VLWA 1DCUA 2B4LA 4NF6A 2QS3A 1IXHA 1RDXA 3PUZE 4N13A 5AA2A 4G8HA 1D9VA 2RINA 1HSJA 4QRZA 3LSWA 1SBPA 1MS7A 1B46A 5I2NA 3IOTA 4JVIA 1QULA 5B70A 5ET8A 1LCFA 4EF1A 4O7MA 3VVDA 4Q8RA 3E78A 1A99A 1I6AA 1Y4CA 3B50A 2O6AA 3LUYA 4FBPA 3VXCA 3PUVE 2Q89A 5DTBA 4PTKA 4ZDMA 2F7CA 1A8FA 3FVNA 4QF9A 5L8DA 4O3BA 4N6PA 4OQOA 4XFEA 1K9ZA 4LATA 1IQ7A 2XHDA 4QSEA 1FPKA 1MM7A 3C32A 3T9VA 2I4BA 2QVRA 5I5PA 2VD3A 1SQYA 4WEPA 3H4ZA 1SYHA 5H8HA 5I59B 1YPNA 2RF1A 3QSLA 1MDQA 1UTHA 4KQPA 3E13X 4NF6B 5DYHA 3CI8A 2HHMA 3SETA 4X1DA 5KZTA 4GXAA 5AA2B 1FBHA 3TODA 2X7QA 3EHTA 3JV9A 1R1NA 5DEXA 3K1PA 5FTHA 3DM0A 4PBQA 3H03A 1B3EA 1NH8A 1AOVA 1MM6A 5I2NB 1IXIA 3U8QA 4G77A 1ATGA 1ELJA 3H3GA 5TP9A 3S2VA 3FJMA 3ILUB 1R9QA 1POTA 4G68B 4GL0A 2V93A 4UA8A 2OLBA 4F31B 3C35A 1GR2A 2HXWA 1ZKBA 2RKMA 1GTKA 4GLIA 3UGWA 1LAXA 1FBDA 4YICA 5FTIA 3VVEA 1NH7A 3S9EA 1NNFA 4N6KA 4PFBA 3UK4A 2KQZA 1HSLA 3TELA 4GWUA 4PC9A 5L9OA 2I49A 4KR5A 4FORA 2QPQA 4KXPA 3KN7A 3K6VA 4PE3A 1NNPA 3VLUA 1Z7ME 3PPOA 4FJPA 4NAPA 1KWHA 4Z7EA 2XWOA 4KYEA 2QVVA 3MW0A 1MRPA 1LB8A 5EYFA 3GLBA 2ZXTA 4PCDA 2OJTA 1ANFA 4XIGQ 1A40A 4X1BA 2P3VA 1B3LA 1RDYA 1G0IA 1XS5A 1FW0A 4R6HA 2WYPA 2P0SA 4N6DA 2Z8EA 4RK2A 4GWZA 1P1OA 4I1DA 4XKNA 1J1NA 4XF5A 2THIA 4AQ4A 1IIWA 1EZOA 2REJA 3CFXA 3K2DA 2XXYA 3ROJA 4PF6A 1B4ZA 4LP2B 5H8QB 4IO5A 1MH4A 3SEXA 1TFDA 3DP4A 3RNNA 1Y4TA 1JEVA 4MBPA 4H67A 5I84A 1TXFA 2F7BA 2Y7KA 1OVTA 4G2ZA 1LBVA 3IB0A 4PGPA 5DVIA 3MP1A 1YTVA 3IX1A 1MPDA 2XXQA 2DXRA 4EQ9A 3EF7A 1SYIA 5EQ7A 4R9GA 3QXMA 1SI1A 4N8GA 3FZVA 3HO7A 5I58A 2XD3A 1MPBA 1B7HA 2D5WA 3HN0A 5ET6A 1N76A 3O9PA 5I57A 1MY1A 3MQ9A 1R6ZA 2DVCA 1FRPA 1KA0A 3EN3A 5ITPA 1MQGA 1UQWA 3H6UA 3Q26A 5A5XA 2OCUA 2ANJA 4PP0A 3M8UA 1B5HA 4ZEKA 3FIRA 4YMBA 3K1MA 4HE1A 2XD2A 5CMMA 4PFUA 1QW0A 4NMYA 1MXVA 1JETA 2VT5A 4OANA 3T0JA 2REGA 2PCRA 1MXYA 2H99A 4KCDA 4RYAA 4KYSA 3IAZA 1NV5A 4L17A 1QKBA 5FHNA 2RC9A 4MLVA 4HS7A 4R73A 4GWOA 1XOCA 1OMPA 1SPIA 3PMXA 3K6WA 3EHUA 1EYIA 5I58B 1WODA 5F24A 2HFBA 4TQUQ 3QK6A 1FPLA 5I57B 2DYXA 4JWOA 3O6GA 3HCQA 3KSXA 1RDZA 1NI9A 3KFMA 4BDMA 4F1VA 4OHNA 3KC1A 5TPAA 3ILTB 4FIMA 4PAIA 4NF8A 4P9KA 2XXRA 4JDFA 4WKMA 3ONMA 3VXBA 2DQVA 2O51A 5BWJA 3TMGA 4F3BA 4PFIA 4F2QA 3N5LA 3UN6A 4FAJA 4R75A 2Q2AA 2CZLA 5IAIA 2OPEA 1XVYA 5IZ1A 4N07A 4QHQA 1PBQA 4LVQA 1YZ0A 1F9BA 4NF0A 4NWCA 4ZEIA 3A3UA 5I2KB 2Z8DA 3KBZA 4JB7A 2E1SA 1MXWA 4U2RA 1MQHA 1NMUA 1N7WA 4E0XA 1FPGA 4NWDA 3MJNA 1LFIA 2QS4A 3B6TA 3C9HA 5EYGA 4XEQA 2Y7PA 2WEFA 1LBYA 3PPRA 1KA1A 2AL5A 1FBFA 2ZZVA 4I3YA 2WKYA 1FBCA 1SVXB 4IY5A 4MNCA 2XXKA 4H6DA 2P3NA 5CBRA 1UIUA 3Q28A 4RPOA 2XXVA 5AA4A 4N81A 2QJEA 4MEVA 3DP8A 4ONYA 5I3SA 4GX6A 2I0CA 1LGBC 5DVFA 5H8FA 4EQ7A 3GZGA 2JJKA 1P1UA 1D3KA 4NGUA 4TLLB 1MY0A 3DELB 2ESNA 1NNKA 3QUFA 4YB7A 4U22A 3TPAA 5AA1A 5AA2D 1USYH 4I9DA 3V8XB 3FUZA 3H6TA 3OO7A 4P11A 2RCBA 3CFLA 4MAGA 2IA4A 3B8BA 3PUWE 1IUDA 4NN3A 3QUJA 3V89B 4AB6A 3MVXA 4I62A 2F36A 1LFGA 1DSNA 3FVGA 4JWXA 1VR5A 3OSRA 3BFTA 4ZS9A 4NEDA 3RQTA 5H8SA 1B52A 1B9JA 2VPNA 2HAUA 1B4HA 2B3FA 1P1QA 1H3DA 1WDNA 3MP6A 1D9QA 3T22A 2V3QA 3B6QA 5JTYA 2Z8FA 3IFCA 5ICQA 1LEVA 4R2BA 2XX9A 3M3KA 4IY6A 1FQEA 5AA4B 3O28A 2XWIA 1PB8A 1PDAA 3Q27A 4FEBA 4ZECA 3CRBA 3KZGA 1JEUA 1NV6A 2Q8MA 5I59A 4TOZA 3SEYA 3IB2A 2UVIA 3KJ7A 2FIXA 3OELA 5H8FB 4AS4A 3SZPA 3TZAA 3TTNA 4MH5A 4E0WA 3HHGA 4Q5TA 4OZ9A 4PAKA 4MX6A 1B5IA 3VV5A 1NV1A 1Z7NE 2H25A 4DI3D 2CEXA 4QSDA 5KDTB 5FBPA 3ZKLA 1DBZA 3RN8A 5JK4A 2Z22A 4IO7A 3HHFA 2I58A 1M5EA 3N26A 3GBBA 4P56A 3C36A 2QS1A 1MY3A 1USYE 4G68A 2XWVA 1B5JA 2PBWA 4DXUA 4RJZA 4Q0CA 4PAFA 2DE2A 4R6YA 2MKZA 4WEDA 4YMAA 1POY1 3C33A 3U94A 1A8EA 5JTYB 3LC8A 2DOJA 2OBGA 4RXLA 2ZZWA 3IOVA 4X48A 3O2AA 4MF3A 5T3JA 4QSCA 1M5DA 3C31A 3CFZA 4H0WA 3PPNA 3D1RA 3TUSA 2WBBA 1QJMA 3ECRA 3N6TA 1I6BA 3IK6B 3VE1B 4NHBA 2WYKA 2F3DA 1LBWA 2NVUB 3MVYA 4F2OA 1B7ZA 2ZYMA 2AIXA 1BIYA 2F3BA 1Y1MA 3H06B 3SERA 2Q8JA 1A7LA 4QBAA 1ZMGA 3FVKA 5CC2A 2XA5A 2O7IA 4X04A 1DPEA 1INPA 3T96B 4AS5A 2QRYA 2YLNA 1DOTA 3MSTA 4GBWA 2O7UA 4GXSB 1FPIA 3THIA 1ZLQA 1MQDA 4OFLA 4YB5A 3M3LA 5H8QA 3UA8A 2AYSA 1UTBA 3MBPA 2AL4A 3ISPA 4H1XA 1B0HA 3CG3A 1JNFA 2O1LA 4JVDA 5LTCA 1M5FA 1FSAA 2H5YA 1BK4A 4GRKA 2HZKA 3GBAA 5LDZA 1QKAA 1H45A 2QSXA 3V83A 3K02A 3K1NA 4IO3A 4KI0E 2BJIA 4DDDA 1S50A 4YKIA 4OYVA 4ESXA 4GL8A 1OLAA 3K0VA 3IL1B 1Y3NA 1M5CA 1B58A 5H8NA 3UIFA 4LZ5A 1YXIA 1FTMA 4PQJA 4P1LA 2G93A 1JVYA 3D4GA 1MY4A 4I8CA 2R6GE 3TDJA 3JZJA 2E0SA 2XXUA 5L9MA 3FD3A 1HSEA 1MQJA 3CIJA 4PETA 3KC0A 4DCXA 1JW4A 3W9WA 4IO2A 3OEMA 1DMBA 3A3CA 4IR8A 1BP5A 3GYYA 1CNQA 4K3FA 3SEWA 3LR1A 4U21A 1Q9DA 1RKMA 1UTBB 4UABA 2F35A 3V5AA 4JBZA 1QGXA 4I3EA 4DIGA 1DPPA 1LCTA 3T9XB 1NNTA 3TTKA 2PT2A 4F19A 2RC7A 4XKPA 2F6GA 1OVBA 5EQAA 1H76A 4NF5B 1FPJA 5HBCA 2KLFA 3OXNA 2Q9TA 4OXVA 1FTLA 1TFAA 1B05A 2F6PA 3MUQA 1URDA 5ITOA 2B3BA 2ONRA 4UACA 3RT6B 1NV3A 5H8NB 4PFTA 2BJJX 4OTEA 3QMFA 3G3JA 3PUYE 3IORA 4PFYA 3FATA 2W7YA 3S9MC 2DDKA 4O3AA 4PFRA 1FTAA 3KOSA 1LBXA 4BDOA 4ZZAA 3LSLA 3T1BA 4G61A 4GD5A 1YAEA 2GH9A 3HFUA 2Q2CA 1IMDA 2KR0A 3FGSA 1S9TA 2FNCA 3IFAA 1M5BA 1O64A 2UXAA 1N3WA 3H6WA 2V84A 5EHSA 4ZE9A 4YKPA 4F1UA 5I2KA 4U23A 4KFQA 3MWBA 4QFLA 1O63A 3OD7A 5BUUA 4U4SA 2P1SA 3CG1A 2X7PA 2ZNUA 5ESYA 1NUXA 3NOHA 1BKAA 4FATA 1G0HA 4XTCQ 1OQHA 3DP6A 1SD3A 3TTMA 4HCYA 4PBHA 3RY3A 4IO4A 2VPOA 3G3IA 5CMKA 1AL3A 2PX1A 2F78A 4ZE8A 5CI5A 1LAHE 1PB7A 2HCAA 3RUMA 3IR1A 2XX8A 1B6HA 5EQ9A 4P0GA 1QUJA 1Y3PA 3T9UA 3MP8A 5KCJA 2X26A 4GWXA 2QMWA 2VP1A 1FTKA 5LOMA 4EXLA 3PMVA 4OMBA 3MYUA 3B7DA 1N04A 3OO9A 1LFHA 2R8TA 2HZLA 3T66A 2Y84A 2DXYA 4YU0A 1JW1A 4MJOA 1XHYA 5F1QA 3TCHA 2V3TA 4LONB 1LLSA 1MQIA 1LAFE 2B65A 3PD9A 2Q88A 2GHAA 5FHOA 4OENA 2QL3A 2FHYA 1EZ9A 3OO8A 4KHZE 2V25A 1AIVA 3R7XA 4JXIA 2DP8A 3RTWB 3G3KA 5I56B 3SEUA 3O6HA 3RGYA 3LV0A 4OVTA 3IJXB 4DI4B 4O8MA 2I3WA 2DWIA 3RYDA 5EHMA 1FQDA 5J1DA 2OX3A 2UVHA 2UYEA 5KCJB 1Y3QA 4YKKA 4PGNA 5ET5A 1LBZA 4POXA 1B0LA 1II5A 4THIA 4GWYA 2I48A 2FBPA 3MVZA 2V3UA 5KDTA 2O84X 3EKIA 4EQBA 3BIGA 2R71A 4Q30B 1B1XA 4HCWA 1PB9A 2HEUA 4MLQA 4G68C 4IGRA 2OWTA 1FJ9A 1US4A 3UP9A 5EQ8A 4O3CA 2L5VA 3TAJA 5IM2A 4DE8A 1B3HA 2M8CA 1MY2A 1XI6A 4IB2A 4PDHA 1JQFA 3HSTA 3OSQA 3RTFB 1L5TA 1MXUA 1Q1KA 1AH5A 4NQ8A 2ABHA 1IMFA 4U1OA 1T0KA 4X8RA 3FXBA 3SEVA 1EYKA 4DLDA 3KSJA 3KN3A 3VDFA 3BKIB 5JEIA 4MCOA 3U92A 4GOTA 4P8BA 4X9TA 1VSOA 4LN5A 5AA3A 1BLFA 3IO4A 3I6VA 4P0IA 4GF8A 3LSXA 4KPTA 4P3LA 2Q74A 3C34A 2NWJA 4DXBA 3B6WA 4N15A 1NUZA 3PPPA 1MDP1 2ZYNA 3PU5A 4OVPA 2XWKA 4PFWA 3LSFB 4R72A 3T9HB 5IGAA 3SKPA 2H4IA 3AXFA 2XX7A 3G3GA 3ZKKA 2GRVA 1NKXA 3BFUA 1MXZA 3W15C 4ELRA 2GFEA 4H5FA 5DT6A 4QXDA 4FEDA 1XT8A 1DK4A 4KCCA 4ELQA 1IMEA 2VGQA 3RT8A 3I5OA 3PMWA 4LZ8A 4PDDA 2PMSA 3W9VA 1IZ1A 4JSDA 4H46A 4YZZA 1ZU0A 1NV0A 4HTGA 1IITA 3WAEA 3TQLA 1B40A 2ONKE 1TWYA 4GBVA 2F5XA 4MMPA 4U4XA 2XXHA 3KBRA 1NUYA 1MG1A 1PC3A 3Q29A 4EUOA 2DE4A 1I69A 3U72A 4DZ1A 1P1WA 2H9BA 1JP4A 3IO6A 2QMXA 2HAVA 2CZKA 1N84A 4OESA 3T93B 1QVSA 4H8JA 4QFNA 2O69A 2UVJA 1MXXA 2DWAA 4OERA 4OVRA 1MH3A 3S9LC 4RNSA 4POWA 4QFOA 5B7DA 1LSTA 3OOAA 4LUBA 2OWZA 1OLCA 3OO6A 1WVJA 2H98A 4HW8A 2NOOA 1ZJLA 4O94A 3PTYA 1LBBA 1Q35A 4N17A 2PVUA 4F3PA 2DVZA 2RCAA 3VVFA 4OA4A 4PF8A 4MFIA 3SESA 5IKBA 3ZS6A 3K00A 1ZBMA 4FE8A 2VD2A 1VE4A 3WAFA 3USDA 1GV8A 4IGTA 1LAGE 4N4UA 4YAHX 3FVOA 1CE2A 3MPLA 3TKDA 4R6KA 4MIJA 4OEUA 4H5GA 1SW5A 2R9JA 2OWSA 3VFJA 1NV2A 3FJGA 4R9FA 1B3GA 4KYDA 4IO6A 3MC2A 4GVOA 2CZHA 3C4MA 4LQ2A 1ZTYA 4M1VA 5CMCA 3GXAA 4GX3A 4OVQA 5F7VA 3ZSFA 2XXXA 4RA1A 3Q25A 3E3KA 4NF5A 4C1TA 1A55A 4MNIA 2OK2A 2Y5KA 1FBGA 3OENA 1YCJA 2PFYA 3RLFE 3M3FA 4RK9A 2IEEA 2NXOA 2XXTA 3TFLA 3JYRA 2HXRA 3OEKA 2Y5LA 2OPDA 2XXPA 2XXIA 4ELOA 1NL5A 1IXCA 3D4CA 4O7IA 5FHMA 2G29A 5H8HB 4BDLA 3G3HA 4BDRA 1UTHB 3TCFA 4LA9A 4HXVA 1NV7A 2YJPA 4NF4A 1VFEA 1AMFA 1LBCA 4LZ7A 2Y7IA 4G4PA 1GVCA 4DXCA 2DS9A 4Z0IA 1FPFA 1FQCA 2D21A 4ZEBA 5DEXB 4HE2A 3IOUA 1FCKA 5DW8A 1B51A 1PEBA 5K2XA 3IB1A 4M4GA 3L6GA 3A09A 5TP9B 1FTOA 2QFLA 2FA7A 1B7UA 3HPIA 3S4UA 4GQOA 1FBEA 3EHSA 4NE4A 2HPGA 3A29A 2O1MA 2O68A 3E9XA 4TLMB 3KJTA 2I3VA 4ZZEA 2OZZA 4NG7A 4F3GA 4OETA 4EF2A 3TCGA 3E79A 1B2HA 2FYIA 4GWWA 5I7IA 3L6HA 2QS2A 2DWJA 2FIEA 1P99A 2B4MA 3VLVA 2ZMBA 4ND9A 5CBSA 3H7MA 4C0RA 4XXUA 4H45A 4HE0A 4NX1A 1FPDA 4NF4B 3U93A 4R2FA 1JVXA 4GFRA 1RYXA 3EQ1A 2F8DA 4BLAA 3CSBA 1SW4A 3FV1A 5CRYA 1H43A 3KOTA 2UVGA 5DVJA 3PPQA 3F11A 3R26A 1D4NA 2DE3A 2GQ1A 2CMOA 4F39A 1NFTA 5HM4B 2F97A 4JSOA 2ZZXA 5CMBA 3K6XA 1SW2A 4JWYA 1A54A 3QAXA 4R74A 5TU0A 1GGGA 2ALUA 2I4CA 1O7TA 1R9LA 4U1ZA 3CR9A 4NTLA 4WXJA 4PE5B 1DTZA 1B3FA 4C1UA 3RPLA 3O66A 3FASA 2A5SA 5I56A 2I0BA 1UIVA 3G7WA 2ZYOA 4H8IA 5IZZA 1EH3A 1VFDA 1FQFA 4DCYA 1SI0A 4MHFA 3K01A 4XKQA 1N0TA 1FQBA 1PBPA 3O29A 2VHAA 1URGA 3S9NC 3O6IA 3QIMA 5M2VA 3PUXE 4FECA 3EPEA 3RPWA 4ELPA 5CM6A 4OEVA 4ECFA 4GX4A 5A5XB 1OIBA 4AB5A 2F34A 1SW1A 3IJOB 2GHBA 5ELVA 1DTGA 3U65A 3OMBA 4OFOA 2PYYA 4F3SA 5ET7A 2I6EA 1CB6A 3K6UA 3BBRA 4BDQA 4RPNA 3DLNA 3HV1A 2RC8A 3PD8A 2ZNSA 2CZIA 1XVXA 2LAOA 1I6QA 4F22A 1JW5A 2CEYA 4EXKA 2ZNTA 5IZ3A 1Y20A 1EU8A 1RYOA 1IMBA 4F18A 4XKRA 5HPQA 4N91A 1US5A 3MPKA 4YKJA 3RPLB 1URSA 2FVZA 3P7IA 1IXGA 1QUIA 3KG2A 4RY1A 5ISUA 1N7XA 1VDWA 3TQWA 2QVUA 4GWSA 3MAMA 1IMAA 3TEPA 4ISUA 4QFKA 3CHGA 4I40A 2Y7WA 1IMCA 4P1EA 3MVWA 4OVJA 3FJ7A 2ZYKA 3UORA
chains in the Genus database with same CATH topology
3T0JA 2PCRA 4GBVA 2F5XA 1YXIA 4MMPA 3FBPA 4P1LA 1NUYA 1NV5A 2DE4A 2WBDA 1JP4A 2CZKA 3BIHA 1NUWA 2V4CA 4N8YA 1FBPA 4PETA 3KC0A 4JVCA 1NV4A 3W9WA 1K9YA 5EYHA 4OVRA 4IR8A 1SPIA 1EYIA 3GYYA 1CNQA 2OWZA 5F24A 1KZ8A 2WX9A 1FPLA 1EYJA 5IZ3B 4O94A 3PTYA 1FPBA 4N17A 1Q9DA 1RDZA 1NI9A 4UABA 4F1VA 2DVZA 1QGXA 5J16A 4I3EA 3KC1A 4PAIA 4OA4A 4PF8A 1AWBA 3LUZA 4P9KA 1FPEA 4F19A 4PFIA 5EQAA 1FPJA 4P47A 4N4UA 2Q9TA 1YYZA 4MNPA 4OVSA 5IZ1A 1YZ0A 1NV3A 4MIJA 4NF0A 1NV2A 3QMFA 3KBZA 2CZHA 2PFZA 1FJ6A 4M1VA 4GX3A 4OVQA 1FPGA 5A5LA 1DCUA 2B4LA 2DDKA 5EYGA 4XEQA 4PFRA 2WEFA 1RDXA 1FTAA 1LBXA 1LBYA 4MNIA 2Y5KA 1KA1A 3T1BA 1FBGA 4G61A 1FBFA 2ZZVA 2PFYA 4I3YA 3HFUA 1FBCA 1IMDA 4MNCA 2XXKA 2HXRA 2KR0A 2P3NA 2Y5LA 3IFAA 4JVIA 4N81A 4O7IA 5ET8A 4MEVA 4F1UA 4O7MA 5I3SA 4GX6A 3E78A 3B50A 4FBPA 4HXVA 2JJKA 1NV7A 4NGUA 4PTKA 5ESYA 1NUXA 3NOHA 1FPFA 1G0HA 4HE2A 4XFEA 1K9ZA 4HCYA 4PBHA 5DW8A 2VPOA 1FPKA 4MAGA 3B8BA 2QFLA 2QVRA 4NN3A 5I5PA 1FBEA 5EQ9A 4GWXA 2HHMA 2HPGA 2VPNA 3A29A 1FBHA 4NG7A 1D9QA 2V3QA 3E79A 3MYUA 3IFCA 4PBQA 1LEVA 4GWWA 5I7IA 2R8TA 2HZLA 2FIEA 2B4MA 2XWIA 4MJOA 4H45A 4HE0A 1NV6A 2Q8MA 4NX1A 2FIXA 1FPDA 4AS4A 3SZPA 4PAKA 4MX6A 2FHYA 1NV1A 1FBDA 4YICA 4DI3D 2CEXA 5FBPA 4N6KA 4PFBA 2KQZA 1DBZA 4GWUA 3LV0A 4OVTA 4PC9A 5JK4A 4DI4B 2DE3A 4O8MA 2GQ1A 2QPQA 3RYDA 4P56A 4KXPA 4PE3A 2ZZXA 5J1DA 2OX3A 4NAPA 2XWVA 2XWOA 4PGNA 5ET5A 4PAFA 2DE2A 2QVVA 1LBZA 4YZZA 4PCDA 2MKZA 4GWYA 2FBPA 2P3VA 1RDYA 3EKIA 1G0IA 3RPLA 3BIGA 2WYPA 4N6DA 2ZZWA 4GWZA 4HCWA 4XF5A 5IZZA 1FJ9A 4MHFA 5T3JA 5EQ8A 2L5VA 5IM2A 3D1RA 2WBBA 3ROJA 4PF6A 1XI6A 4PDHA 4NHBA 2WYKA 2F3DA 1LBWA 5CM6A 2F3BA 4NQ8A 1IMFA 4GX4A 4X8RA 4QBAA 3FXBA 1LBVA 1EYKA 4PGPA 2XA5A 4X04A 3U65A 1INPA 5ET7A 4AS5A 5EQ7A 4MCOA 4P8BA 4X9TA 4N8GA 4LN5A 3MSTA 4GBWA 1FPIA 2CZIA 4P3LA 2Q74A 5ET6A 2CEYA 1NUZA 4N15A 5IZ3A 1FRPA 4OVPA 1IMBA 2XWKA 1KA0A 4F18A 4N91A 5IGAA 3ISPA 3RPLB 4JVDA 2FVZA 5LTCA 1FSAA 1VDWA 1BK4A 2QVUA 4GWSA 2HZKA 1IMAA 4QXDA 4HE1A 5LDZA 1DK4A 3CHGA 4I40A 1IMEA 1IMCA 2VT5A 4P1EA 4OANA 4PDDA 3W9VA 2BJIA 4H46A 1NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJ6 A;  1D9Q A;  3T0J A;  4GX3 A;  2PCR A;  1FPG A;  5A5L A;  1DCU A;  4GBV A;  2DDK A;  1FJ9 A;  3IFC A;  1YXI A;  5T3J A;  1LEV A;  3FBP A;  4GWW A;  5EYG A;  5EQ8 A;  1NUY A;  2WEF A;  1RDX A;  1FTA A;  1NV5 A;  1LBX A;  2WBB A;  3D1R A;  2R8T A;  1LBY A;  3ROJ A;  2FIE A;  2WBD A;  2Y5K A;  1KA1 A;  1FBG A;  1XI6 A;  1FBF A;  4G61 A;  1JP4 A;  4I3Y A;  2CZK A;  2F3D A;  1FBC A;  1LBW A;  3BIH A;  1IMD A;  1NUW A;  4MJO A;  4H45 A;  4HE0 A;  1NV6 A;  1FBP A;  2Q8M A;  3KC0 A;  2F3B A;  2P3N A;  2Y5L A;  1IMF A;  3IFA A;  2FIX A;  1FPD A;  1NV4 A;  4GX4 A;  4AS4 A;  1K9Y A;  5EYH A;  4IR8 A;  1LBV A;  1SPI A;  4N81 A;  1EYK A;  4O7I A;  5ET8 A;  1EYI A;  1CNQ A;  5I3S A;  2OWZ A;  5F24 A;  2FHY A;  4GX6 A;  1NV1 A;  1KZ8 A;  1FPL A;  1INP A;  1FBD A;  1EYJ A;  5IZ3 B;  5ET7 A;  4AS5 A;  5EQ7 A;  5FBP A;  4FBP A;  4HXV A;  1FPB A;  2JJK A;  1NV7 A;  1Q9D A;  1RDZ A;  1NI9 A;  1DBZ A;  4GWU A;  3LV0 A;  4GBW A;  1QGX A;  4PTK A;  4I3E A;  3KC1 A;  5ESY A;  5J16 A;  1NUX A;  1FPF A;  1FPI A;  2GQ1 A;  2CZI A;  1AWB A;  3LUZ A;  2Q74 A;  1G0H A;  5ET6 A;  1NUZ A;  3RYD A;  1FPE A;  4KXP A;  5IZ3 A;  4HE2 A;  1K9Z A;  1FRP A;  2OX3 A;  1IMB A;  5DW8 A;  5EQA A;  1KA0 A;  1FPJ A;  1FPK A;  3B8B A;  3RPL B;  1YYZ A;  2FVZ A;  2QFL A;  5ET5 A;  2QVR A;  1LBZ A;  2QVV A;  5IZ1 A;  1FSA A;  1VDW A;  1BK4 A;  2QVU A;  4GWS A;  1FBE A;  5EQ9 A;  4GWY A;  1IMA A;  1YZ0 A;  1NV3 A;  2FBP A;  4QXD A;  4HE1 A;  2P3V A;  5LDZ A;  1DK4 A;  1RDY A;  1G0I A;  1NV2 A;  4I40 A;  4GWX A;  1IME A;  3RPL A;  3BIG A;  1IMC A;  2HHM A;  3A29 A;  3QMF A;  2VT5 A;  3KBZ A;  2CZH A;  2BJI A;  1FBH A;  4GWZ A;  4H46 A;  1NV0 A; 
#chains in the Genus database with same CATH topology
 4G8N A;  3FXU A;  1QUK A;  2XXW A;  2UYF A;  4LQ5 A;  3R6U A;  1TT1 A;  5AE4 A;  1IEJ A;  1FQA A;  3FBP A;  1OQG A;  2Y7R A;  5K2Y A;  5TPA B;  3E4R A;  2A5T A;  1ZIU A;  3FV2 A;  2WBD A;  4NF8 B;  3KGC A;  4G8M A;  1N3X A;  2NUV A;  4GIZ A;  2HQ0 A;  3BIH A;  1NUW A;  5ICT A;  1B1H A;  4YB6 A;  4KD5 A;  4EDP A;  2V4C A;  4N8Y A;  3ODB A;  1FBP A;  3U1O A;  4JVC A;  1NV4 A;  1K9Y A;  5EYH A;  3N94 A;  3IOW A;  3SDF A;  2YPN A;  3FXR A;  1Y9U A;  1H44 A;  1MPC A;  2D3I A;  1KZ8 A;  2WX9 A;  1EYJ A;  3I3V A;  5IZ3 B;  3PV0 E;  3LBS A;  1FPB A;  2ONS A;  2VOZ A;  3KEI A;  5J16 A;  3MZ1 A;  3MZB A;  4F29 A;  3G3F A;  4ZED A;  1XC1 A;  1AWB A;  3LUZ A;  1P1N A;  5L9S A;  1D9Y A;  2P2A A;  1FPE A;  3PGF A;  4BDN A;  4QFP A;  2PT1 A;  2DWH A;  1FTJ A;  3K4U A;  4OWD A;  3QYT A;  4ZEF A;  4P47 A;  1B32 A;  4F1Y A;  4H65 A;  1SDX A;  1YYZ A;  3N6U A;  3FXQ A;  3TTR A;  4MNP A;  4OVS A;  3H6V A;  3CVG A;  1Y1Z A;  4ESW A;  1BTJ A;  2F7A A;  1S7Y A;  3TYH A;  3KN8 A;  4OFJ A;  3MZ9 A;  2A5T B;  2PFZ A;  3CSG A;  1EZP A;  2DSF A;  1FJ6 A;  1LB9 A;  3TTL A;  3O97 A;  5A5L A;  2Z23 A;  3VLW A;  1DCU A;  2B4L A;  4NF6 A;  2QS3 A;  1IXH A;  1RDX A;  3PUZ E;  4N13 A;  5AA2 A;  4G8H A;  1D9V A;  2RIN A;  1HSJ A;  4QRZ A;  3LSW A;  1SBP A;  1MS7 A;  1B46 A;  5I2N A;  3IOT A;  4JVI A;  1QUL A;  5B70 A;  5ET8 A;  1LCF A;  4EF1 A;  4O7M A;  3VVD A;  4Q8R A;  3E78 A;  1A99 A;  1I6A A;  1Y4C A;  3B50 A;  2O6A A;  3LUY A;  4FBP A;  3VXC A;  3PUV E;  2Q89 A;  5DTB A;  4PTK A;  4ZDM A;  2F7C A;  1A8F A;  3FVN A;  4QF9 A;  5L8D A;  4O3B A;  4N6P A;  4OQO A;  4XFE A;  1K9Z A;  4LAT A;  1IQ7 A;  2XHD A;  4QSE A;  1FPK A;  1MM7 A;  3C32 A;  3T9V A;  2I4B A;  2QVR A;  5I5P A;  2VD3 A;  1SQY A;  4WEP A;  3H4Z A;  1SYH A;  5H8H A;  5I59 B;  1YPN A;  2RF1 A;  3QSL A;  1MDQ A;  1UTH A;  4KQP A;  3E13 X;  4NF6 B;  5DYH A;  3CI8 A;  2HHM A;  3SET A;  4X1D A;  5KZT A;  4GXA A;  5AA2 B;  1FBH A;  3TOD A;  2X7Q A;  3EHT A;  3JV9 A;  1R1N A;  5DEX A;  3K1P A;  5FTH A;  3DM0 A;  4PBQ A;  3H03 A;  1B3E A;  1NH8 A;  1AOV A;  1MM6 A;  5I2N B;  1IXI A;  3U8Q A;  4G77 A;  1ATG A;  1ELJ A;  3H3G A;  5TP9 A;  3S2V A;  3FJM A;  3ILU B;  1R9Q A;  1POT A;  4G68 B;  4GL0 A;  2V93 A;  4UA8 A;  2OLB A;  4F31 B;  3C35 A;  1GR2 A;  2HXW A;  1ZKB A;  2RKM A;  1GTK A;  4GLI A;  3UGW A;  1LAX A;  1FBD A;  4YIC A;  5FTI A;  3VVE A;  1NH7 A;  3S9E A;  1NNF A;  4N6K A;  4PFB A;  3UK4 A;  2KQZ A;  1HSL A;  3TEL A;  4GWU A;  4PC9 A;  5L9O A;  2I49 A;  4KR5 A;  4FOR A;  2QPQ A;  4KXP A;  3KN7 A;  3K6V A;  4PE3 A;  1NNP A;  3VLU A;  1Z7M E;  3PPO A;  4FJP A;  4NAP A;  1KWH A;  4Z7E A;  2XWO A;  4KYE A;  2QVV A;  3MW0 A;  1MRP A;  1LB8 A;  5EYF A;  3GLB A;  2ZXT A;  4PCD A;  2OJT A;  1ANF A;  4XIG Q;  1A40 A;  4X1B A;  2P3V A;  1B3L A;  1RDY A;  1G0I A;  1XS5 A;  1FW0 A;  4R6H A;  2WYP A;  2P0S A;  4N6D A;  2Z8E A;  4RK2 A;  4GWZ A;  1P1O A;  4I1D A;  4XKN A;  1J1N A;  4XF5 A;  2THI A;  4AQ4 A;  1IIW A;  1EZO A;  2REJ A;  3CFX A;  3K2D A;  2XXY A;  3ROJ A;  4PF6 A;  1B4Z A;  4LP2 B;  5H8Q B;  4IO5 A;  1MH4 A;  3SEX A;  1TFD A;  3DP4 A;  3RNN A;  1Y4T A;  1JEV A;  4MBP A;  4H67 A;  5I84 A;  1TXF A;  2F7B A;  2Y7K A;  1OVT A;  4G2Z A;  1LBV A;  3IB0 A;  4PGP A;  5DVI A;  3MP1 A;  1YTV A;  3IX1 A;  1MPD A;  2XXQ A;  2DXR A;  4EQ9 A;  3EF7 A;  1SYI A;  5EQ7 A;  4R9G A;  3QXM A;  1SI1 A;  4N8G A;  3FZV A;  3HO7 A;  5I58 A;  2XD3 A;  1MPB A;  1B7H A;  2D5W A;  3HN0 A;  5ET6 A;  1N76 A;  3O9P A;  5I57 A;  1MY1 A;  3MQ9 A;  1R6Z A;  2DVC A;  1FRP A;  1KA0 A;  3EN3 A;  5ITP A;  1MQG A;  1UQW A;  3H6U A;  3Q26 A;  5A5X A;  2OCU A;  2ANJ A;  4PP0 A;  3M8U A;  1B5H A;  4ZEK A;  3FIR A;  4YMB A;  3K1M A;  4HE1 A;  2XD2 A;  5CMM A;  4PFU A;  1QW0 A;  4NMY A;  1MXV A;  1JET A;  2VT5 A;  4OAN A;  3T0J A;  2REG A;  2PCR A;  1MXY A;  2H99 A;  4KCD A;  4RYA A;  4KYS A;  3IAZ A;  1NV5 A;  4L17 A;  1QKB A;  5FHN A;  2RC9 A;  4MLV A;  4HS7 A;  4R73 A;  4GWO A;  1XOC A;  1OMP A;  1SPI A;  3PMX A;  3K6W A;  3EHU A;  1EYI A;  5I58 B;  1WOD A;  5F24 A;  2HFB A;  4TQU Q;  3QK6 A;  1FPL A;  5I57 B;  2DYX A;  4JWO A;  3O6G A;  3HCQ A;  3KSX A;  1RDZ A;  1NI9 A;  3KFM A;  4BDM A;  4F1V A;  4OHN A;  3KC1 A;  5TPA A;  3ILT B;  4FIM A;  4PAI A;  4NF8 A;  4P9K A;  2XXR A;  4JDF A;  4WKM A;  3ONM A;  3VXB A;  2DQV A;  2O51 A;  5BWJ A;  3TMG A;  4F3B A;  4PFI A;  4F2Q A;  3N5L A;  3UN6 A;  4FAJ A;  4R75 A;  2Q2A A;  2CZL A;  5IAI A;  2OPE A;  1XVY A;  5IZ1 A;  4N07 A;  4QHQ A;  1PBQ A;  4LVQ A;  1YZ0 A;  1F9B A;  4NF0 A;  4NWC A;  4ZEI A;  3A3U A;  5I2K B;  2Z8D A;  3KBZ A;  4JB7 A;  2E1S A;  1MXW A;  4U2R A;  1MQH A;  1NMU A;  1N7W A;  4E0X A;  1FPG A;  4NWD A;  3MJN A;  1LFI A;  2QS4 A;  3B6T A;  3C9H A;  5EYG A;  4XEQ A;  2Y7P A;  2WEF A;  1LBY A;  3PPR A;  1KA1 A;  2AL5 A;  1FBF A;  2ZZV A;  4I3Y A;  2WKY A;  1FBC A;  1SVX B;  4IY5 A;  4MNC A;  2XXK A;  4H6D A;  2P3N A;  5CBR A;  1UIU A;  3Q28 A;  4RPO A;  2XXV A;  5AA4 A;  4N81 A;  2QJE A;  4MEV A;  3DP8 A;  4ONY A;  5I3S A;  4GX6 A;  2I0C A;  1LGB C;  5DVF A;  5H8F A;  4EQ7 A;  3GZG A;  2JJK A;  1P1U A;  1D3K A;  4NGU A;  4TLL B;  1MY0 A;  3DEL B;  2ESN A;  1NNK A;  3QUF A;  4YB7 A;  4U22 A;  3TPA A;  5AA1 A;  5AA2 D;  1USY H;  4I9D A;  3V8X B;  3FUZ A;  3H6T A;  3OO7 A;  4P11 A;  2RCB A;  3CFL A;  4MAG A;  2IA4 A;  3B8B A;  3PUW E;  1IUD A;  4NN3 A;  3QUJ A;  3V89 B;  4AB6 A;  3MVX A;  4I62 A;  2F36 A;  1LFG A;  1DSN A;  3FVG A;  4JWX A;  1VR5 A;  3OSR A;  3BFT A;  4ZS9 A;  4NED A;  3RQT A;  5H8S A;  1B52 A;  1B9J A;  2VPN A;  2HAU A;  1B4H A;  2B3F A;  1P1Q A;  1H3D A;  1WDN A;  3MP6 A;  1D9Q A;  3T22 A;  2V3Q A;  3B6Q A;  5JTY A;  2Z8F A;  3IFC A;  5ICQ A;  1LEV A;  4R2B A;  2XX9 A;  3M3K A;  4IY6 A;  1FQE A;  5AA4 B;  3O28 A;  2XWI A;  1PB8 A;  1PDA A;  3Q27 A;  4FEB A;  4ZEC A;  3CRB A;  3KZG A;  1JEU A;  1NV6 A;  2Q8M A;  5I59 A;  4TOZ A;  3SEY A;  3IB2 A;  2UVI A;  3KJ7 A;  2FIX A;  3OEL A;  5H8F B;  4AS4 A;  3SZP A;  3TZA A;  3TTN A;  4MH5 A;  4E0W A;  3HHG A;  4Q5T A;  4OZ9 A;  4PAK A;  4MX6 A;  1B5I A;  3VV5 A;  1NV1 A;  1Z7N E;  2H25 A;  4DI3 D;  2CEX A;  4QSD A;  5KDT B;  5FBP A;  3ZKL A;  1DBZ A;  3RN8 A;  5JK4 A;  2Z22 A;  4IO7 A;  3HHF A;  2I58 A;  1M5E A;  3N26 A;  3GBB A;  4P56 A;  3C36 A;  2QS1 A;  1MY3 A;  1USY E;  4G68 A;  2XWV A;  1B5J A;  2PBW A;  4DXU A;  4RJZ A;  4Q0C A;  4PAF A;  2DE2 A;  4R6Y A;  2MKZ A;  4WED A;  4YMA A;  1POY 1;  3C33 A;  3U94 A;  1A8E A;  5JTY B;  3LC8 A;  2DOJ A;  2OBG A;  4RXL A;  2ZZW A;  3IOV A;  4X48 A;  3O2A A;  4MF3 A;  5T3J A;  4QSC A;  1M5D A;  3C31 A;  3CFZ A;  4H0W A;  3PPN A;  3D1R A;  3TUS A;  2WBB A;  1QJM A;  3ECR A;  3N6T A;  1I6B A;  3IK6 B;  3VE1 B;  4NHB A;  2WYK A;  2F3D A;  1LBW A;  2NVU B;  3MVY A;  4F2O A;  1B7Z A;  2ZYM A;  2AIX A;  1BIY A;  2F3B A;  1Y1M A;  3H06 B;  3SER A;  2Q8J A;  1A7L A;  4QBA A;  1ZMG A;  3FVK A;  5CC2 A;  2XA5 A;  2O7I A;  4X04 A;  1DPE A;  1INP A;  3T96 B;  4AS5 A;  2QRY A;  2YLN A;  1DOT A;  3MST A;  4GBW A;  2O7U A;  4GXS B;  1FPI A;  3THI A;  1ZLQ A;  1MQD A;  4OFL A;  4YB5 A;  3M3L A;  5H8Q A;  3UA8 A;  2AYS A;  1UTB A;  3MBP A;  2AL4 A;  3ISP A;  4H1X A;  1B0H A;  3CG3 A;  1JNF A;  2O1L A;  4JVD A;  5LTC A;  1M5F A;  1FSA A;  2H5Y A;  1BK4 A;  4GRK A;  2HZK A;  3GBA A;  5LDZ A;  1QKA A;  1H45 A;  2QSX A;  3V83 A;  3K02 A;  3K1N A;  4IO3 A;  4KI0 E;  2BJI A;  4DDD A;  1S50 A;  4YKI A;  4OYV A;  4ESX A;  4GL8 A;  1OLA A;  3K0V A;  3IL1 B;  1Y3N A;  1M5C A;  1B58 A;  5H8N A;  3UIF A;  4LZ5 A;  1YXI A;  1FTM A;  4PQJ A;  4P1L A;  2G93 A;  1JVY A;  3D4G A;  1MY4 A;  4I8C A;  2R6G E;  3TDJ A;  3JZJ A;  2E0S A;  2XXU A;  5L9M A;  3FD3 A;  1HSE A;  1MQJ A;  3CIJ A;  4PET A;  3KC0 A;  4DCX A;  1JW4 A;  3W9W A;  4IO2 A;  3OEM A;  1DMB A;  3A3C A;  4IR8 A;  1BP5 A;  3GYY A;  1CNQ A;  4K3F A;  3SEW A;  3LR1 A;  4U21 A;  1Q9D A;  1RKM A;  1UTB B;  4UAB A;  2F35 A;  3V5A A;  4JBZ A;  1QGX A;  4I3E A;  4DIG A;  1DPP A;  1LCT A;  3T9X B;  1NNT A;  3TTK A;  2PT2 A;  4F19 A;  2RC7 A;  4XKP A;  2F6G A;  1OVB A;  5EQA A;  1H76 A;  4NF5 B;  1FPJ A;  5HBC A;  2KLF A;  3OXN A;  2Q9T A;  4OXV A;  1FTL A;  1TFA A;  1B05 A;  2F6P A;  3MUQ A;  1URD A;  5ITO A;  2B3B A;  2ONR A;  4UAC A;  3RT6 B;  1NV3 A;  5H8N B;  4PFT A;  2BJJ X;  4OTE A;  3QMF A;  3G3J A;  3PUY E;  3IOR A;  4PFY A;  3FAT A;  2W7Y A;  3S9M C;  2DDK A;  4O3A A;  4PFR A;  1FTA A;  3KOS A;  1LBX A;  4BDO A;  4ZZA A;  3LSL A;  3T1B A;  4G61 A;  4GD5 A;  1YAE A;  2GH9 A;  3HFU A;  2Q2C A;  1IMD A;  2KR0 A;  3FGS A;  1S9T A;  2FNC A;  3IFA A;  1M5B A;  1O64 A;  2UXA A;  1N3W A;  3H6W A;  2V84 A;  5EHS A;  4ZE9 A;  4YKP A;  4F1U A;  5I2K A;  4U23 A;  4KFQ A;  3MWB A;  4QFL A;  1O63 A;  3OD7 A;  5BUU A;  4U4S A;  2P1S A;  3CG1 A;  2X7P A;  2ZNU A;  5ESY A;  1NUX A;  3NOH A;  1BKA A;  4FAT A;  1G0H A;  4XTC Q;  1OQH A;  3DP6 A;  1SD3 A;  3TTM A;  4HCY A;  4PBH A;  3RY3 A;  4IO4 A;  2VPO A;  3G3I A;  5CMK A;  1AL3 A;  2PX1 A;  2F78 A;  4ZE8 A;  5CI5 A;  1LAH E;  1PB7 A;  2HCA A;  3RUM A;  3IR1 A;  2XX8 A;  1B6H A;  5EQ9 A;  4P0G A;  1QUJ A;  1Y3P A;  3T9U A;  3MP8 A;  5KCJ A;  2X26 A;  4GWX A;  2QMW A;  2VP1 A;  1FTK A;  5LOM A;  4EXL A;  3PMV A;  4OMB A;  3MYU A;  3B7D A;  1N04 A;  3OO9 A;  1LFH A;  2R8T A;  2HZL A;  3T66 A;  2Y84 A;  2DXY A;  4YU0 A;  1JW1 A;  4MJO A;  1XHY A;  5F1Q A;  3TCH A;  2V3T A;  4LON B;  1LLS A;  1MQI A;  1LAF E;  2B65 A;  3PD9 A;  2Q88 A;  2GHA A;  5FHO A;  4OEN A;  2QL3 A;  2FHY A;  1EZ9 A;  3OO8 A;  4KHZ E;  2V25 A;  1AIV A;  3R7X A;  4JXI A;  2DP8 A;  3RTW B;  3G3K A;  5I56 B;  3SEU A;  3O6H A;  3RGY A;  3LV0 A;  4OVT A;  3IJX B;  4DI4 B;  4O8M A;  2I3W A;  2DWI A;  3RYD A;  5EHM A;  1FQD A;  5J1D A;  2OX3 A;  2UVH A;  2UYE A;  5KCJ B;  1Y3Q A;  4YKK A;  4PGN A;  5ET5 A;  1LBZ A;  4POX A;  1B0L A;  1II5 A;  4THI A;  4GWY A;  2I48 A;  2FBP A;  3MVZ A;  2V3U A;  5KDT A;  2O84 X;  3EKI A;  4EQB A;  3BIG A;  2R71 A;  4Q30 B;  1B1X A;  4HCW A;  1PB9 A;  2HEU A;  4MLQ A;  4G68 C;  4IGR A;  2OWT A;  1FJ9 A;  1US4 A;  3UP9 A;  5EQ8 A;  4O3C A;  2L5V A;  3TAJ A;  5IM2 A;  4DE8 A;  1B3H A;  2M8C A;  1MY2 A;  1XI6 A;  4IB2 A;  4PDH A;  1JQF A;  3HST A;  3OSQ A;  3RTF B;  1L5T A;  1MXU A;  1Q1K A;  1AH5 A;  4NQ8 A;  2ABH A;  1IMF A;  4U1O A;  1T0K A;  4X8R A;  3FXB A;  3SEV A;  1EYK A;  4DLD A;  3KSJ A;  3KN3 A;  3VDF A;  3BKI B;  5JEI A;  4MCO A;  3U92 A;  4GOT A;  4P8B A;  4X9T A;  1VSO A;  4LN5 A;  5AA3 A;  1BLF A;  3IO4 A;  3I6V A;  4P0I A;  4GF8 A;  3LSX A;  4KPT A;  4P3L A;  2Q74 A;  3C34 A;  2NWJ A;  4DXB A;  3B6W A;  4N15 A;  1NUZ A;  3PPP A;  1MDP 1;  2ZYN A;  3PU5 A;  4OVP A;  2XWK A;  4PFW A;  3LSF B;  4R72 A;  3T9H B;  5IGA A;  3SKP A;  2H4I A;  3AXF A;  2XX7 A;  3G3G A;  3ZKK A;  2GRV A;  1NKX A;  3BFU A;  1MXZ A;  3W15 C;  4ELR A;  2GFE A;  4H5F A;  5DT6 A;  4QXD A;  4FED A;  1XT8 A;  1DK4 A;  4KCC A;  4ELQ A;  1IME A;  2VGQ A;  3RT8 A;  3I5O A;  3PMW A;  4LZ8 A;  4PDD A;  2PMS A;  3W9V A;  1IZ1 A;  4JSD A;  4H46 A;  4YZZ A;  1ZU0 A;  1NV0 A;  4HTG A;  1IIT A;  3WAE A;  3TQL A;  1B40 A;  2ONK E;  1TWY A;  4GBV A;  2F5X A;  4MMP A;  4U4X A;  2XXH A;  3KBR A;  1NUY A;  1MG1 A;  1PC3 A;  3Q29 A;  4EUO A;  2DE4 A;  1I69 A;  3U72 A;  4DZ1 A;  1P1W A;  2H9B A;  1JP4 A;  3IO6 A;  2QMX A;  2HAV A;  2CZK A;  1N84 A;  4OES A;  3T93 B;  1QVS A;  4H8J A;  4QFN A;  2O69 A;  2UVJ A;  1MXX A;  2DWA A;  4OER A;  4OVR A;  1MH3 A;  3S9L C;  4RNS A;  4POW A;  4QFO A;  5B7D A;  1LST A;  3OOA A;  4LUB A;  2OWZ A;  1OLC A;  3OO6 A;  1WVJ A;  2H98 A;  4HW8 A;  2NOO A;  1ZJL A;  4O94 A;  3PTY A;  1LBB A;  1Q35 A;  4N17 A;  2PVU A;  4F3P A;  2DVZ A;  2RCA A;  3VVF A;  4OA4 A;  4PF8 A;  4MFI A;  3SES A;  5IKB A;  3ZS6 A;  3K00 A;  1ZBM A;  4FE8 A;  2VD2 A;  1VE4 A;  3WAF A;  3USD A;  1GV8 A;  4IGT A;  1LAG E;  4N4U A;  4YAH X;  3FVO A;  1CE2 A;  3MPL A;  3TKD A;  4R6K A;  4MIJ A;  4OEU A;  4H5G A;  1SW5 A;  2R9J A;  2OWS A;  3VFJ A;  1NV2 A;  3FJG A;  4R9F A;  1B3G A;  4KYD A;  4IO6 A;  3MC2 A;  4GVO A;  2CZH A;  3C4M A;  4LQ2 A;  1ZTY A;  4M1V A;  5CMC A;  3GXA A;  4GX3 A;  4OVQ A;  5F7V A;  3ZSF A;  2XXX A;  4RA1 A;  3Q25 A;  3E3K A;  4NF5 A;  4C1T A;  1A55 A;  4MNI A;  2OK2 A;  2Y5K A;  1FBG A;  3OEN A;  1YCJ A;  2PFY A;  3RLF E;  3M3F A;  4RK9 A;  2IEE A;  2NXO A;  2XXT A;  3TFL A;  3JYR A;  2HXR A;  3OEK A;  2Y5L A;  2OPD A;  2XXP A;  2XXI A;  4ELO A;  1NL5 A;  1IXC A;  3D4C A;  4O7I A;  5FHM A;  2G29 A;  5H8H B;  4BDL A;  3G3H A;  4BDR A;  1UTH B;  3TCF A;  4LA9 A;  4HXV A;  1NV7 A;  2YJP A;  4NF4 A;  1VFE A;  1AMF A;  1LBC A;  4LZ7 A;  2Y7I A;  4G4P A;  1GVC A;  4DXC A;  2DS9 A;  4Z0I A;  1FPF A;  1FQC A;  2D21 A;  4ZEB A;  5DEX B;  4HE2 A;  3IOU A;  1FCK A;  5DW8 A;  1B51 A;  1PEB A;  5K2X A;  3IB1 A;  4M4G A;  3L6G A;  3A09 A;  5TP9 B;  1FTO A;  2QFL A;  2FA7 A;  1B7U A;  3HPI A;  3S4U A;  4GQO A;  1FBE A;  3EHS A;  4NE4 A;  2HPG A;  3A29 A;  2O1M A;  2O68 A;  3E9X A;  4TLM B;  3KJT A;  2I3V A;  4ZZE A;  2OZZ A;  4NG7 A;  4F3G A;  4OET A;  4EF2 A;  3TCG A;  3E79 A;  1B2H A;  2FYI A;  4GWW A;  5I7I A;  3L6H A;  2QS2 A;  2DWJ A;  2FIE A;  1P99 A;  2B4M A;  3VLV A;  2ZMB A;  4ND9 A;  5CBS A;  3H7M A;  4C0R A;  4XXU A;  4H45 A;  4HE0 A;  4NX1 A;  1FPD A;  4NF4 B;  3U93 A;  4R2F A;  1JVX A;  4GFR A;  1RYX A;  3EQ1 A;  2F8D A;  4BLA A;  3CSB A;  1SW4 A;  3FV1 A;  5CRY A;  1H43 A;  3KOT A;  2UVG A;  5DVJ A;  3PPQ A;  3F11 A;  3R26 A;  1D4N A;  2DE3 A;  2GQ1 A;  2CMO A;  4F39 A;  1NFT A;  5HM4 B;  2F97 A;  4JSO A;  2ZZX A;  5CMB A;  3K6X A;  1SW2 A;  4JWY A;  1A54 A;  3QAX A;  4R74 A;  5TU0 A;  1GGG A;  2ALU A;  2I4C A;  1O7T A;  1R9L A;  4U1Z A;  3CR9 A;  4NTL A;  4WXJ A;  4PE5 B;  1DTZ A;  1B3F A;  4C1U A;  3RPL A;  3O66 A;  3FAS A;  2A5S A;  5I56 A;  2I0B A;  1UIV A;  3G7W A;  2ZYO A;  4H8I A;  5IZZ A;  1EH3 A;  1VFD A;  1FQF A;  4DCY A;  1SI0 A;  4MHF A;  3K01 A;  4XKQ A;  1N0T A;  1FQB A;  1PBP A;  3O29 A;  2VHA A;  1URG A;  3S9N C;  3O6I A;  3QIM A;  5M2V A;  3PUX E;  4FEC A;  3EPE A;  3RPW A;  4ELP A;  5CM6 A;  4OEV A;  4ECF A;  4GX4 A;  5A5X B;  1OIB A;  4AB5 A;  2F34 A;  1SW1 A;  3IJO B;  2GHB A;  5ELV A;  1DTG A;  3U65 A;  3OMB A;  4OFO A;  2PYY A;  4F3S A;  5ET7 A;  2I6E A;  1CB6 A;  3K6U A;  3BBR A;  4BDQ A;  4RPN A;  3DLN A;  3HV1 A;  2RC8 A;  3PD8 A;  2ZNS A;  2CZI A;  1XVX A;  2LAO A;  1I6Q A;  4F22 A;  1JW5 A;  2CEY A;  4EXK A;  2ZNT A;  5IZ3 A;  1Y20 A;  1EU8 A;  1RYO A;  1IMB A;  4F18 A;  4XKR A;  5HPQ A;  4N91 A;  1US5 A;  3MPK A;  4YKJ A;  3RPL B;  1URS A;  2FVZ A;  3P7I A;  1IXG A;  1QUI A;  3KG2 A;  4RY1 A;  5ISU A;  1N7X A;  1VDW A;  3TQW A;  2QVU A;  4GWS A;  3MAM A;  1IMA A;  3TEP A;  4ISU A;  4QFK A;  3CHG A;  4I40 A;  2Y7W A;  1IMC A;  4P1E A;  3MVW A;  4OVJ A;  3FJ7 A;  2ZYK A;  3UOR A; 
#chains in the Genus database with same CATH homology
 3T0J A;  2PCR A;  4GBV A;  2F5X A;  1YXI A;  4MMP A;  3FBP A;  4P1L A;  1NUY A;  1NV5 A;  2DE4 A;  2WBD A;  1JP4 A;  2CZK A;  3BIH A;  1NUW A;  2V4C A;  4N8Y A;  1FBP A;  4PET A;  3KC0 A;  4JVC A;  1NV4 A;  3W9W A;  1K9Y A;  5EYH A;  4OVR A;  4IR8 A;  1SPI A;  1EYI A;  3GYY A;  1CNQ A;  2OWZ A;  5F24 A;  1KZ8 A;  2WX9 A;  1FPL A;  1EYJ A;  5IZ3 B;  4O94 A;  3PTY A;  1FPB A;  4N17 A;  1Q9D A;  1RDZ A;  1NI9 A;  4UAB A;  4F1V A;  2DVZ A;  1QGX A;  5J16 A;  4I3E A;  3KC1 A;  4PAI A;  4OA4 A;  4PF8 A;  1AWB A;  3LUZ A;  4P9K A;  1FPE A;  4F19 A;  4PFI A;  5EQA A;  1FPJ A;  4P47 A;  4N4U A;  2Q9T A;  1YYZ A;  4MNP A;  4OVS A;  5IZ1 A;  1YZ0 A;  1NV3 A;  4MIJ A;  4NF0 A;  1NV2 A;  3QMF A;  3KBZ A;  2CZH A;  2PFZ A;  1FJ6 A;  4M1V A;  4GX3 A;  4OVQ A;  1FPG A;  5A5L A;  1DCU A;  2B4L A;  2DDK A;  5EYG A;  4XEQ A;  4PFR A;  2WEF A;  1RDX A;  1FTA A;  1LBX A;  1LBY A;  4MNI A;  2Y5K A;  1KA1 A;  3T1B A;  1FBG A;  4G61 A;  1FBF A;  2ZZV A;  2PFY A;  4I3Y A;  3HFU A;  1FBC A;  1IMD A;  4MNC A;  2XXK A;  2HXR A;  2KR0 A;  2P3N A;  2Y5L A;  3IFA A;  4JVI A;  4N81 A;  4O7I A;  5ET8 A;  4MEV A;  4F1U A;  4O7M A;  5I3S A;  4GX6 A;  3E78 A;  3B50 A;  4FBP A;  4HXV A;  2JJK A;  1NV7 A;  4NGU A;  4PTK A;  5ESY A;  1NUX A;  3NOH A;  1FPF A;  1G0H A;  4HE2 A;  4XFE A;  1K9Z A;  4HCY A;  4PBH A;  5DW8 A;  2VPO A;  1FPK A;  4MAG A;  3B8B A;  2QFL A;  2QVR A;  4NN3 A;  5I5P A;  1FBE A;  5EQ9 A;  4GWX A;  2HHM A;  2HPG A;  2VPN A;  3A29 A;  1FBH A;  4NG7 A;  1D9Q A;  2V3Q A;  3E79 A;  3MYU A;  3IFC A;  4PBQ A;  1LEV A;  4GWW A;  5I7I A;  2R8T A;  2HZL A;  2FIE A;  2B4M A;  2XWI A;  4MJO A;  4H45 A;  4HE0 A;  1NV6 A;  2Q8M A;  4NX1 A;  2FIX A;  1FPD A;  4AS4 A;  3SZP A;  4PAK A;  4MX6 A;  2FHY A;  1NV1 A;  1FBD A;  4YIC A;  4DI3 D;  2CEX A;  5FBP A;  4N6K A;  4PFB A;  2KQZ A;  1DBZ A;  4GWU A;  3LV0 A;  4OVT A;  4PC9 A;  5JK4 A;  4DI4 B;  2DE3 A;  4O8M A;  2GQ1 A;  2QPQ A;  3RYD A;  4P56 A;  4KXP A;  4PE3 A;  2ZZX A;  5J1D A;  2OX3 A;  4NAP A;  2XWV A;  2XWO A;  4PGN A;  5ET5 A;  4PAF A;  2DE2 A;  2QVV A;  1LBZ A;  4YZZ A;  4PCD A;  2MKZ A;  4GWY A;  2FBP A;  2P3V A;  1RDY A;  3EKI A;  1G0I A;  3RPL A;  3BIG A;  2WYP A;  4N6D A;  2ZZW A;  4GWZ A;  4HCW A;  4XF5 A;  5IZZ A;  1FJ9 A;  4MHF A;  5T3J A;  5EQ8 A;  2L5V A;  5IM2 A;  3D1R A;  2WBB A;  3ROJ A;  4PF6 A;  1XI6 A;  4PDH A;  4NHB A;  2WYK A;  2F3D A;  1LBW A;  5CM6 A;  2F3B A;  4NQ8 A;  1IMF A;  4GX4 A;  4X8R A;  4QBA A;  3FXB A;  1LBV A;  1EYK A;  4PGP A;  2XA5 A;  4X04 A;  3U65 A;  1INP A;  5ET7 A;  4AS5 A;  5EQ7 A;  4MCO A;  4P8B A;  4X9T A;  4N8G A;  4LN5 A;  3MST A;  4GBW A;  1FPI A;  2CZI A;  4P3L A;  2Q74 A;  5ET6 A;  2CEY A;  1NUZ A;  4N15 A;  5IZ3 A;  1FRP A;  4OVP A;  1IMB A;  2XWK A;  1KA0 A;  4F18 A;  4N91 A;  5IGA A;  3ISP A;  3RPL B;  4JVD A;  2FVZ A;  5LTC A;  1FSA A;  1VDW A;  1BK4 A;  2QVU A;  4GWS A;  2HZK A;  1IMA A;  4QXD A;  4HE1 A;  5LDZ A;  1DK4 A;  3CHG A;  4I40 A;  1IME A;  1IMC A;  2VT5 A;  4P1E A;  4OAN A;  4PDD A;  3W9V A;  2BJI A;  4H46 A;  1NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...