4HE2A

Crystal structure of human muscle fructose-1,6-bisphosphatase q32r mutant complex with amp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
308
Chain Sequence
LTLTRYVMEKGRQAKGTGELTRLLNSMLTAIKAISSAVRKAGLAKLDVLSNSLVINMLQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase isozyme 2
publication title Crystal Structures of Human Muscle Fructose-1,6-Bisphosphatase: Novel Quaternary States, Enhanced AMP Affinity, and Allosteric Signal Transmission Pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 308
sequence length 325
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4he2A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4he2A02
1AWBA 1FBGA 5DW8A 2Y5LA 4H45A 1FPDA 5T3JA 5EYHA 1LBXA 3IFAA 2CZHA 3T0JA 1IMDA 1FTAA 1RDXA 4HE1A 1DK4A 1FBFA 5I3SA 1EYIA 2FIXA 4QXDA 2FBPA 1NUZA 4FBPA 3ROJA 4I3YA 5IZ1A 2FIEA 2P3VA 1KZ8A 2WBDA 1NUWA 2Q74A 1NV4A 2PCRA 4GBVA 3D1RA 1EYKA 2OWZA 1FPKA 1NV7A 1FBPA 3RPLA 1YYZA 1IMFA 1JP4A 4GWZA 1BK4A 1NI9A 4GX3A 1EYJA 1FPFA 1FPGA 1LBYA 1IMBA 4GX4A 5F24A 1IMEA 1YXIA 1KA0A 2FVZA 1G0HA 2HHMA 5EQ7A 1RDYA 4AS5A 2BJIA 1FPEA 4H46A 5EQ9A 2VT5A 1VDWA 4I3EA 3FBPA 3RPLB 2QFLA 4GWWA 3BIGA 2F3BA 2GQ1A 3KC0A 5EYGA 1FPJA 1IMCA 1G0IA 1NV3A 1KA1A 1LEVA 5ET8A 5EQAA 1RDZA 2R8TA 1FPBA 2FHYA 1NV1A 4GWUA 1CNQA 4N81A 4AS4A 1NV5A 4GBWA 4O7IA 5ET7A 1LBZA 4PTKA 5FBPA 3RYDA 2WEFA 5IZ3A 4HE2A 1NV2A 4KXPA 4GWXA 4IR8A 1FPIA 2Q8MA 5EQ8A 2OX3A 4MJOA 1NUXA 3BIHA 1FSAA 1IMAA 2Y5KA 3IFCA 2F3DA 5IZ3B 4I40A 2WBBA 2CZIA 1NV6A 4GWYA 1LBWA 5ESYA 1FBEA 4GWSA 1QGXA 1FBDA 5A5LA 1K9YA 4HE0A 2JJKA 5J16A 5ET6A 3A29A 1DBZA 1LBVA 3LUZA 4HXVA 1FBCA 1XI6A 5LDZA 2QVRA 3QMFA 1NUYA 2QVUA 3KC1A 4G61A 1D9QA 1FPLA 4GX6A 2DDKA 2P3NA 1Q9DA 1INPA 2CZKA 1YZ0A 1K9ZA 3B8BA 3KBZA 2QVVA 1FRPA 1SPIA 1DCUA 1FBHA 1NV0A 1FJ6A 3LV0A 5ET5A 1FJ9A
chains in the Genus database with same CATH superfamily
5A5XB 3TMGA 3UORA 3S9NC 3EF7A 5H8NA 1H76A 4EQ7A 2I0BA 3FXRA 3K6WA 4GIZA 5F1QA 2RC7A 2VHAA 3OENA 4HTGA 3W9VA 1LGBC 3K1NA 2FIEA 2Z23A 3CFZA 1ZKBA 3UN6A 1VSOA 3E3KA 3IR1A 5KDTB 1NI9A 3QSLA 4XFEA 5HM4B 1LBYA 4GWOA 4MLQA 4U22A 3T96B 3R6UA 3EHSA 1H43A 2RC8A 3RUMA 4X8RA 1EH3A 2HZLA 3N94A 3WAFA 3TPAA 3TFLA 1JQFA 1MM7A 1B51A 2DVZA 4XKRA 1MXYA 4IGRA 1T0KA 4G2ZA 3T9UA 4WKMA 3DP6A 4KXPA 4N8GA 4XEQA 2Q89A 3OOAA 3TYHA 3TTLA 4RY1A 1D4NA 3JV9A 2XXWA 3P7IA 2WKYA 1DBZA 4O3BA 1FQAA 1XI6A 4OENA 4OXVA 2DDKA 2ONSA 5DVJA 3OEMA 4KYSA 2Y84A 5H8HB 4E0XA 1M5CA 2O1LA 3IJXB 3VV5A 1UIVA 2REJA 4NMYA 3KGCA 3VLUA 3MVYA 4P1EA 3OD7A 4RPNA 3OEKA 4X9TA 3C35A 5A5XA 1IXGA 4GL8A 3KZGA 2PYYA 2DYXA 3PPNA 4DXUA 4Q30B 3Q26A 2QS2A 1N84A 3RT6B 1JP4A 3M8UA 1FPGA 4NF0A 4C1TA 4YMAA 1B4HA 3C36A 1ZJLA 2F6PA 1G0HA 4JB7A 5AA3A 4QFKA 4OVRA 3ZKKA 5J1DA 5ICTA 2ALUA 4YB5A 1MDQA 5KDTA 4U1OA 1B3EA 4F3GA 2IA4A 1DMBA 4H5FA 3MPLA 2DWHA 4RXLA 1P1NA 1MQDA 3R7XA 2Z8DA 1PBPA 3IOTA 2F34A 1PBQA 3TTRA 4PFBA 3RLFE 4TQUQ 3GYYA 4R72A 4FIMA 3OSRA 4NG7A 3ODBA 2O51A 1FQFA 4XKNA 5BUUA 1IMAA 3FVKA 4P11A 2F7CA 2I4CA 2WYKA 3ILTB 3FV1A 4P0GA 2QVRA 3QMFA 1FTKA 4LQ5A 4DI4B 2QMWA 2V4CA 4IO6A 4LP2B 3V5AA 5I58B 1AWBA 5CMMA 3K1MA 3FJ7A 2VP1A 4NF4B 5H8HA 3BFTA 1FTAA 3PPQA 1RDXA 2OPEA 4GRKA 2O84X 2Q88A 3ROJA 4KQPA 4F3BA 4P47A 3VLWA 2I49A 2CZLA 4YU0A 1POY1 3E13X 2QJEA 2OJTA 1FPKA 1B1XA 3B6WA 5AA2B 1EYJA 4F1VA 3TQWA 4AQ4A 4G68C 4AS5A 3UK4A 4OWDA 2OK2A 4QFNA 1OVTA 4OVSA 1SBPA 5CM6A 2GQ1A 1IXHA 4OVTA 4PE3A 5I2NB 4M4GA 4NWCA 4BDNA 4EF1A 3SESA 4GWUA 3LR1A 3CHGA 1H3DA 4N81A 3LSLA 5FBPA 3RYDA 2R9JA 4HE2A 2XWKA 1B3FA 2OPDA 1A55A 5F7VA 1NUXA 3KEIA 3VVEA 3T9HB 3N6TA 1IZ1A 2CZIA 1US5A 1HSLA 4GWSA 5A5LA 1FBDA 5JK4A 5K2YA 1QKAA 3S9EA 3KC1A 4JVDA 2KR0A 1ELJA 5CBRA 3T9VA 3QUJA 4NHBA 4H6DA 2Y5LA 3HSTA 5JTYB 4I62A 5T3JA 5H8QB 2P1SA 4G8HA 3TZAA 1FW0A 1MQJA 3H6TA 3FJGA 3FJMA 1I6AA 4THIA 1GVCA 4OEVA 5I58A 3OXNA 4MIJA 1B7HA 4I9DA 4NF4A 4U4SA 4TOZA 1S7YA 3K0VA 1FCKA 4QBAA 2KLFA 3PPOA 2R6GE 1WDNA 1LAGE 4ELQA 1MXVA 1B1HA 4LA9A 5ELVA 5CI5A 1RDYA 4PFRA 1R9LA 5AA2D 2OLBA 3LBSA 2L5VA 1LEVA 2KQZA 5LOMA 1AIVA 4YKPA 2ABHA 3U72A 4F3SA 1LBZA 4N91A 3VDFA 3ISPA 1TXFA 5I2NA 2VPNA 3KBRA 4YB6A 3TCFA 1MY2A 2THIA 1DTGA 3CVGA 1A54A 3KN3A 4OVJA 3PU5A 4U2RA 3MC2A 4JWYA 3A29A 3SEYA 1NUYA 1N7XA 1MRPA 4IY5A 3ILUB 1LCFA 2XXKA 4KCCA 4X48A 1BIYA 1DCUA 2NOOA 4NGUA 2DXRA 5TU0A 4H8IA 4HCYA 4MLVA 3CI8A 3Q29A 2RCBA 3T66A 5JTYA 5FHMA 3H03A 1OLAA 3B6QA 4FEBA 1JW1A 1B0LA 4N6PA 4GX3A 3CFXA 1Y20A 1IMEA 4FEDA 2AL4A 1POTA 4YMBA 3CR9A 4KYDA 3T93B 1MXUA 4POXA 5DTBA 2V3UA 4EQ9A 2F3BA 2I4BA 1MXWA 2HFBA 4RPOA 2ZNTA 1Y3NA 1N0TA 1NNKA 1CNQA 1YAEA 1H44A 1M5FA 4OANA 3KSJA 4XF5A 3R26A 2XXPA 5ICQA 1VE4A 2ONKE 3CSGA 1PB7A 4GWYA 3FVNA 3IO4A 2XX7A 4U21A 5TP9B 3MVZA 1IITA 1LAXA 1FPLA 3IORA 1INPA 4ESXA 1NNFA 1NL5A 4RA1A 3MVXA 2CEXA 2QVVA 1B0HA 4PQJA 2QMXA 5L8DA 4N4UA 4X04A 4P56A 4H8JA 2F35A 4BDRA 3U1OA 3E9XA 4UACA 3S4UA 4BDMA 1IUDA 2PT2A 4ZE9A 3G3JA 2XXVA 2FBPA 4MCOA 4NQ8A 3H6UA 4ZEBA 4EUOA 4PE5B 4GWZA 4OERA 1BK4A 4Q8RA 1IMBA 4GD5A 2FVZA 2XX9A 2VT5A 4GXAA 3BIGA 4DDDA 1IMCA 4O3CA 4PAKA 2DE4A 3W9WA 1CE2A 3USDA 3TTNA 2NVUB 4NEDA 1LB9A 1JVXA 4OFLA 3I5OA 4R6YA 3D4GA 4RNSA 4XKQA 1P1OA 3K00A 2XXHA 2ZYNA 2RKMA 4N6DA 2F7AA 2Y5KA 2GRVA 4LZ7A 3C33A 1VR5A 2XXUA 3UGWA 1FBEA 4JBZA 2M8CA 5ET6A 3UP9A 3LUZA 3K2DA 2OWTA 3LSWA 2ZMBA 4H1XA 3UA8A 1SQYA 3WAEA 2P3NA 1EU8A 3FUZA 4JDFA 3HN0A 1K9ZA 2QL3A 5TP9A 1O64A 4Q0CA 3G3FA 3MVWA 1VFDA 2QRYA 4OVQA 2QS1A 3EHUA 3PUVE 1RKMA 2VPOA 3A09A 2IEEA 1DK4A 5L9MA 4DXBA 2I48A 3OELA 3CG3A 4LATA 3QK6A 1MG1A 3KOSA 4F19A 2O1MA 1A8EA 1SD3A 3SEUA 1IMFA 1QUIA 2DQVA 1YTVA 4G8MA 2XXYA 4OFJA 3BKIB 4LVQA 2B4LA 4PF8A 2FNCA 3MPKA 2XWVA 3C32A 5EYGA 4JVIA 1FPJA 1QW0A 1LFGA 2OCUA 1FPBA 1O63A 1LCTA 2FYIA 2O7UA 2PBWA 1AOVA 1FQBA 3N6UA 3PPRA 4R73A 3K6UA 1NMUA 4MJOA 3BIHA 2XD3A 1MQHA 4I40A 1B7ZA 5KZTA 1BLFA 3GXAA 1MM6A 2NWJA 5IZZA 1AL3A 3TTMA 2H5YA 1I69A 2DVCA 2Z8EA 3PUZE 1S9TA 2QVUA 3ZKLA 4NF5B 4QSCA 3V89B 1FTOA 4F29A 5ISUA 4KFQA 1A7LA 1TFDA 3EHTA 3PUYE 4NF6A 3TCGA 1USYH 1DPPA 2RINA 2AL5A 1ZIUA 1LAHE 3I6VA 3B7DA 4KR5A 4R2BA 1AMFA 2UVHA 4YKIA 3SDFA 3PD9A 1DTZA 1ZBMA 4R9FA 3KSXA 5I2KB 1N04A 5DVFA 1Z7ME 3TAJA 4ELOA 1JEVA 1B2HA 3MP1A 3OSQA 4ZEKA 1ZTYA 1URDA 3RPLA 1B40A 3IOVA 3HPIA 1FPFA 4PFUA 1KA0A 3SEWA 2ESNA 1MPBA 3OO8A 2B4MA 2RCAA 4C0RA 1LFIA 4NAPA 4YICA 4PFWA 2ZXTA 3EKIA 4IY6A 5DEXA 2UVJA 4MX6A 2DWAA 4N8YA 5ITOA 1I6QA 1Q1KA 4EDPA 1O7TA 3IB0A 4PTKA 1MH3A 3K4UA 1XC1A 4GWXA 2E0SA 2OWSA 5M2VA 4FECA 5IAIA 2Z22A 1B5HA 2RF1A 5L9OA 1FQDA 3BBRA 1SW4A 3MYUA 4XIGQ 3JYRA 2WBBA 4XKPA 4LONB 5CBSA 3PD8A 3M3FA 2G93A 1FBCA 4L17A 4ZE8A 1ZU0A 2MKZA 4GX6A 5EYFA 4WXJA 2ZNUA 1PEBA 2CMOA 1IXCA 4NN3A 1NV0A 3ZSFA 5CC2A 4ZZAA 2V3TA 4NF5A 5DW8A 2VGQA 2UVIA 2REGA 1B46A 5EYHA 1LBXA 3RTFB 4KCDA 3FXUA 1IMDA 1FBFA 1XVXA 1IEJA 3CRBA 2DWJA 4MH5A 4FBPA 3SERA 4ZEFA 4QFOA 2XXIA 1B3GA 1PB8A 5IZ1A 5B7DA 4PGNA 4O8MA 4C1UA 1OIBA 1MY0A 5FTHA 4I1DA 4OETA 1FBPA 5I2KA 4OHNA 1YYZA 4PGPA 3A3CA 4R75A 4JWOA 3Q25A 4U4XA 1S50A 2HHMA 5EQ7A 3S9LC 2NUVA 3FVGA 4F39A 1G0IA 2HQ0A 4BDQA 3U92A 4EXLA 1F9BA 4N13A 2R8TA 2A5TB 1FTMA 5H8FB 2ZYKA 3IJOB 1Y4TA 2WEFA 3HFUA 4GL0A 3G7WA 4QSEA 3N26A 5CRYA 4MMPA 2F6GA 3O9PA 3FXQA 4MNPA 3PMVA 1SYHA 2Q2CA 4UABA 2CEYA 4ZECA 1K9YA 5J16A 3O66A 4TLLB 5CMBA 4HXVA 2I3VA 3PMWA 1YCJA 4QHQA 1HSJA 2CZKA 2AYSA 1B58A 1SPIA 3VVFA 1B5IA 2O7IA 1XS5A 3K02A 1D9YA 2Q9TA 1P1QA 2HZKA 1B52A 3MQ9A 3LUYA 3ONMA 4WEPA 3T22A 4X1DA 5I59B 2XXRA 2CZHA 1LB8A 2UXAA 4X1BA 3K6XA 1EYIA 2FIXA 3U94A 1IXIA 3GBBA 5AA4B 3IAZA 2Q2AA 1NUZA 4OEUA 3ECRA 1XHYA 4PBHA 4Q5TA 1MY1A 5HBCA 1B32A 4ONYA 1M5BA 4IB2A 3PV0E 4LN5A 4R6HA 3S9MC 1EYKA 1MXZA 1JVYA 4GXSB 4YKKA 3PTYA 2OZZA 1YXIA 3HV1A 4ZS9A 5EHMA 2Y7IA 3SKPA 1UTBB 2ZZVA 4N17A 4R9GA 4H46A 4P0IA 2PFZA 1B6HA 2QS3A 4I3EA 4GWWA 2D21A 2ANJA 1MXXA 3FIRA 2H98A 2DSFA 2GH9A 2VD3A 1SDXA 4PETA 3HCQA 1URGA 4KYEA 5ET7A 3PMXA 3O2AA 3BFUA 2VD2A 3HO7A 4EXKA 1FTJA 1FQCA 1FPIA 4ECFA 3E4RA 4NWDA 5EQ8A 4BLAA 2A5TA 3O6IA 5H8FA 2H4IA 2Y7WA 4ZDMA 4JSDA 3TKDA 5KCJB 2X26A 1CB6A 3DLNA 5IM2A 1NNTA 3PUWE 2O6AA 5FTIA 3V83A 2V93A 3AXFA 2QPQA 4O94A 3KBZA 1LBCA 3FVOA 4U1ZA 5JEIA 5ET5A 1FJ9A 1JEUA 4PDDA 1FBGA 4RYAA 4RK9A 1A99A 1FPDA 1JETA 4GF8A 2V25A 2O68A 3RT8A 3LSFB 1NNPA 1UTHB 4PFYA 3O29A 3PGFA 3EN3A 1DSNA 4QXDA 3JZJA 5I84A 4I3YA 1SW1A 5I59A 1BTJA 4YKJA 1KZ8A 2GFEA 5DVIA 4O7MA 3NOHA 1SI0A 5AA4A 1A40A 1MPCA 3RGYA 3L6HA 3U93A 4AB6A 3F11A 1JW4A 1DOTA 2PVUA 1GV8A 5HPQA 3FD3A 4OA4A 4RK2A 3QIMA 1WODA 1Y9UA 1KA1A 1UTBA 1B3HA 1RDZA 2FHYA 5LTCA 4AS4A 4O7IA 2PMSA 3TODA 2LAOA 3MZBA 1Y3PA 1NV2A 1QUJA 3KJ7A 4GFRA 1TT1A 1B05A 4DI3D 3SETA 1PC3A 3HHGA 4OFOA 2W7YA 1NV6A 5I5PA 4N15A 1SW5A 3MWBA 4HW8A 5LDZA 2HAUA 2ONRA 1SVXB 1A8FA 3FV2A 1D9QA 2G29A 3C31A 5KCJA 3S2VA 3U65A 1Y4CA 4MNCA 1LSTA 1AH5A 3H4ZA 1IIWA 4IO3A 1IQ7A 4G4PA 4DE8A 5CMKA 5ITPA 2Q8JA 3PPPA 4LUBA 3SZPA 4Z7EA 4NTLA 1EZ9A 4OQOA 4HE1A 3TDJA 4NF6B 4ZZEA 2Y7RA 1BP5A 2F36A 1I6BA 1ZLQA 3T1BA 3MP8A 3TCHA 3RNNA 1ANFA 4P9KA 1UTHA 4POWA 3C9HA 1NV4A 4BDOA 3H6VA 1M5DA 1NV7A 4ESWA 3TEPA 1FQEA 1ATGA 3TTKA 1KWHA 2ZYMA 4HS7A 1NFTA 4RJZA 4FE8A 1FPEA 3MSTA 1XVYA 3FGSA 3RPLB 3FBPA 2QFLA 3KFMA 1USYE 2H25A 4KI0E 4R2FA 2I0CA 4LQ2A 3RN8A 5ET8A 1B7UA 3KJTA 3B6TA 4XXUA 4XTCQ 5DEXB 1MQGA 5IZ3A 4MHFA 4MBPA 2DS9A 4F1UA 1GGGA 4OZ9A 2Q8MA 3I3VA 4G77A 1Y1ZA 2NXOA 4GLIA 4TLMB 3CSBA 2XHDA 1LBBA 1N3XA 1N3WA 2RC9A 3VE1B 3GZGA 3TUSA 3M3LA 3IL1B 2HAVA 4G61A 1MQIA 4DIGA 4F1YA 4FATA 1R9QA 1FJ6A 5K2XA 1SYIA 2I58A 4OESA 4H45A 1TWYA 1VFEA 3C4MA 4OVPA 2UYEA 1NH7A 1XT8A 4EF2A 4PAFA 1RYXA 1MS7A 3CFLA 2P3VA 1PB9A 1OQGA 4GVOA 3A3UA 1D9VA 3IOUA 3IX1A 3LC8A 1GR2A 4DCXA 2HEUA 1QVSA 4N07A 4ELRA 5I57B 4P1LA 3VXBA 3IB1A 4GOTA 1QUKA 2X7QA 4KPTA 1Y1MA 2D5WA 1LLSA 3W15C 1FTLA 4OMBA 2DE3A 2O69A 3DP8A 3MAMA 3H3GA 4DXCA 4IR8A 3KN7A 4H65A 5IKBA 3GBAA 4PCDA 4E0WA 4ISUA 1FSAA 1Z7NE 2PFYA 1NH8A 3G3KA 1WVJA 4QSDA 1RYOA 1Y3QA 1OVBA 2ZZXA 1QKBA 3B50A 1DPEA 2D3IA 3CIJA 3O28A 2XXTA 4NX1A 3O97A 1NKXA 4YAHX 1L5TA 2Y7KA 3KG2A 4JXIA 2I6EA 1N76A 4R74A 3IFAA 4KHZE 3T0JA 1UQWA 5FHNA 3MUQA 2OBGA 4F18A 2H9BA 2HCAA 3SEXA 4ND9A 4AB5A 3IK6B 2I3WA 2XD2A 4IO4A 3T9XB 1JNFA 3VVDA 3EQ1A 4QFLA 2GHBA 3L6GA 1NUWA 2PCRA 4ZEIA 3D1RA 4YZZA 3DM0A 4PP0A 1P1UA 4PC9A 3OO7A 4GX4A 5H8SA 3E79A 4MEVA 2BJIA 4DCYA 3TELA 4OTEA 1NV3A 3RTWB 2GHAA 2H99A 3MP6A 1D3KA 5I57A 3FZVA 3H06B 1NV1A 4N6KA 2YLNA 3SEVA 1GTKA 2B65A 2V3QA 4PAIA 2XXXA 3CG1A 4IO7A 2FA7A 3MBPA 1EZPA 1OLCA 1LBWA 5ESYA 3MZ1A 2JJKA 5B70A 1SI1A 3OO9A 3VXCA 1TFAA 4MAGA 1P1WA 3H6WA 5TPAB 4LZ8A 3OO6A 1MH4A 4JSOA 4KD5A 3E78A 1SW2A 4R6KA 1YPNA 3IB2A 2XXQA 5I56B 3M3KA 2HXRA 3LV0A 4UA8A 3THIA 1M5EA 2DXYA 3N5LA 2HPGA 3Q27A 5I3SA 2F7BA 5AE4A 2ZZWA 5AA2A 3D4CA 5AA1A 1OQHA 1Q35A 2BJJX 4Z0IA 2Q74A 3IO6A 4FAJA 3RY3A 2WX9A 2DP8A 3FASA 2OWZA 4F3PA 4I8CA 2QSXA 4QF9A 4G68B 5F24A 3RPWA 4IO2A 2X7PA 5EQ9A 2QS4A 4PFTA 1US4A 5BWJA 2A5SA 3KC0A 4NF8B 2P0SA 1PDAA 4K3FA 3U8QA 3MW0A 3HHFA 2PX1A 4MFIA 1URSA 4GBWA 4JWXA 4MNIA 2HXWA 3FXBA 4GQOA 3QUFA 1QULA 2AIXA 2B3FA 2XA5A 4WEDA 2OX3A 5IGAA 2E1SA 2F97A 2F3DA 3VLVA 3G3IA 4BDLA 1QGXA 2P2AA 4HE0A 1XOCA 4DZ1A 4U23A 2Y7PA 3O6GA 3IOWA 4OYVA 5H8NB 5H8QA 4ZEDA 3RQTA 3PUXE 2DOJA 1R1NA 1B9JA 4JVCA 4LZ5A 3G3HA 4H0WA 5TPAA 4PF6A 3ZS6A 2UVGA 5DT6A 2VOZA 4M1VA 2Z8FA 4G8NA 3G3GA 3QAXA 3DELB 3C34A 5I56A 4O3AA 2F8DA 1B5JA 2XWOA 1B4ZA 2B3BA 1J1NA 4F2OA 4H67A 2F5XA 2XX8A 4FJPA 2WBDA 3FATA 2XWIA 4GBVA 2ZNSA 4HCWA 1MDP1 3MZ9A 3K1PA 1R6ZA 3LSXA 2UYFA 5FHOA 4YB7A 3TQLA 1VDWA 1QJMA 3V8XB 1ZMGA 4P3LA 3Q28A 1OMPA 3EPEA 4QRZA 4G68A 5L9SA 3OMBA 1B3LA 1UIUA 3MJNA 5I7IA 2V84A 4PFIA 5EQAA 3KN8A 2YPNA 3K01A 4PDHA 4IO5A 3GLBA 1NV5A 1HSEA 1LAFE 5CMCA 4PBQA 4DLDA 1H45A 4ELPA 1P99A 4QFPA 3QXMA 4NF8A 4EQBA 1JW5A 5DYHA 3QYTA 1BKAA 1MY3A 1MPDA 2F78A 1II5A 3O6HA 3IFCA 3UIFA 4F22A 5IZ3B 2ZYOA 4MF3A 3K6VA 4F2QA 1EZOA 2YJPA 5EHSA 4H5GA 1N7WA 2DWIA 1LBVA 3DP4A 2R71A 1MY4A 2WYPA 4FORA 4NE4A 1Q9DA 3VFJA 1YZ0A 3B8BA 1LFHA 2DE2A 3KOTA 1FRPA 1FBHA 3H7MA 4F31B 2PT1A 4IGTA 4P8BA
chains in the Genus database with same CATH topology
5DW8A 4HCYA 4H45A 5EYHA 1LBXA 1IMDA 4OVPA 1FBFA 4PAFA 4FBPA 5IZ1A 3W9VA 4PGNA 4O8MA 2FIEA 2P3VA 1FBPA 1YYZA 4PGPA 1NI9A 4GX3A 4XFEA 1LBYA 1IMEA 2HHMA 5EQ7A 4P1LA 4X8RA 2HZLA 2F3BA 1G0IA 2DVZA 2DE3A 2R8TA 1CNQA 2WEFA 3HFUA 4OANA 4KXPA 4XF5A 4N8GA 4IR8A 4XEQA 4PCDA 4MMPA 1FSAA 4MNPA 2PFYA 4UABA 4GWYA 2CEYA 1K9YA 5J16A 1DBZA 4HXVA 1XI6A 2ZZXA 3B50A 1FPLA 2DDKA 4NX1A 1INPA 2CZKA 2CEXA 2QVVA 1SPIA 4N4UA 4X04A 4P56A 2Q9TA 2HZKA 3IFAA 2CZHA 3T0JA 4P1EA 4X9TA 4F18A 1EYIA 2FIXA 2FBPA 1NUZA 4MCOA 4PBHA 1NUWA 4LN5A 2PCRA 4NQ8A 3D1RA 1EYKA 4YZZA 4GWZA 1JP4A 4PC9A 1BK4A 3PTYA 1FPGA 4NF0A 1IMBA 4GX4A 1YXIA 2FVZA 3E79A 1G0HA 4MEVA 2ZZVA 4N17A 2BJIA 4H46A 4OVRA 2PFZA 2VT5A 4I3EA 5J1DA 4GWWA 3BIGA 1IMCA 1NV3A 4PAKA 2DE4A 3W9WA 1NV1A 4PETA 4N6KA 5ET7A 4PFBA 2V3QA 3GYYA 4PAIA 4NG7A 1FPIA 5EQ8A 4N6DA 1IMAA 2Y5KA 2WYKA 5IM2A 1LBWA 5ESYA 1FBEA 2JJKA 5ET6A 3LUZA 2QVRA 3QMFA 4MAGA 2P3NA 3E78A 2QPQA 4DI4B 1K9ZA 2V4CA 4O94A 3KBZA 2HXRA 3LV0A 5ET5A 4PDDA 1FJ9A 1AWBA 1FBGA 4OVQA 1FPDA 2HPGA 2VPOA 1FTAA 1RDXA 1DK4A 5I3SA 4QXDA 2ZZWA 3ROJA 4I3YA 4P47A 1KZ8A 4F19A 4O7MA 2Q74A 3NOHA 2WX9A 2OWZA 1FPKA 1IMFA 1EYJA 4F1VA 5F24A 4AS5A 2B4LA 4PF8A 5EQ9A 2XWVA 4OVSA 5CM6A 2GQ1A 3KC0A 5EYGA 4JVIA 1FPJA 4OA4A 4OVTA 4PE3A 1KA1A 1RDZA 1FPBA 2FHYA 4GWUA 5LTCA 3CHGA 4N81A 4AS4A 4GBWA 4O7IA 5FBPA 4MNIA 3FXBA 3RYDA 4HE2A 2XWKA 1NV2A 2XA5A 2OX3A 4MJOA 5IGAA 1NUXA 3BIHA 4DI3D 2F3DA 4I40A 2CZIA 1NV6A 5IZZA 4GWSA 1QGXA 1FBDA 5A5LA 4N15A 5I5PA 5JK4A 4HE0A 5LDZA 2QVUA 3KC1A 4JVDA 1D9QA 2KR0A 3U65A 4MNCA 4JVCA 4NHBA 2Y5LA 4PF6A 5T3JA 3SZPA 4M1VA 4HE1A 2XWOA 4MIJA 2F5XA 3T1BA 4P9KA 4QBAA 2WBDA 1NV4A 2XWIA 4GBVA 1NV7A 3RPLA 4HCWA 1FPFA 1KA0A 1RDYA 4PFRA 2B4MA 1FPEA 3MSTA 4NAPA 1VDWA 3RPLB 3FBPA 4YICA 2QFLA 4P3LA 3EKIA 4MX6A 5I7IA 4PFIA 2L5VA 1LEVA 5ET8A 5EQAA 2KQZA 4N8YA 4PDHA 1NV5A 1LBZA 4PTKA 4N91A 5IZ3A 3ISPA 4MHFA 4PBQA 4GWXA 4F1UA 2Q8MA 2VPNA 3IFCA 5IZ3B 3MYUA 2WBBA 3A29A 1LBVA 1FBCA 2WYPA 1NUYA 4G61A 2MKZA 4GX6A 1Q9DA 1YZ0A 3B8BA 2XXKA 2DE2A 1FRPA 1DCUA 1FBHA 4NN3A 1NV0A 1FJ6A 4NGUA 4P8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWB A;  1FBG A;  5DW8 A;  2Y5L A;  4H45 A;  1FPD A;  5T3J A;  5EYH A;  1LBX A;  3IFA A;  2CZH A;  3T0J A;  1IMD A;  1FTA A;  1RDX A;  4HE1 A;  1DK4 A;  1FBF A;  5I3S A;  1EYI A;  2FIX A;  4QXD A;  2FBP A;  1NUZ A;  4FBP A;  3ROJ A;  4I3Y A;  5IZ1 A;  2FIE A;  2P3V A;  1KZ8 A;  2WBD A;  1NUW A;  2Q74 A;  1NV4 A;  2PCR A;  4GBV A;  3D1R A;  1EYK A;  2OWZ A;  1FPK A;  1NV7 A;  1FBP A;  3RPL A;  1YYZ A;  1IMF A;  1JP4 A;  4GWZ A;  1BK4 A;  1NI9 A;  4GX3 A;  1EYJ A;  1FPF A;  1FPG A;  1LBY A;  1IMB A;  4GX4 A;  5F24 A;  1IME A;  1YXI A;  1KA0 A;  2FVZ A;  1G0H A;  2HHM A;  5EQ7 A;  1RDY A;  4AS5 A;  2BJI A;  1FPE A;  4H46 A;  5EQ9 A;  2VT5 A;  1VDW A;  4I3E A;  3FBP A;  3RPL B;  2QFL A;  4GWW A;  3BIG A;  2F3B A;  2GQ1 A;  3KC0 A;  5EYG A;  1FPJ A;  1IMC A;  1G0I A;  1NV3 A;  1KA1 A;  1LEV A;  5ET8 A;  5EQA A;  1RDZ A;  2R8T A;  1FPB A;  2FHY A;  1NV1 A;  4GWU A;  1CNQ A;  4N81 A;  4AS4 A;  1NV5 A;  4GBW A;  4O7I A;  5ET7 A;  1LBZ A;  4PTK A;  5FBP A;  3RYD A;  2WEF A;  5IZ3 A;  4HE2 A;  1NV2 A;  4KXP A;  4GWX A;  4IR8 A;  1FPI A;  2Q8M A;  5EQ8 A;  2OX3 A;  4MJO A;  1NUX A;  3BIH A;  1FSA A;  1IMA A;  2Y5K A;  3IFC A;  2F3D A;  5IZ3 B;  4I40 A;  2WBB A;  2CZI A;  1NV6 A;  4GWY A;  1LBW A;  5ESY A;  1FBE A;  4GWS A;  1QGX A;  1FBD A;  5A5L A;  1K9Y A;  4HE0 A;  2JJK A;  5J16 A;  5ET6 A;  3A29 A;  1DBZ A;  1LBV A;  3LUZ A;  4HXV A;  1FBC A;  1XI6 A;  5LDZ A;  2QVR A;  3QMF A;  1NUY A;  2QVU A;  3KC1 A;  4G61 A;  1D9Q A;  1FPL A;  4GX6 A;  2DDK A;  2P3N A;  1Q9D A;  1INP A;  2CZK A;  1YZ0 A;  1K9Z A;  3B8B A;  3KBZ A;  2QVV A;  1FRP A;  1SPI A;  1DCU A;  1FBH A;  1NV0 A;  1FJ6 A;  3LV0 A;  5ET5 A;  1FJ9 A; 
#chains in the Genus database with same CATH topology
 5A5X B;  3TMG A;  3UOR A;  3S9N C;  3EF7 A;  5H8N A;  1H76 A;  4EQ7 A;  2I0B A;  3FXR A;  3K6W A;  4GIZ A;  5F1Q A;  2RC7 A;  2VHA A;  3OEN A;  4HTG A;  3W9V A;  1LGB C;  3K1N A;  2FIE A;  2Z23 A;  3CFZ A;  1ZKB A;  3UN6 A;  1VSO A;  3E3K A;  3IR1 A;  5KDT B;  1NI9 A;  3QSL A;  4XFE A;  5HM4 B;  1LBY A;  4GWO A;  4MLQ A;  4U22 A;  3T96 B;  3R6U A;  3EHS A;  1H43 A;  2RC8 A;  3RUM A;  4X8R A;  1EH3 A;  2HZL A;  3N94 A;  3WAF A;  3TPA A;  3TFL A;  1JQF A;  1MM7 A;  1B51 A;  2DVZ A;  4XKR A;  1MXY A;  4IGR A;  1T0K A;  4G2Z A;  3T9U A;  4WKM A;  3DP6 A;  4KXP A;  4N8G A;  4XEQ A;  2Q89 A;  3OOA A;  3TYH A;  3TTL A;  4RY1 A;  1D4N A;  3JV9 A;  2XXW A;  3P7I A;  2WKY A;  1DBZ A;  4O3B A;  1FQA A;  1XI6 A;  4OEN A;  4OXV A;  2DDK A;  2ONS A;  5DVJ A;  3OEM A;  4KYS A;  2Y84 A;  5H8H B;  4E0X A;  1M5C A;  2O1L A;  3IJX B;  3VV5 A;  1UIV A;  2REJ A;  4NMY A;  3KGC A;  3VLU A;  3MVY A;  4P1E A;  3OD7 A;  4RPN A;  3OEK A;  4X9T A;  3C35 A;  5A5X A;  1IXG A;  4GL8 A;  3KZG A;  2PYY A;  2DYX A;  3PPN A;  4DXU A;  4Q30 B;  3Q26 A;  2QS2 A;  1N84 A;  3RT6 B;  1JP4 A;  3M8U A;  1FPG A;  4NF0 A;  4C1T A;  4YMA A;  1B4H A;  3C36 A;  1ZJL A;  2F6P A;  1G0H A;  4JB7 A;  5AA3 A;  4QFK A;  4OVR A;  3ZKK A;  5J1D A;  5ICT A;  2ALU A;  4YB5 A;  1MDQ A;  5KDT A;  4U1O A;  1B3E A;  4F3G A;  2IA4 A;  1DMB A;  4H5F A;  3MPL A;  2DWH A;  4RXL A;  1P1N A;  1MQD A;  3R7X A;  2Z8D A;  1PBP A;  3IOT A;  2F34 A;  1PBQ A;  3TTR A;  4PFB A;  3RLF E;  4TQU Q;  3GYY A;  4R72 A;  4FIM A;  3OSR A;  4NG7 A;  3ODB A;  2O51 A;  1FQF A;  4XKN A;  5BUU A;  1IMA A;  3FVK A;  4P11 A;  2F7C A;  2I4C A;  2WYK A;  3ILT B;  3FV1 A;  4P0G A;  2QVR A;  3QMF A;  1FTK A;  4LQ5 A;  4DI4 B;  2QMW A;  2V4C A;  4IO6 A;  4LP2 B;  3V5A A;  5I58 B;  1AWB A;  5CMM A;  3K1M A;  3FJ7 A;  2VP1 A;  4NF4 B;  5H8H A;  3BFT A;  1FTA A;  3PPQ A;  1RDX A;  2OPE A;  4GRK A;  2O84 X;  2Q88 A;  3ROJ A;  4KQP A;  4F3B A;  4P47 A;  3VLW A;  2I49 A;  2CZL A;  4YU0 A;  1POY 1;  3E13 X;  2QJE A;  2OJT A;  1FPK A;  1B1X A;  3B6W A;  5AA2 B;  1EYJ A;  4F1V A;  3TQW A;  4AQ4 A;  4G68 C;  4AS5 A;  3UK4 A;  4OWD A;  2OK2 A;  4QFN A;  1OVT A;  4OVS A;  1SBP A;  5CM6 A;  2GQ1 A;  1IXH A;  4OVT A;  4PE3 A;  5I2N B;  4M4G A;  4NWC A;  4BDN A;  4EF1 A;  3SES A;  4GWU A;  3LR1 A;  3CHG A;  1H3D A;  4N81 A;  3LSL A;  5FBP A;  3RYD A;  2R9J A;  4HE2 A;  2XWK A;  1B3F A;  2OPD A;  1A55 A;  5F7V A;  1NUX A;  3KEI A;  3VVE A;  3T9H B;  3N6T A;  1IZ1 A;  2CZI A;  1US5 A;  1HSL A;  4GWS A;  5A5L A;  1FBD A;  5JK4 A;  5K2Y A;  1QKA A;  3S9E A;  3KC1 A;  4JVD A;  2KR0 A;  1ELJ A;  5CBR A;  3T9V A;  3QUJ A;  4NHB A;  4H6D A;  2Y5L A;  3HST A;  5JTY B;  4I62 A;  5T3J A;  5H8Q B;  2P1S A;  4G8H A;  3TZA A;  1FW0 A;  1MQJ A;  3H6T A;  3FJG A;  3FJM A;  1I6A A;  4THI A;  1GVC A;  4OEV A;  5I58 A;  3OXN A;  4MIJ A;  1B7H A;  4I9D A;  4NF4 A;  4U4S A;  4TOZ A;  1S7Y A;  3K0V A;  1FCK A;  4QBA A;  2KLF A;  3PPO A;  2R6G E;  1WDN A;  1LAG E;  4ELQ A;  1MXV A;  1B1H A;  4LA9 A;  5ELV A;  5CI5 A;  1RDY A;  4PFR A;  1R9L A;  5AA2 D;  2OLB A;  3LBS A;  2L5V A;  1LEV A;  2KQZ A;  5LOM A;  1AIV A;  4YKP A;  2ABH A;  3U72 A;  4F3S A;  1LBZ A;  4N91 A;  3VDF A;  3ISP A;  1TXF A;  5I2N A;  2VPN A;  3KBR A;  4YB6 A;  3TCF A;  1MY2 A;  2THI A;  1DTG A;  3CVG A;  1A54 A;  3KN3 A;  4OVJ A;  3PU5 A;  4U2R A;  3MC2 A;  4JWY A;  3A29 A;  3SEY A;  1NUY A;  1N7X A;  1MRP A;  4IY5 A;  3ILU B;  1LCF A;  2XXK A;  4KCC A;  4X48 A;  1BIY A;  1DCU A;  2NOO A;  4NGU A;  2DXR A;  5TU0 A;  4H8I A;  4HCY A;  4MLV A;  3CI8 A;  3Q29 A;  2RCB A;  3T66 A;  5JTY A;  5FHM A;  3H03 A;  1OLA A;  3B6Q A;  4FEB A;  1JW1 A;  1B0L A;  4N6P A;  4GX3 A;  3CFX A;  1Y20 A;  1IME A;  4FED A;  2AL4 A;  1POT A;  4YMB A;  3CR9 A;  4KYD A;  3T93 B;  1MXU A;  4POX A;  5DTB A;  2V3U A;  4EQ9 A;  2F3B A;  2I4B A;  1MXW A;  2HFB A;  4RPO A;  2ZNT A;  1Y3N A;  1N0T A;  1NNK A;  1CNQ A;  1YAE A;  1H44 A;  1M5F A;  4OAN A;  3KSJ A;  4XF5 A;  3R26 A;  2XXP A;  5ICQ A;  1VE4 A;  2ONK E;  3CSG A;  1PB7 A;  4GWY A;  3FVN A;  3IO4 A;  2XX7 A;  4U21 A;  5TP9 B;  3MVZ A;  1IIT A;  1LAX A;  1FPL A;  3IOR A;  1INP A;  4ESX A;  1NNF A;  1NL5 A;  4RA1 A;  3MVX A;  2CEX A;  2QVV A;  1B0H A;  4PQJ A;  2QMX A;  5L8D A;  4N4U A;  4X04 A;  4P56 A;  4H8J A;  2F35 A;  4BDR A;  3U1O A;  3E9X A;  4UAC A;  3S4U A;  4BDM A;  1IUD A;  2PT2 A;  4ZE9 A;  3G3J A;  2XXV A;  2FBP A;  4MCO A;  4NQ8 A;  3H6U A;  4ZEB A;  4EUO A;  4PE5 B;  4GWZ A;  4OER A;  1BK4 A;  4Q8R A;  1IMB A;  4GD5 A;  2FVZ A;  2XX9 A;  2VT5 A;  4GXA A;  3BIG A;  4DDD A;  1IMC A;  4O3C A;  4PAK A;  2DE4 A;  3W9W A;  1CE2 A;  3USD A;  3TTN A;  2NVU B;  4NED A;  1LB9 A;  1JVX A;  4OFL A;  3I5O A;  4R6Y A;  3D4G A;  4RNS A;  4XKQ A;  1P1O A;  3K00 A;  2XXH A;  2ZYN A;  2RKM A;  4N6D A;  2F7A A;  2Y5K A;  2GRV A;  4LZ7 A;  3C33 A;  1VR5 A;  2XXU A;  3UGW A;  1FBE A;  4JBZ A;  2M8C A;  5ET6 A;  3UP9 A;  3LUZ A;  3K2D A;  2OWT A;  3LSW A;  2ZMB A;  4H1X A;  3UA8 A;  1SQY A;  3WAE A;  2P3N A;  1EU8 A;  3FUZ A;  4JDF A;  3HN0 A;  1K9Z A;  2QL3 A;  5TP9 A;  1O64 A;  4Q0C A;  3G3F A;  3MVW A;  1VFD A;  2QRY A;  4OVQ A;  2QS1 A;  3EHU A;  3PUV E;  1RKM A;  2VPO A;  3A09 A;  2IEE A;  1DK4 A;  5L9M A;  4DXB A;  2I48 A;  3OEL A;  3CG3 A;  4LAT A;  3QK6 A;  1MG1 A;  3KOS A;  4F19 A;  2O1M A;  1A8E A;  1SD3 A;  3SEU A;  1IMF A;  1QUI A;  2DQV A;  1YTV A;  4G8M A;  2XXY A;  4OFJ A;  3BKI B;  4LVQ A;  2B4L A;  4PF8 A;  2FNC A;  3MPK A;  2XWV A;  3C32 A;  5EYG A;  4JVI A;  1FPJ A;  1QW0 A;  1LFG A;  2OCU A;  1FPB A;  1O63 A;  1LCT A;  2FYI A;  2O7U A;  2PBW A;  1AOV A;  1FQB A;  3N6U A;  3PPR A;  4R73 A;  3K6U A;  1NMU A;  4MJO A;  3BIH A;  2XD3 A;  1MQH A;  4I40 A;  1B7Z A;  5KZT A;  1BLF A;  3GXA A;  1MM6 A;  2NWJ A;  5IZZ A;  1AL3 A;  3TTM A;  2H5Y A;  1I69 A;  2DVC A;  2Z8E A;  3PUZ E;  1S9T A;  2QVU A;  3ZKL A;  4NF5 B;  4QSC A;  3V89 B;  1FTO A;  4F29 A;  5ISU A;  4KFQ A;  1A7L A;  1TFD A;  3EHT A;  3PUY E;  4NF6 A;  3TCG A;  1USY H;  1DPP A;  2RIN A;  2AL5 A;  1ZIU A;  1LAH E;  3I6V A;  3B7D A;  4KR5 A;  4R2B A;  1AMF A;  2UVH A;  4YKI A;  3SDF A;  3PD9 A;  1DTZ A;  1ZBM A;  4R9F A;  3KSX A;  5I2K B;  1N04 A;  5DVF A;  1Z7M E;  3TAJ A;  4ELO A;  1JEV A;  1B2H A;  3MP1 A;  3OSQ A;  4ZEK A;  1ZTY A;  1URD A;  3RPL A;  1B40 A;  3IOV A;  3HPI A;  1FPF A;  4PFU A;  1KA0 A;  3SEW A;  2ESN A;  1MPB A;  3OO8 A;  2B4M A;  2RCA A;  4C0R A;  1LFI A;  4NAP A;  4YIC A;  4PFW A;  2ZXT A;  3EKI A;  4IY6 A;  5DEX A;  2UVJ A;  4MX6 A;  2DWA A;  4N8Y A;  5ITO A;  1I6Q A;  1Q1K A;  4EDP A;  1O7T A;  3IB0 A;  4PTK A;  1MH3 A;  3K4U A;  1XC1 A;  4GWX A;  2E0S A;  2OWS A;  5M2V A;  4FEC A;  5IAI A;  2Z22 A;  1B5H A;  2RF1 A;  5L9O A;  1FQD A;  3BBR A;  1SW4 A;  3MYU A;  4XIG Q;  3JYR A;  2WBB A;  4XKP A;  4LON B;  5CBS A;  3PD8 A;  3M3F A;  2G93 A;  1FBC A;  4L17 A;  4ZE8 A;  1ZU0 A;  2MKZ A;  4GX6 A;  5EYF A;  4WXJ A;  2ZNU A;  1PEB A;  2CMO A;  1IXC A;  4NN3 A;  1NV0 A;  3ZSF A;  5CC2 A;  4ZZA A;  2V3T A;  4NF5 A;  5DW8 A;  2VGQ A;  2UVI A;  2REG A;  1B46 A;  5EYH A;  1LBX A;  3RTF B;  4KCD A;  3FXU A;  1IMD A;  1FBF A;  1XVX A;  1IEJ A;  3CRB A;  2DWJ A;  4MH5 A;  4FBP A;  3SER A;  4ZEF A;  4QFO A;  2XXI A;  1B3G A;  1PB8 A;  5IZ1 A;  5B7D A;  4PGN A;  4O8M A;  4C1U A;  1OIB A;  1MY0 A;  5FTH A;  4I1D A;  4OET A;  1FBP A;  5I2K A;  4OHN A;  1YYZ A;  4PGP A;  3A3C A;  4R75 A;  4JWO A;  3Q25 A;  4U4X A;  1S50 A;  2HHM A;  5EQ7 A;  3S9L C;  2NUV A;  3FVG A;  4F39 A;  1G0I A;  2HQ0 A;  4BDQ A;  3U92 A;  4EXL A;  1F9B A;  4N13 A;  2R8T A;  2A5T B;  1FTM A;  5H8F B;  2ZYK A;  3IJO B;  1Y4T A;  2WEF A;  3HFU A;  4GL0 A;  3G7W A;  4QSE A;  3N26 A;  5CRY A;  4MMP A;  2F6G A;  3O9P A;  3FXQ A;  4MNP A;  3PMV A;  1SYH A;  2Q2C A;  4UAB A;  2CEY A;  4ZEC A;  1K9Y A;  5J16 A;  3O66 A;  4TLL B;  5CMB A;  4HXV A;  2I3V A;  3PMW A;  1YCJ A;  4QHQ A;  1HSJ A;  2CZK A;  2AYS A;  1B58 A;  1SPI A;  3VVF A;  1B5I A;  2O7I A;  1XS5 A;  3K02 A;  1D9Y A;  2Q9T A;  1P1Q A;  2HZK A;  1B52 A;  3MQ9 A;  3LUY A;  3ONM A;  4WEP A;  3T22 A;  4X1D A;  5I59 B;  2XXR A;  2CZH A;  1LB8 A;  2UXA A;  4X1B A;  3K6X A;  1EYI A;  2FIX A;  3U94 A;  1IXI A;  3GBB A;  5AA4 B;  3IAZ A;  2Q2A A;  1NUZ A;  4OEU A;  3ECR A;  1XHY A;  4PBH A;  4Q5T A;  1MY1 A;  5HBC A;  1B32 A;  4ONY A;  1M5B A;  4IB2 A;  3PV0 E;  4LN5 A;  4R6H A;  3S9M C;  1EYK A;  1MXZ A;  1JVY A;  4GXS B;  4YKK A;  3PTY A;  2OZZ A;  1YXI A;  3HV1 A;  4ZS9 A;  5EHM A;  2Y7I A;  3SKP A;  1UTB B;  2ZZV A;  4N17 A;  4R9G A;  4H46 A;  4P0I A;  2PFZ A;  1B6H A;  2QS3 A;  4I3E A;  4GWW A;  2D21 A;  2ANJ A;  1MXX A;  3FIR A;  2H98 A;  2DSF A;  2GH9 A;  2VD3 A;  1SDX A;  4PET A;  3HCQ A;  1URG A;  4KYE A;  5ET7 A;  3PMX A;  3O2A A;  3BFU A;  2VD2 A;  3HO7 A;  4EXK A;  1FTJ A;  1FQC A;  1FPI A;  4ECF A;  3E4R A;  4NWD A;  5EQ8 A;  4BLA A;  2A5T A;  3O6I A;  5H8F A;  2H4I A;  2Y7W A;  4ZDM A;  4JSD A;  3TKD A;  5KCJ B;  2X26 A;  1CB6 A;  3DLN A;  5IM2 A;  1NNT A;  3PUW E;  2O6A A;  5FTI A;  3V83 A;  2V93 A;  3AXF A;  2QPQ A;  4O94 A;  3KBZ A;  1LBC A;  3FVO A;  4U1Z A;  5JEI A;  5ET5 A;  1FJ9 A;  1JEU A;  4PDD A;  1FBG A;  4RYA A;  4RK9 A;  1A99 A;  1FPD A;  1JET A;  4GF8 A;  2V25 A;  2O68 A;  3RT8 A;  3LSF B;  1NNP A;  1UTH B;  4PFY A;  3O29 A;  3PGF A;  3EN3 A;  1DSN A;  4QXD A;  3JZJ A;  5I84 A;  4I3Y A;  1SW1 A;  5I59 A;  1BTJ A;  4YKJ A;  1KZ8 A;  2GFE A;  5DVI A;  4O7M A;  3NOH A;  1SI0 A;  5AA4 A;  1A40 A;  1MPC A;  3RGY A;  3L6H A;  3U93 A;  4AB6 A;  3F11 A;  1JW4 A;  1DOT A;  2PVU A;  1GV8 A;  5HPQ A;  3FD3 A;  4OA4 A;  4RK2 A;  3QIM A;  1WOD A;  1Y9U A;  1KA1 A;  1UTB A;  1B3H A;  1RDZ A;  2FHY A;  5LTC A;  4AS4 A;  4O7I A;  2PMS A;  3TOD A;  2LAO A;  3MZB A;  1Y3P A;  1NV2 A;  1QUJ A;  3KJ7 A;  4GFR A;  1TT1 A;  1B05 A;  4DI3 D;  3SET A;  1PC3 A;  3HHG A;  4OFO A;  2W7Y A;  1NV6 A;  5I5P A;  4N15 A;  1SW5 A;  3MWB A;  4HW8 A;  5LDZ A;  2HAU A;  2ONR A;  1SVX B;  1A8F A;  3FV2 A;  1D9Q A;  2G29 A;  3C31 A;  5KCJ A;  3S2V A;  3U65 A;  1Y4C A;  4MNC A;  1LST A;  1AH5 A;  3H4Z A;  1IIW A;  4IO3 A;  1IQ7 A;  4G4P A;  4DE8 A;  5CMK A;  5ITP A;  2Q8J A;  3PPP A;  4LUB A;  3SZP A;  4Z7E A;  4NTL A;  1EZ9 A;  4OQO A;  4HE1 A;  3TDJ A;  4NF6 B;  4ZZE A;  2Y7R A;  1BP5 A;  2F36 A;  1I6B A;  1ZLQ A;  3T1B A;  3MP8 A;  3TCH A;  3RNN A;  1ANF A;  4P9K A;  1UTH A;  4POW A;  3C9H A;  1NV4 A;  4BDO A;  3H6V A;  1M5D A;  1NV7 A;  4ESW A;  3TEP A;  1FQE A;  1ATG A;  3TTK A;  1KWH A;  2ZYM A;  4HS7 A;  1NFT A;  4RJZ A;  4FE8 A;  1FPE A;  3MST A;  1XVY A;  3FGS A;  3RPL B;  3FBP A;  2QFL A;  3KFM A;  1USY E;  2H25 A;  4KI0 E;  4R2F A;  2I0C A;  4LQ2 A;  3RN8 A;  5ET8 A;  1B7U A;  3KJT A;  3B6T A;  4XXU A;  4XTC Q;  5DEX B;  1MQG A;  5IZ3 A;  4MHF A;  4MBP A;  2DS9 A;  4F1U A;  1GGG A;  4OZ9 A;  2Q8M A;  3I3V A;  4G77 A;  1Y1Z A;  2NXO A;  4GLI A;  4TLM B;  3CSB A;  2XHD A;  1LBB A;  1N3X A;  1N3W A;  2RC9 A;  3VE1 B;  3GZG A;  3TUS A;  3M3L A;  3IL1 B;  2HAV A;  4G61 A;  1MQI A;  4DIG A;  4F1Y A;  4FAT A;  1R9Q A;  1FJ6 A;  5K2X A;  1SYI A;  2I58 A;  4OES A;  4H45 A;  1TWY A;  1VFE A;  3C4M A;  4OVP A;  2UYE A;  1NH7 A;  1XT8 A;  4EF2 A;  4PAF A;  1RYX A;  1MS7 A;  3CFL A;  2P3V A;  1PB9 A;  1OQG A;  4GVO A;  3A3U A;  1D9V A;  3IOU A;  3IX1 A;  3LC8 A;  1GR2 A;  4DCX A;  2HEU A;  1QVS A;  4N07 A;  4ELR A;  5I57 B;  4P1L A;  3VXB A;  3IB1 A;  4GOT A;  1QUK A;  2X7Q A;  4KPT A;  1Y1M A;  2D5W A;  1LLS A;  3W15 C;  1FTL A;  4OMB A;  2DE3 A;  2O69 A;  3DP8 A;  3MAM A;  3H3G A;  4DXC A;  4IR8 A;  3KN7 A;  4H65 A;  5IKB A;  3GBA A;  4PCD A;  4E0W A;  4ISU A;  1FSA A;  1Z7N E;  2PFY A;  1NH8 A;  3G3K A;  1WVJ A;  4QSD A;  1RYO A;  1Y3Q A;  1OVB A;  2ZZX A;  1QKB A;  3B50 A;  1DPE A;  2D3I A;  3CIJ A;  3O28 A;  2XXT A;  4NX1 A;  3O97 A;  1NKX A;  4YAH X;  1L5T A;  2Y7K A;  3KG2 A;  4JXI A;  2I6E A;  1N76 A;  4R74 A;  3IFA A;  4KHZ E;  3T0J A;  1UQW A;  5FHN A;  3MUQ A;  2OBG A;  4F18 A;  2H9B A;  2HCA A;  3SEX A;  4ND9 A;  4AB5 A;  3IK6 B;  2I3W A;  2XD2 A;  4IO4 A;  3T9X B;  1JNF A;  3VVD A;  3EQ1 A;  4QFL A;  2GHB A;  3L6G A;  1NUW A;  2PCR A;  4ZEI A;  3D1R A;  4YZZ A;  3DM0 A;  4PP0 A;  1P1U A;  4PC9 A;  3OO7 A;  4GX4 A;  5H8S A;  3E79 A;  4MEV A;  2BJI A;  4DCY A;  3TEL A;  4OTE A;  1NV3 A;  3RTW B;  2GHA A;  2H99 A;  3MP6 A;  1D3K A;  5I57 A;  3FZV A;  3H06 B;  1NV1 A;  4N6K A;  2YLN A;  3SEV A;  1GTK A;  2B65 A;  2V3Q A;  4PAI A;  2XXX A;  3CG1 A;  4IO7 A;  2FA7 A;  3MBP A;  1EZP A;  1OLC A;  1LBW A;  5ESY A;  3MZ1 A;  2JJK A;  5B70 A;  1SI1 A;  3OO9 A;  3VXC A;  1TFA A;  4MAG A;  1P1W A;  3H6W A;  5TPA B;  4LZ8 A;  3OO6 A;  1MH4 A;  4JSO A;  4KD5 A;  3E78 A;  1SW2 A;  4R6K A;  1YPN A;  3IB2 A;  2XXQ A;  5I56 B;  3M3K A;  2HXR A;  3LV0 A;  4UA8 A;  3THI A;  1M5E A;  2DXY A;  3N5L A;  2HPG A;  3Q27 A;  5I3S A;  2F7B A;  5AE4 A;  2ZZW A;  5AA2 A;  3D4C A;  5AA1 A;  1OQH A;  1Q35 A;  2BJJ X;  4Z0I A;  2Q74 A;  3IO6 A;  4FAJ A;  3RY3 A;  2WX9 A;  2DP8 A;  3FAS A;  2OWZ A;  4F3P A;  4I8C A;  2QSX A;  4QF9 A;  4G68 B;  5F24 A;  3RPW A;  4IO2 A;  2X7P A;  5EQ9 A;  2QS4 A;  4PFT A;  1US4 A;  5BWJ A;  2A5S A;  3KC0 A;  4NF8 B;  2P0S A;  1PDA A;  4K3F A;  3U8Q A;  3MW0 A;  3HHF A;  2PX1 A;  4MFI A;  1URS A;  4GBW A;  4JWX A;  4MNI A;  2HXW A;  3FXB A;  4GQO A;  3QUF A;  1QUL A;  2AIX A;  2B3F A;  2XA5 A;  4WED A;  2OX3 A;  5IGA A;  2E1S A;  2F97 A;  2F3D A;  3VLV A;  3G3I A;  4BDL A;  1QGX A;  2P2A A;  4HE0 A;  1XOC A;  4DZ1 A;  4U23 A;  2Y7P A;  3O6G A;  3IOW A;  4OYV A;  5H8N B;  5H8Q A;  4ZED A;  3RQT A;  3PUX E;  2DOJ A;  1R1N A;  1B9J A;  4JVC A;  4LZ5 A;  3G3H A;  4H0W A;  5TPA A;  4PF6 A;  3ZS6 A;  2UVG A;  5DT6 A;  2VOZ A;  4M1V A;  2Z8F A;  4G8N A;  3G3G A;  3QAX A;  3DEL B;  3C34 A;  5I56 A;  4O3A A;  2F8D A;  1B5J A;  2XWO A;  1B4Z A;  2B3B A;  1J1N A;  4F2O A;  4H67 A;  2F5X A;  2XX8 A;  4FJP A;  2WBD A;  3FAT A;  2XWI A;  4GBV A;  2ZNS A;  4HCW A;  1MDP 1;  3MZ9 A;  3K1P A;  1R6Z A;  3LSX A;  2UYF A;  5FHO A;  4YB7 A;  3TQL A;  1VDW A;  1QJM A;  3V8X B;  1ZMG A;  4P3L A;  3Q28 A;  1OMP A;  3EPE A;  4QRZ A;  4G68 A;  5L9S A;  3OMB A;  1B3L A;  1UIU A;  3MJN A;  5I7I A;  2V84 A;  4PFI A;  5EQA A;  3KN8 A;  2YPN A;  3K01 A;  4PDH A;  4IO5 A;  3GLB A;  1NV5 A;  1HSE A;  1LAF E;  5CMC A;  4PBQ A;  4DLD A;  1H45 A;  4ELP A;  1P99 A;  4QFP A;  3QXM A;  4NF8 A;  4EQB A;  1JW5 A;  5DYH A;  3QYT A;  1BKA A;  1MY3 A;  1MPD A;  2F78 A;  1II5 A;  3O6H A;  3IFC A;  3UIF A;  4F22 A;  5IZ3 B;  2ZYO A;  4MF3 A;  3K6V A;  4F2Q A;  1EZO A;  2YJP A;  5EHS A;  4H5G A;  1N7W A;  2DWI A;  1LBV A;  3DP4 A;  2R71 A;  1MY4 A;  2WYP A;  4FOR A;  4NE4 A;  1Q9D A;  3VFJ A;  1YZ0 A;  3B8B A;  1LFH A;  2DE2 A;  3KOT A;  1FRP A;  1FBH A;  3H7M A;  4F31 B;  2PT1 A;  4IGT A;  4P8B A; 
#chains in the Genus database with same CATH homology
 5DW8 A;  4HCY A;  4H45 A;  5EYH A;  1LBX A;  1IMD A;  4OVP A;  1FBF A;  4PAF A;  4FBP A;  5IZ1 A;  3W9V A;  4PGN A;  4O8M A;  2FIE A;  2P3V A;  1FBP A;  1YYZ A;  4PGP A;  1NI9 A;  4GX3 A;  4XFE A;  1LBY A;  1IME A;  2HHM A;  5EQ7 A;  4P1L A;  4X8R A;  2HZL A;  2F3B A;  1G0I A;  2DVZ A;  2DE3 A;  2R8T A;  1CNQ A;  2WEF A;  3HFU A;  4OAN A;  4KXP A;  4XF5 A;  4N8G A;  4IR8 A;  4XEQ A;  4PCD A;  4MMP A;  1FSA A;  4MNP A;  2PFY A;  4UAB A;  4GWY A;  2CEY A;  1K9Y A;  5J16 A;  1DBZ A;  4HXV A;  1XI6 A;  2ZZX A;  3B50 A;  1FPL A;  2DDK A;  4NX1 A;  1INP A;  2CZK A;  2CEX A;  2QVV A;  1SPI A;  4N4U A;  4X04 A;  4P56 A;  2Q9T A;  2HZK A;  3IFA A;  2CZH A;  3T0J A;  4P1E A;  4X9T A;  4F18 A;  1EYI A;  2FIX A;  2FBP A;  1NUZ A;  4MCO A;  4PBH A;  1NUW A;  4LN5 A;  2PCR A;  4NQ8 A;  3D1R A;  1EYK A;  4YZZ A;  4GWZ A;  1JP4 A;  4PC9 A;  1BK4 A;  3PTY A;  1FPG A;  4NF0 A;  1IMB A;  4GX4 A;  1YXI A;  2FVZ A;  3E79 A;  1G0H A;  4MEV A;  2ZZV A;  4N17 A;  2BJI A;  4H46 A;  4OVR A;  2PFZ A;  2VT5 A;  4I3E A;  5J1D A;  4GWW A;  3BIG A;  1IMC A;  1NV3 A;  4PAK A;  2DE4 A;  3W9W A;  1NV1 A;  4PET A;  4N6K A;  5ET7 A;  4PFB A;  2V3Q A;  3GYY A;  4PAI A;  4NG7 A;  1FPI A;  5EQ8 A;  4N6D A;  1IMA A;  2Y5K A;  2WYK A;  5IM2 A;  1LBW A;  5ESY A;  1FBE A;  2JJK A;  5ET6 A;  3LUZ A;  2QVR A;  3QMF A;  4MAG A;  2P3N A;  3E78 A;  2QPQ A;  4DI4 B;  1K9Z A;  2V4C A;  4O94 A;  3KBZ A;  2HXR A;  3LV0 A;  5ET5 A;  4PDD A;  1FJ9 A;  1AWB A;  1FBG A;  4OVQ A;  1FPD A;  2HPG A;  2VPO A;  1FTA A;  1RDX A;  1DK4 A;  5I3S A;  4QXD A;  2ZZW A;  3ROJ A;  4I3Y A;  4P47 A;  1KZ8 A;  4F19 A;  4O7M A;  2Q74 A;  3NOH A;  2WX9 A;  2OWZ A;  1FPK A;  1IMF A;  1EYJ A;  4F1V A;  5F24 A;  4AS5 A;  2B4L A;  4PF8 A;  5EQ9 A;  2XWV A;  4OVS A;  5CM6 A;  2GQ1 A;  3KC0 A;  5EYG A;  4JVI A;  1FPJ A;  4OA4 A;  4OVT A;  4PE3 A;  1KA1 A;  1RDZ A;  1FPB A;  2FHY A;  4GWU A;  5LTC A;  3CHG A;  4N81 A;  4AS4 A;  4GBW A;  4O7I A;  5FBP A;  4MNI A;  3FXB A;  3RYD A;  4HE2 A;  2XWK A;  1NV2 A;  2XA5 A;  2OX3 A;  4MJO A;  5IGA A;  1NUX A;  3BIH A;  4DI3 D;  2F3D A;  4I40 A;  2CZI A;  1NV6 A;  5IZZ A;  4GWS A;  1QGX A;  1FBD A;  5A5L A;  4N15 A;  5I5P A;  5JK4 A;  4HE0 A;  5LDZ A;  2QVU A;  3KC1 A;  4JVD A;  1D9Q A;  2KR0 A;  3U65 A;  4MNC A;  4JVC A;  4NHB A;  2Y5L A;  4PF6 A;  5T3J A;  3SZP A;  4M1V A;  4HE1 A;  2XWO A;  4MIJ A;  2F5X A;  3T1B A;  4P9K A;  4QBA A;  2WBD A;  1NV4 A;  2XWI A;  4GBV A;  1NV7 A;  3RPL A;  4HCW A;  1FPF A;  1KA0 A;  1RDY A;  4PFR A;  2B4M A;  1FPE A;  3MST A;  4NAP A;  1VDW A;  3RPL B;  3FBP A;  4YIC A;  2QFL A;  4P3L A;  3EKI A;  4MX6 A;  5I7I A;  4PFI A;  2L5V A;  1LEV A;  5ET8 A;  5EQA A;  2KQZ A;  4N8Y A;  4PDH A;  1NV5 A;  1LBZ A;  4PTK A;  4N91 A;  5IZ3 A;  3ISP A;  4MHF A;  4PBQ A;  4GWX A;  4F1U A;  2Q8M A;  2VPN A;  3IFC A;  5IZ3 B;  3MYU A;  2WBB A;  3A29 A;  1LBV A;  1FBC A;  2WYP A;  1NUY A;  4G61 A;  2MKZ A;  4GX6 A;  1Q9D A;  1YZ0 A;  3B8B A;  2XXK A;  2DE2 A;  1FRP A;  1DCU A;  1FBH A;  4NN3 A;  1NV0 A;  1FJ6 A;  4NGU A;  4P8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...