5J16A

Crystal structure of inositol monophosphate bound saimpase-ii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
258
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Inositol monophosphate bound SaIMPase-II
rcsb
source organism Staphylococcus aureus (strain mssa476)
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 77
structure length 258
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5j16A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j16A02
1RDXA 2Y5KA 1FPLA 4GX3A 3RYDA 5DW8A 1LBXA 4MJOA 1YXIA 2WBBA 4N81A 1FPJA 2QVUA 1JP4A 1NV7A 1AWBA 2QFLA 4HE0A 2VT5A 5I3SA 5J16A 3IFCA 5EQ8A 1KA1A 4HXVA 1IMCA 4GWUA 2QVVA 2F3BA 4AS5A 1IMFA 1FBFA 5EYHA 1LBZA 1VDWA 2FVZA 2P3NA 1NV2A 5T3JA 1DK4A 1LEVA 1FBDA 1D9QA 4QXDA 5IZ3B 1NUZA 1FBCA 3D1RA 1FPFA 3A29A 4GWYA 1FBPA 3RPLA 2FHYA 1K9YA 3QMFA 2JJKA 4PTKA 1NUWA 2Q8MA 1FTAA 4FBPA 1NV6A 1FPGA 1NUYA 3BIHA 4GWWA 1FRPA 5ESYA 2R8TA 2QVRA 3FBPA 1FPDA 5IZ1A 1NV5A 2PCRA 4GX6A 3ROJA 1FPBA 1NV4A 2F3DA 5F24A 4KXPA 1LBYA 1KZ8A 2CZHA 4GBWA 1FBGA 2OWZA 1DCUA 1NV1A 2OX3A 1YZ0A 1RDZA 1RDYA 1LBVA 3LV0A 1EYJA 4I40A 1KA0A 4HE2A 1K9ZA 1IMEA 5EQAA 1BK4A 2WBDA 3RPLB 4GWZA 4H45A 2P3VA 5FBPA 2DDKA 4AS4A 2BJIA 1FJ9A 4IR8A 1LBWA 5EYGA 1NV0A 1NUXA 1IMBA 1CNQA 1G0HA 3KBZA 3KC1A 1INPA 3KC0A 2WEFA 2FBPA 1FBEA 2HHMA 5ET5A 1EYKA 5ET8A 5EQ7A 4O7IA 1FPEA 5A5LA 4G61A 1XI6A 1NV3A 1G0IA 1IMAA 5EQ9A 2CZIA 2GQ1A 2FIXA 1IMDA 1Q9DA 4HE1A 3BIGA 4I3YA 4I3EA 2CZKA 3IFAA 4GBVA 1SPIA 5LDZA 1FPIA 4GX4A 5IZ3A 2FIEA 1YYZA 2Y5LA 1FPKA 4H46A 2Q74A 1FSAA 1QGXA 5ET6A 1DBZA 1EYIA 4GWXA 5ET7A 3B8BA 1NI9A 1FJ6A 3LUZA 1FBHA 4GWSA 3T0JA
chains in the Genus database with same CATH superfamily
1DPEA 4FJPA 4GX3A 5TP9A 2GFEA 3KG2A 4N81A 2H25A 2F6GA 1MY2A 1GV8A 3OENA 1ZBMA 5I3SA 4HTGA 2XX8A 4M1VA 3QUJA 1LCFA 3MP6A 1FBFA 2PX1A 4F22A 2RINA 4QXDA 2DE3A 3VE1B 4WXJA 3K1PA 3SETA 1A8EA 1R9QA 1H43A 1UIUA 4O8MA 4FBPA 3CI8A 5L8DA 3GBBA 3PGFA 2F7CA 3FVOA 2VP1A 3MQ9A 4KI0E 3G3GA 3KOSA 2PCRA 5CM6A 4X04A 4GX6A 4DXUA 4N13A 2F5XA 4QFPA 4XFEA 4RY1A 1P99A 2ZYOA 4P0GA 5H8SA 3FXBA 2ZMBA 4YKIA 1N3WA 4KYSA 3TQLA 2XXQA 5H8HA 3PU5A 4OFJA 1D4NA 4O3CA 1JETA 4YMAA 2I49A 4YKPA 4Q30B 1Y1MA 1SYHA 1OLCA 3HN0A 2NUVA 4XKNA 2WEFA 3W15C 1MY3A 4QFNA 1MXWA 2H4IA 1NV3A 4EF1A 3G7WA 1HSEA 4RK9A 1J1NA 5AA2A 4PDHA 3B6WA 1LGBC 2FIXA 2OPEA 3I6VA 3IX1A 3MVXA 4JWXA 4NWCA 2KLFA 4PFWA 3QYTA 2OZZA 2V3UA 1B3HA 2HZLA 1JP4A 2XXXA 3TCGA 1BLFA 2DWAA 1NL5A 3C34A 3HSTA 3Q27A 4H1XA 5ICTA 3BBRA 4AS5A 4THIA 5EYHA 5I5PA 1LBZA 3CSGA 4OMBA 1MS7A 2OJTA 4Z7EA 1D9QA 3FXUA 3U8QA 2O7IA 4H6DA 1LBBA 3CFLA 1OVBA 1FRPA 1B4ZA 2ABHA 1USYH 4F3BA 4DXBA 1NV4A 5AA3A 1TWYA 1DCUA 3O6HA 2OX3A 4H5FA 3VLUA 1YZ0A 3ONMA 1K9ZA 2ONSA 1IMEA 3K2DA 1PBPA 3TDJA 3TKDA 4ISUA 1BTJA 5A5XB 4EQ9A 4MNPA 4PGPA 4FEDA 5ELVA 3HPIA 5EHMA 4PAFA 3TTLA 2R6GE 2FBPA 2QS4A 3KGCA 3VFJA 4O7IA 3IAZA 1B05A 3FATA 2H98A 1MY0A 2XWKA 4F2OA 5AA4B 1QKAA 5H8HB 4LZ8A 1PB8A 2VGQA 2YLNA 4OXVA 4JSDA 3VLVA 5I57A 4OVSA 3W9WA 2ZXTA 1LAGE 1O7TA 5ET6A 2DWJA 4R2FA 2Q2AA 3TAJA 1IEJA 1RDXA 5FTIA 2H5YA 3UK4A 3R26A 1YXIA 5DEXB 1YPNA 1AWBA 4PGNA 4NMYA 4RJZA 4QSCA 4G68C 3B7DA 4P1LA 2P3NA 3N26A 1NV2A 1FBDA 3OMBA 3TEPA 1B0HA 3EHUA 3B6QA 2REJA 1PEBA 1Y4TA 3RN8A 3H6WA 2UVHA 4RYAA 1IZ1A 4O3BA 3SDFA 3ODBA 2D5WA 2XXKA 2DVZA 3C35A 2OCUA 4F18A 5FHOA 2ONKE 2CZHA 4QFKA 1FBGA 2OWZA 4HCWA 3Q26A 4NF8A 1RDYA 2PT2A 1B58A 1WDNA 5I2KB 5EQAA 2WBDA 4R6YA 2CEXA 4AQ4A 4C1TA 2P3VA 3TQWA 4FEBA 2F6PA 1OQHA 4OVTA 2Q2CA 3MVWA 4JVCA 3PPPA 3QIMA 2ANJA 1PBQA 3K01A 4F3PA 4BDRA 3PUZE 2QJEA 5A5LA 4G61A 1B52A 2CEYA 4BDLA 3K6VA 4N4UA 1MQIA 3SZPA 1IMDA 1LFIA 4I3EA 2XXTA 3K0VA 2I6EA 2RC8A 1FTKA 2Q74A 3CG3A 1EYIA 4ZEIA 3B8BA 3PPNA 3LUZA 3ZS6A 5CBRA 3TTKA 5ICQA 4FORA 4MJOA 4PF8A 5IZZA 2WBBA 1FPJA 1LAXA 4NWDA 2R9JA 2V3QA 2XX9A 2QS1A 2O1MA 1KA1A 3KEIA 3CVGA 4PF6A 2P1SA 1VDWA 2P0SA 5T3JA 2FYIA 4FATA 5H8QB 3LR1A 4XKQA 1FBCA 1LBCA 2PFZA 3C32A 4QFLA 2ZNTA 1NUWA 3IO6A 2QL3A 1R9LA 1NV6A 3DELB 5ESYA 1NFTA 4DZ1A 3U1OA 3L6HA 2GHBA 2QMWA 1KZ8A 4KCCA 3G3JA 3SEXA 4ECFA 5HPQA 1EYJA 3E4RA 5KZTA 4XKPA 3JYRA 4HS7A 3H3GA 3SESA 3IB0A 4F19A 3ISPA 4JVIA 2DDKA 1S7YA 4DDDA 1B40A 3FJ7A 3IL1B 4FE8A 5I59A 3DM0A 4ZE8A 4NF4A 3EKIA 1B7ZA 4QF9A 4WKMA 3TTMA 3DLNA 4NF8B 3TFLA 1GVCA 4UABA 1MXZA 1ATGA 2DSFA 4NF6A 2PBWA 5IZ3A 3JZJA 5CRYA 4GWXA 4GD5A 3FXRA 4AB5A 1SI0A 3T0JA 3Q29A 4PP0A 4GLIA 5H8FA 4Q0CA 2H9BA 2I3VA 3KN8A 4OZ9A 1EU8A 3TPAA 2I0CA 4BDQA 4DIGA 4HE0A 3FIRA 3OEMA 1ZU0A 4ZEBA 5EQ8A 1P1OA 2G29A 1MPDA 2V3TA 5I57B 5DVFA 4ESXA 5JTYB 4G77A 3FXQA 1FQCA 2Q8MA 1Y4CA 1ZKBA 3RTFB 2XXWA 4QHQA 3OO7A 3PUWE 4EDPA 3O9PA 3SERA 1SDXA 5DEXA 3JV9A 5CMKA 3SKPA 1TT1A 1S50A 1D9YA 3E13X 3U94A 1UTHA 2Y7WA 4GVOA 1F9BA 3T22A 4KPTA 3IR1A 1IQ7A 2OPDA 2DWHA 2NWJA 4PFRA 4DE8A 4DLDA 2X7PA 1Y9UA 1EH3A 1FBEA 4XKRA 2UVIA 1FTJA 1B7HA 5KCJB 3PD9A 3I5OA 3OO9A 5L9SA 1LB8A 2M8CA 4OVJA 4PQJA 4IO3A 4R75A 1Q9DA 4H67A 3MP1A 4KHZE 4HCYA 1N0TA 1XVXA 1M5CA 2F34A 4X8RA 1XC1A 2F78A 2IA4A 1JNFA 3LSWA 1FQEA 1MY1A 3H6VA 4LQ5A 1MM7A 4LA9A 1EZOA 4G8HA 3IFCA 2UVJA 4NF6B 3IORA 5CBSA 1TXFA 4IB2A 4ZECA 5BWJA 2DOJA 5I84A 3PD8A 3O28A 2JJKA 5H8FB 1MXVA 2IEEA 2XXIA 3NOHA 4JSOA 2QVRA 2B4LA 1OIBA 3PMXA 1VFDA 2UYEA 1FTMA 1NH7A 2I4CA 2UXAA 2ZYNA 1MM6A 1IUDA 4U21A 1NKXA 2VOZA 2Q88A 5LOMA 3AXFA 2GH9A 4P47A 3SEVA 4OA4A 3QUFA 3OO6A 3ILUB 4BDNA 1I6AA 1SW5A 4MBPA 3M3FA 3THIA 4NX1A 3U72A 2HHMA 1MXYA 2XX7A 1FPEA 4GL8A 1XI6A 4IY6A 3LUYA 3PPOA 3U93A 5IM2A 5TPAB 1SVXB 1SW4A 1BIYA 3W9VA 4XEQA 1MQJA 5K2YA 3ZKKA 5LTCA 2B4MA 3IOUA 4O7MA 4N15A 3BIGA 4I3YA 3IFAA 1SPIA 4TOZA 4H5GA 1FPIA 4O3AA 4MF3A 3V83A 1YYZA 4H8IA 1QGXA 3KN7A 1XT8A 4MLVA 1B4HA 3CSBA 4G8NA 1EZ9A 3KSJA 2RKMA 4EUOA 1LBXA 5I59B 1JVXA 1Y3PA 2HCAA 2Z8DA 2Q89A 3LC8A 1MY4A 1QVSA 4GF8A 2QFLA 2F7BA 4YB5A 4LVQA 4IGTA 5F7VA 1ELJA 1P1UA 3KBRA 3FVNA 5IZ3B 4JB7A 3FV1A 3EN3A 1UIVA 2V93A 4MHFA 3KFMA 1YCJA 1Q1KA 1B32A 2ZYKA 4IGRA 3TZAA 1GTKA 5DT6A 1NUYA 3BIHA 2YJPA 1BKAA 1ZLQA 3S9EA 3MWBA 1FPBA 3RT6B 4YZZA 1KWHA 4OFLA 1BP5A 1XS5A 4GBWA 3G3KA 1Z7NE 3PPRA 3VVEA 5FTHA 4QRZA 3TCHA 2D21A 3FVGA 2WYPA 4P9KA 1FW0A 3FV2A 1AIVA 1LFHA 2A5TA 3MPLA 1D3KA 5DVIA 3KSXA 2D3IA 2P2AA 2V25A 4DCXA 4Q8RA 3RGYA 1MQDA 3OSQA 1B5HA 3PTYA 4MX6A 1DMBA 4Z0IA 4YB6A 1IMAA 1N7XA 2AL5A 5AE4A 1UTHB 3PMVA 3E79A 2CZKA 1IITA 3LBSA 3G3FA 4G8MA 3PPQA 2FIEA 3R6UA 3EPEA 4QSEA 5ET7A 1RYOA 2Y5KA 1LAFE 4PFIA 1NNFA 5CC2A 4GQOA 2HFBA 2XXPA 2QVUA 5TPAA 4MEVA 4KD5A 4NF0A 2CZLA 4DI4B 4U22A 4P8BA 1CB6A 2XD2A 2QVVA 2X26A 4OQOA 3HHGA 1H3DA 1L5TA 5DTBA 1NUZA 3D1RA 5CMMA 3FJMA 3RNNA 3MZBA 1WVJA 2HAUA 5IAIA 3OSRA 4LN5A 4E0WA 4NE4A 5IZ1A 4UA8A 2QSXA 3OOAA 4NF5A 3MAMA 2YPNA 4LATA 3K6XA 2HQ0A 1T0KA 5TP9B 1RDZA 2AIXA 2V4CA 3OXNA 1RYXA 1SBPA 2XXYA 3CFXA 3MVYA 1BK4A 4GWZA 4MNIA 4H45A 4X1DA 3CFZA 5HBCA 4H0WA 4AS4A 4PDDA 1ZTYA 2DXRA 3SEWA 2DYXA 1IMBA 2E0SA 3IB2A 3KC0A 4AB6A 2DWIA 2DE4A 4NN3A 2F97A 1I69A 4O94A 4POWA 2FNCA 3TYHA 4OENA 1ANFA 3FASA 5I58A 1AL3A 4K3FA 3RY3A 4YAHX 3T9UA 2Z8EA 4DCYA 1HSJA 1USYE 1N3XA 1FQDA 2L5VA 2Y5LA 4H65A 2O84X 4RPOA 2NVUB 3LSXA 3T96B 3UGWA 4JWOA 5ITPA 4MIJA 4OVPA 3H7MA 4PFBA 1II5A 4OETA 3PMWA 2QPQA 1PDAA 1MG1A 3DP8A 1N04A 3BFUA 2Y7IA 2B65A 2AL4A 2THIA 3K02A 4IO4A 1FBPA 3SEYA 1Y3QA 3RPLA 1K9YA 4N6PA 1VE4A 2DVCA 2X7QA 3MYUA 1PB9A 4MCOA 5IKBA 2R8TA 4I9DA 3MZ9A 1QJMA 3ROJA 3M3LA 5F24A 1A54A 2DE2A 1IXHA 3SEUA 2UVGA 4IO5A 3LV0A 1LCTA 4EXKA 3MJNA 5ISUA 1N84A 2VD3A 3BKIB 1IXCA 2G93A 2CMOA 4QBAA 4IR8A 5B7DA 1MQHA 1NV0A 4NF4B 2Y7RA 2ONRA 4PFUA 2ZZVA 1VFEA 4DI3D 1XHYA 2ZNUA 4NF5B 5ET5A 3E3KA 4F1VA 1US5A 4N91A 5EQ9A 4KQPA 4XTCQ 2GQ1A 3FGSA 4R6KA 2OWTA 1NNTA 3PUVE 3Q25A 5CMCA 4XXUA 4NHBA 1DBZA 5DYHA 3MW0A 3VV5A 3BFTA 3DP4A 4YU0A 2R71A 3LSFB 3VXBA 3N6TA 3MVZA 1Y20A 2VD2A 2WX9A 5EHSA 2B3BA 4FECA 1URDA 3O66A 4R9FA 3UP9A 1MXUA 4IO2A 2ZYMA 1FCKA 4WEDA 3A3UA 3N6UA 1NMUA 3EQ1A 3V5AA 4GIZA 2WKYA 4GWYA 1R6ZA 3V8XB 2FHYA 3S4UA 2WYKA 3QSLA 3FZVA 2V84A 3P7IA 1MH3A 3HCQA 4LONB 4ZZAA 2XD3A 2O51A 3VXCA 1JW4A 2H99A 4X9TA 4QFOA 4R9GA 3U65A 3GYYA 4I40A 1SD3A 1URGA 4ESWA 3MP8A 3RPLB 3M8UA 1B7UA 4PCDA 1SYIA 1SW1A 2BJIA 3UN6A 2E1SA 4TLLB 4P3LA 3TODA 1DSNA 1B0LA 1EYKA 5ET8A 5EQ7A 3KZGA 4PE5B 1LFGA 3O6IA 3FD3A 3C36A 1G0IA 3LSLA 1QW0A 3FUZA 4ZE9A 4PAIA 1POTA 2OWSA 3ZKLA 1AOVA 1LAHE 4GX4A 3MUQA 4I8CA 2HZKA 4N8YA 3L6GA 1EZPA 1URSA 2B3FA 1FTLA 1B5JA 5I2KA 3MZ1A 3TELA 3OO8A 3EHSA 4U4SA 4OYVA 4F31B 4QSDA 4IO7A 2NOOA 4LUBA 2Q9TA 3A09A 1H76A 4OEUA 4R73A 1M5EA 1P1WA 2HXWA 1AH5A 1LEVA 1NH8A 1HSLA 3DP6A 1B1XA 3A29A 5K2XA 1P1QA 4FIMA 2QRYA 1O63A 4JXIA 1JQFA 2NXOA 4PFTA 3B6TA 1A8FA 3RT8A 1S9TA 4RXLA 4F39A 2XXRA 4P56A 4E0XA 3RQTA 5CI5A 3FJGA 3RUMA 3K6UA 4OEVA 1FQFA 2KQZA 4ELPA 3S9LC 4C0RA 4I62A 3KJTA 4IY5A 2ZNSA 2HEUA 1G0HA 4OESA 4I1DA 4F3GA 3S9MC 3EF7A 5H8QA 2HPGA 3VVFA 3TUSA 3O6GA 5FHMA 3U92A 4U2RA 2BJJX 5DVJA 4NQ8A 5KDTB 3O97A 3T9VA 2Y7KA 5I56A 4ELOA 1CE2A 3H4ZA 1A55A 4GXSB 5JK4A 2RC9A 4GXAA 3GLBA 4MH5A 1A7LA 1FJ6A 2RC7A 1FPLA 3RYDA 2LAOA 1IXGA 3GZGA 4OERA 4N17A 3TMGA 1FTOA 1Y1ZA 5J16A 4P0IA 4HXVA 2GRVA 3O2AA 4GWOA 2FVZA 1JVYA 3N94A 2F7AA 4LQ2A 3CIJA 1VR5A 4GOTA 3G3IA 3OELA 3FBPA 2QS2A 4MLQA 3TTRA 1MRPA 2F3DA 4YKJA 1QUJA 1SQYA 1OMPA 2F35A 5L9OA 3RPWA 2OLBA 1MPCA 4N6KA 1AMFA 1KA0A 4HE2A 1MH4A 2I48A 3IJXB 4F2QA 4LZ5A 2Z22A 2ALUA 2PYYA 2ZZXA 1DOTA 1JW1A 5H8NA 4JVDA 2VPNA 4NAPA 2I4BA 3PV0E 1VSOA 5EYGA 4BDOA 3KBZA 5EYFA 1INPA 3MSTA 3B50A 4U23A 3T9XB 2RF1A 4POXA 2HAVA 5F1QA 3RLFE 1FQAA 4HW8A 1B9JA 3WAFA 1M5FA 4HE1A 1B3LA 3ZSFA 5AA2B 3V89B 4H46A 1FSAA 1B5IA 2XWOA 5CMBA 4GWSA 2XXVA 2QMXA 5DW8A 4EF2A 4X1BA 1RKMA 1ZIUA 3CR9A 3UA8A 4GL0A 4ZDMA 1B6HA 4KYDA 4ZZEA 5I2NB 3ECRA 1B3EA 3IOTA 1IMFA 2AYSA 4KR5A 2Y84A 4OWDA 5AA2D 3PUXE 4ZS9A 5L9MA 1DTGA 3CG1A 4PTKA 2ESNA 4LZ7A 1FPGA 1JEVA 1MDQA 1MPBA 1A99A 4EXLA 5IGAA 4R6HA 3MPKA 4NTLA 2XA5A 4KXPA 4N07A 1Q35A 3HHFA 3UORA 1YTVA 4G68A 1N7WA 4JDFA 5TU0A 2I0BA 4Q5TA 3C33A 1CNQA 4BLAA 4PBHA 3M3KA 2RCAA 2VPOA 5A5XA 1OVTA 2MKZA 3VVDA 3EHTA 1B51A 4X48A 2OBGA 4OHNA 3FVKA 3OD7A 1TFDA 5JTYA 2DQVA 4PAKA 2FA7A 3QK6A 5H8NB 1H44A 4R72A 2XXUA 3IOWA 4GBVA 2OK2A 5LDZA 4NEDA 3T9HB 1Z7ME 2O1LA 1JW5A 1FBHA 4TQUQ 3K1MA 3T1BA 1PB7A 2Z23A 3K6WA 4YICA 3A3CA 3E9XA 4N6DA 1YAEA 3T66A 1XVYA 2KR0A 2W7YA 3IO4A 4L17A 5KDTA 4RK2A 1ZMGA 3T93B 2F3BA 1JEUA 1Y3NA 1QULA 3IK6B 1ZJLA 2XXHA 1LSTA 1N76A 5KCJA 4OFOA 3QMFA 4DXCA 1FTAA 2XWVA 3IB1A 2VHAA 3N5LA 4U1OA 4GFRA 4MMPA 4YMBA 5J1DA 4XF5A 3O29A 3F11A 2F8DA 1XOCA 4MNCA 4ELRA 1O64A 4OTEA 1SW2A 3H03A 2Y7PA 1D9VA 2O7UA 3GBAA 1B3FA 3S2VA 1FJ9A 4KYEA 1LBWA 4G2ZA 4ONYA 2PFYA 4H8JA 1MXXA 2QS3A 3K4UA 4EQBA 3Q28A 2DP8A 3MBPA 1B3GA 3VDFA 3UIFA 1FPKA 3RTWB 1NI9A 5B70A 1I6QA 4JBZA 4RNSA 4UACA 4R2BA 4P11A 4OVQA 4PFYA 4LP2B 1IMCA 3HO7A 4OANA 4PC9A 1LB9A 4F1YA 1DK4A 4G4PA 2REGA 2HXRA 3IJOB 3C4MA 1M5BA 3TTNA 3H6TA 3D4GA 1LLSA 1FQBA 2XHDA 2GHAA 4JWYA 4C1UA 3KOTA 5HM4B 1B46A 5AA1A 4KFQA 1GR2A 1UTBA 2PT1A 5I2NA 3GXAA 1LBVA 3H06B 1SI1A 3S9NC 3HV1A 4ND9A 4IO6A 4MFIA 4PBQA 3HFUA 4R74A 2PMSA 2F36A 3KN3A 1NUXA 2XWIA 3KC1A 1H45A 3ILTB 1UQWA 2DS9A 3KJ7A 3R7XA 5M2VA 3K00A 1POY1 4KCDA 1M5DA 3MC2A 2DXYA 1B1HA 1P1NA 4P1EA 2CZIA 4PE3A 1MDP1 1WODA 4YB7A 4G68B 3USDA 1IXIA 3IOVA 1PC3A 3D4CA 4U4XA 2O68A 4YKKA 3QAXA 1NNKA 3VLWA 4ZEKA 4U1ZA 5I7IA 1NV7A 3QXMA 3WAEA 2VT5A 2A5TB 4F1UA 1QUIA 1DPPA 1A40A 5FHNA 4GWUA 4F3SA 4PETA 1OQGA 4ZEFA 4TLMB 2O69A 1US4A 1MQGA 4F29A 1FPFA 4NG7A 5I58B 4XIGQ 2Q8JA 4OVRA 2UYFA 1GGGA 4EQ7A 4GWWA 1FPDA 2RCBA 4RA1A 3PUYE 2Z8FA 1NV5A 1LBYA 5AA4A 2I3WA 2O6AA 1NV1A 3E78A 4GRKA 3K1NA 5FBPA 3CHGA 1B2HA 4NGUA 2ZZWA 1R1NA 3I3VA 3C9HA 1DTZA 1I6BA 3OEKA 3G3HA 4BDMA 4ELQA 3C31A 1UTBB 1QKBA 3H6UA 4M4GA 5I56B 1NNPA 4WEPA 4MAGA 4ZEDA 2I58A 5ITOA 2PVUA 4RPNA 5JEIA 4FAJA 1OLAA 4N8GA 1TFAA 2A5SA 1QUKA 3TCFA 3CRBA 5BUUA 1IIWA
chains in the Genus database with same CATH topology
1RDXA 2Y5KA 3T1BA 1FPLA 4GX3A 3RYDA 4PFIA 5DW8A 4YICA 1LBXA 4MJOA 4N6DA 4PF8A 1YXIA 2WX9A 5IZZA 2WBBA 4MIJA 4N81A 1FPJA 2QVUA 4OVPA 2HZLA 1JP4A 4MEVA 4N17A 1NV7A 5I7IA 2KR0A 1AWBA 2V3QA 2QFLA 5J1DA 4NF0A 2Q9TA 4HE0A 4PFBA 2VT5A 5I3SA 4PGNA 4DI4B 5J16A 4OVQA 3IFCA 4F1UA 5EQ8A 1KA1A 4HXVA 2QPQA 4P8BA 1IMCA 4GWUA 2QVVA 4M1VA 4PETA 4OANA 2F3BA 4AS5A 1IMFA 1FBFA 5EYHA 4PF6A 4P1LA 5I5PA 1LBZA 1VDWA 2FVZA 2P3NA 4PC9A 4N8GA 1NV2A 5T3JA 1DK4A 1LEVA 1FBDA 1D9QA 4QXDA 5IZ3B 1NUZA 1FBCA 3D1RA 2DE3A 1FPFA 3A29A 4GWYA 4NG7A 1FBPA 2HXRA 3RPLA 2FHYA 4MHFA 1K9YA 2PFZA 2WYKA 3QMFA 2JJKA 4PTKA 1NUWA 2Q8MA 4OVRA 4O8MA 1FTAA 4FBPA 2XWVA 1NV6A 1FPGA 1NUYA 3MYUA 3BIHA 4MCOA 4GWWA 1FRPA 5ESYA 2R8TA 3NOHA 4LN5A 2QVRA 2B4LA 5IGAA 3FBPA 1FPDA 5IZ1A 1NV5A 2PCRA 2XXKA 4X04A 5CM6A 4GX6A 2DVZA 4MMPA 3ROJA 2F5XA 1FPBA 1NV4A 2F3DA 5F24A 4KXPA 2XA5A 4X9TA 4XFEA 4XF5A 1LBYA 1KZ8A 4YZZA 2CZHA 2DE2A 4F18A 4GBWA 1FBGA 2OWZA 1DCUA 1NV1A 2OX3A 3FXBA 4HCWA 1YZ0A 1RDZA 3U65A 4N6KA 2V4CA 1RDYA 1LBVA 3LV0A 1EYJA 4MNCA 3GYYA 4P56A 4I40A 1KA0A 4HE2A 1K9ZA 2WYPA 1IMEA 5EQAA 4P9KA 2ZZXA 1BK4A 3E78A 2WBDA 3RPLB 4GWZA 4JVDA 2CEXA 4P47A 4OA4A 4MNIA 4H45A 2VPNA 4PCDA 4PBQA 3HFUA 2P3VA 2KQZA 4NAPA 4F19A 5FBPA 3ISPA 4JVIA 2DDKA 4AS4A 2BJIA 3CHGA 4PDDA 4QBAA 1FJ9A 4IR8A 4PFRA 1LBWA 4NGUA 5EYGA 1NV0A 4MNPA 4OVTA 4PGPA 1NUXA 2ZZWA 1IMBA 1CNQA 1G0HA 3KBZA 3KC1A 2XWIA 4PBHA 1INPA 2ZZVA 4JVCA 3KC0A 4P3LA 4DI3D 2DE4A 3MSTA 2VPOA 2PFYA 4NN3A 4NX1A 4PAFA 2WEFA 2MKZA 2HPGA 4O94A 2FBPA 1FBEA 2HHMA 5ET5A 1EYKA 5ET8A 3B50A 5EQ7A 3EKIA 4O7IA 1FPEA 5A5LA 4G61A 3PTYA 1XI6A 4F1VA 1NV3A 4N91A 2CEYA 4MX6A 1G0IA 2XWKA 5IM2A 4NQ8A 4PAKA 4P1EA 1IMAA 5EQ9A 4UABA 4N4UA 2CZIA 4MAGA 4PDHA 4XEQA 3W9VA 3SZPA 5LTCA 4PE3A 2GQ1A 2B4MA 2FIXA 4O7MA 1IMDA 1Q9DA 4N15A 4HE1A 3BIGA 4I3YA 4I3EA 2CZKA 3E79A 4PAIA 3IFAA 4GBVA 1SPIA 5LDZA 4HCYA 4OVSA 1FPIA 4GX4A 5IZ3A 2L5VA 3W9WA 2FIEA 4X8RA 1YYZA 2Y5LA 4NHBA 1FPKA 5JK4A 4H46A 2Q74A 1FSAA 1QGXA 5ET6A 2HZKA 1DBZA 1EYIA 4GWXA 5ET7A 2XWOA 3B8BA 4N8YA 1NI9A 1FJ6A 3LUZA 1FBHA 4GWSA 3T0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDX A;  2Y5K A;  1FPL A;  4GX3 A;  3RYD A;  5DW8 A;  1LBX A;  4MJO A;  1YXI A;  2WBB A;  4N81 A;  1FPJ A;  2QVU A;  1JP4 A;  1NV7 A;  1AWB A;  2QFL A;  4HE0 A;  2VT5 A;  5I3S A;  5J16 A;  3IFC A;  5EQ8 A;  1KA1 A;  4HXV A;  1IMC A;  4GWU A;  2QVV A;  2F3B A;  4AS5 A;  1IMF A;  1FBF A;  5EYH A;  1LBZ A;  1VDW A;  2FVZ A;  2P3N A;  1NV2 A;  5T3J A;  1DK4 A;  1LEV A;  1FBD A;  1D9Q A;  4QXD A;  5IZ3 B;  1NUZ A;  1FBC A;  3D1R A;  1FPF A;  3A29 A;  4GWY A;  1FBP A;  3RPL A;  2FHY A;  1K9Y A;  3QMF A;  2JJK A;  4PTK A;  1NUW A;  2Q8M A;  1FTA A;  4FBP A;  1NV6 A;  1FPG A;  1NUY A;  3BIH A;  4GWW A;  1FRP A;  5ESY A;  2R8T A;  2QVR A;  3FBP A;  1FPD A;  5IZ1 A;  1NV5 A;  2PCR A;  4GX6 A;  3ROJ A;  1FPB A;  1NV4 A;  2F3D A;  5F24 A;  4KXP A;  1LBY A;  1KZ8 A;  2CZH A;  4GBW A;  1FBG A;  2OWZ A;  1DCU A;  1NV1 A;  2OX3 A;  1YZ0 A;  1RDZ A;  1RDY A;  1LBV A;  3LV0 A;  1EYJ A;  4I40 A;  1KA0 A;  4HE2 A;  1K9Z A;  1IME A;  5EQA A;  1BK4 A;  2WBD A;  3RPL B;  4GWZ A;  4H45 A;  2P3V A;  5FBP A;  2DDK A;  4AS4 A;  2BJI A;  1FJ9 A;  4IR8 A;  1LBW A;  5EYG A;  1NV0 A;  1NUX A;  1IMB A;  1CNQ A;  1G0H A;  3KBZ A;  3KC1 A;  1INP A;  3KC0 A;  2WEF A;  2FBP A;  1FBE A;  2HHM A;  5ET5 A;  1EYK A;  5ET8 A;  5EQ7 A;  4O7I A;  1FPE A;  5A5L A;  4G61 A;  1XI6 A;  1NV3 A;  1G0I A;  1IMA A;  5EQ9 A;  2CZI A;  2GQ1 A;  2FIX A;  1IMD A;  1Q9D A;  4HE1 A;  3BIG A;  4I3Y A;  4I3E A;  2CZK A;  3IFA A;  4GBV A;  1SPI A;  5LDZ A;  1FPI A;  4GX4 A;  5IZ3 A;  2FIE A;  1YYZ A;  2Y5L A;  1FPK A;  4H46 A;  2Q74 A;  1FSA A;  1QGX A;  5ET6 A;  1DBZ A;  1EYI A;  4GWX A;  5ET7 A;  3B8B A;  1NI9 A;  1FJ6 A;  3LUZ A;  1FBH A;  4GWS A;  3T0J A; 
#chains in the Genus database with same CATH topology
 1DPE A;  4FJP A;  4GX3 A;  5TP9 A;  2GFE A;  3KG2 A;  4N81 A;  2H25 A;  2F6G A;  1MY2 A;  1GV8 A;  3OEN A;  1ZBM A;  5I3S A;  4HTG A;  2XX8 A;  4M1V A;  3QUJ A;  1LCF A;  3MP6 A;  1FBF A;  2PX1 A;  4F22 A;  2RIN A;  4QXD A;  2DE3 A;  3VE1 B;  4WXJ A;  3K1P A;  3SET A;  1A8E A;  1R9Q A;  1H43 A;  1UIU A;  4O8M A;  4FBP A;  3CI8 A;  5L8D A;  3GBB A;  3PGF A;  2F7C A;  3FVO A;  2VP1 A;  3MQ9 A;  4KI0 E;  3G3G A;  3KOS A;  2PCR A;  5CM6 A;  4X04 A;  4GX6 A;  4DXU A;  4N13 A;  2F5X A;  4QFP A;  4XFE A;  4RY1 A;  1P99 A;  2ZYO A;  4P0G A;  5H8S A;  3FXB A;  2ZMB A;  4YKI A;  1N3W A;  4KYS A;  3TQL A;  2XXQ A;  5H8H A;  3PU5 A;  4OFJ A;  1D4N A;  4O3C A;  1JET A;  4YMA A;  2I49 A;  4YKP A;  4Q30 B;  1Y1M A;  1SYH A;  1OLC A;  3HN0 A;  2NUV A;  4XKN A;  2WEF A;  3W15 C;  1MY3 A;  4QFN A;  1MXW A;  2H4I A;  1NV3 A;  4EF1 A;  3G7W A;  1HSE A;  4RK9 A;  1J1N A;  5AA2 A;  4PDH A;  3B6W A;  1LGB C;  2FIX A;  2OPE A;  3I6V A;  3IX1 A;  3MVX A;  4JWX A;  4NWC A;  2KLF A;  4PFW A;  3QYT A;  2OZZ A;  2V3U A;  1B3H A;  2HZL A;  1JP4 A;  2XXX A;  3TCG A;  1BLF A;  2DWA A;  1NL5 A;  3C34 A;  3HST A;  3Q27 A;  4H1X A;  5ICT A;  3BBR A;  4AS5 A;  4THI A;  5EYH A;  5I5P A;  1LBZ A;  3CSG A;  4OMB A;  1MS7 A;  2OJT A;  4Z7E A;  1D9Q A;  3FXU A;  3U8Q A;  2O7I A;  4H6D A;  1LBB A;  3CFL A;  1OVB A;  1FRP A;  1B4Z A;  2ABH A;  1USY H;  4F3B A;  4DXB A;  1NV4 A;  5AA3 A;  1TWY A;  1DCU A;  3O6H A;  2OX3 A;  4H5F A;  3VLU A;  1YZ0 A;  3ONM A;  1K9Z A;  2ONS A;  1IME A;  3K2D A;  1PBP A;  3TDJ A;  3TKD A;  4ISU A;  1BTJ A;  5A5X B;  4EQ9 A;  4MNP A;  4PGP A;  4FED A;  5ELV A;  3HPI A;  5EHM A;  4PAF A;  3TTL A;  2R6G E;  2FBP A;  2QS4 A;  3KGC A;  3VFJ A;  4O7I A;  3IAZ A;  1B05 A;  3FAT A;  2H98 A;  1MY0 A;  2XWK A;  4F2O A;  5AA4 B;  1QKA A;  5H8H B;  4LZ8 A;  1PB8 A;  2VGQ A;  2YLN A;  4OXV A;  4JSD A;  3VLV A;  5I57 A;  4OVS A;  3W9W A;  2ZXT A;  1LAG E;  1O7T A;  5ET6 A;  2DWJ A;  4R2F A;  2Q2A A;  3TAJ A;  1IEJ A;  1RDX A;  5FTI A;  2H5Y A;  3UK4 A;  3R26 A;  1YXI A;  5DEX B;  1YPN A;  1AWB A;  4PGN A;  4NMY A;  4RJZ A;  4QSC A;  4G68 C;  3B7D A;  4P1L A;  2P3N A;  3N26 A;  1NV2 A;  1FBD A;  3OMB A;  3TEP A;  1B0H A;  3EHU A;  3B6Q A;  2REJ A;  1PEB A;  1Y4T A;  3RN8 A;  3H6W A;  2UVH A;  4RYA A;  1IZ1 A;  4O3B A;  3SDF A;  3ODB A;  2D5W A;  2XXK A;  2DVZ A;  3C35 A;  2OCU A;  4F18 A;  5FHO A;  2ONK E;  2CZH A;  4QFK A;  1FBG A;  2OWZ A;  4HCW A;  3Q26 A;  4NF8 A;  1RDY A;  2PT2 A;  1B58 A;  1WDN A;  5I2K B;  5EQA A;  2WBD A;  4R6Y A;  2CEX A;  4AQ4 A;  4C1T A;  2P3V A;  3TQW A;  4FEB A;  2F6P A;  1OQH A;  4OVT A;  2Q2C A;  3MVW A;  4JVC A;  3PPP A;  3QIM A;  2ANJ A;  1PBQ A;  3K01 A;  4F3P A;  4BDR A;  3PUZ E;  2QJE A;  5A5L A;  4G61 A;  1B52 A;  2CEY A;  4BDL A;  3K6V A;  4N4U A;  1MQI A;  3SZP A;  1IMD A;  1LFI A;  4I3E A;  2XXT A;  3K0V A;  2I6E A;  2RC8 A;  1FTK A;  2Q74 A;  3CG3 A;  1EYI A;  4ZEI A;  3B8B A;  3PPN A;  3LUZ A;  3ZS6 A;  5CBR A;  3TTK A;  5ICQ A;  4FOR A;  4MJO A;  4PF8 A;  5IZZ A;  2WBB A;  1FPJ A;  1LAX A;  4NWD A;  2R9J A;  2V3Q A;  2XX9 A;  2QS1 A;  2O1M A;  1KA1 A;  3KEI A;  3CVG A;  4PF6 A;  2P1S A;  1VDW A;  2P0S A;  5T3J A;  2FYI A;  4FAT A;  5H8Q B;  3LR1 A;  4XKQ A;  1FBC A;  1LBC A;  2PFZ A;  3C32 A;  4QFL A;  2ZNT A;  1NUW A;  3IO6 A;  2QL3 A;  1R9L A;  1NV6 A;  3DEL B;  5ESY A;  1NFT A;  4DZ1 A;  3U1O A;  3L6H A;  2GHB A;  2QMW A;  1KZ8 A;  4KCC A;  3G3J A;  3SEX A;  4ECF A;  5HPQ A;  1EYJ A;  3E4R A;  5KZT A;  4XKP A;  3JYR A;  4HS7 A;  3H3G A;  3SES A;  3IB0 A;  4F19 A;  3ISP A;  4JVI A;  2DDK A;  1S7Y A;  4DDD A;  1B40 A;  3FJ7 A;  3IL1 B;  4FE8 A;  5I59 A;  3DM0 A;  4ZE8 A;  4NF4 A;  3EKI A;  1B7Z A;  4QF9 A;  4WKM A;  3TTM A;  3DLN A;  4NF8 B;  3TFL A;  1GVC A;  4UAB A;  1MXZ A;  1ATG A;  2DSF A;  4NF6 A;  2PBW A;  5IZ3 A;  3JZJ A;  5CRY A;  4GWX A;  4GD5 A;  3FXR A;  4AB5 A;  1SI0 A;  3T0J A;  3Q29 A;  4PP0 A;  4GLI A;  5H8F A;  4Q0C A;  2H9B A;  2I3V A;  3KN8 A;  4OZ9 A;  1EU8 A;  3TPA A;  2I0C A;  4BDQ A;  4DIG A;  4HE0 A;  3FIR A;  3OEM A;  1ZU0 A;  4ZEB A;  5EQ8 A;  1P1O A;  2G29 A;  1MPD A;  2V3T A;  5I57 B;  5DVF A;  4ESX A;  5JTY B;  4G77 A;  3FXQ A;  1FQC A;  2Q8M A;  1Y4C A;  1ZKB A;  3RTF B;  2XXW A;  4QHQ A;  3OO7 A;  3PUW E;  4EDP A;  3O9P A;  3SER A;  1SDX A;  5DEX A;  3JV9 A;  5CMK A;  3SKP A;  1TT1 A;  1S50 A;  1D9Y A;  3E13 X;  3U94 A;  1UTH A;  2Y7W A;  4GVO A;  1F9B A;  3T22 A;  4KPT A;  3IR1 A;  1IQ7 A;  2OPD A;  2DWH A;  2NWJ A;  4PFR A;  4DE8 A;  4DLD A;  2X7P A;  1Y9U A;  1EH3 A;  1FBE A;  4XKR A;  2UVI A;  1FTJ A;  1B7H A;  5KCJ B;  3PD9 A;  3I5O A;  3OO9 A;  5L9S A;  1LB8 A;  2M8C A;  4OVJ A;  4PQJ A;  4IO3 A;  4R75 A;  1Q9D A;  4H67 A;  3MP1 A;  4KHZ E;  4HCY A;  1N0T A;  1XVX A;  1M5C A;  2F34 A;  4X8R A;  1XC1 A;  2F78 A;  2IA4 A;  1JNF A;  3LSW A;  1FQE A;  1MY1 A;  3H6V A;  4LQ5 A;  1MM7 A;  4LA9 A;  1EZO A;  4G8H A;  3IFC A;  2UVJ A;  4NF6 B;  3IOR A;  5CBS A;  1TXF A;  4IB2 A;  4ZEC A;  5BWJ A;  2DOJ A;  5I84 A;  3PD8 A;  3O28 A;  2JJK A;  5H8F B;  1MXV A;  2IEE A;  2XXI A;  3NOH A;  4JSO A;  2QVR A;  2B4L A;  1OIB A;  3PMX A;  1VFD A;  2UYE A;  1FTM A;  1NH7 A;  2I4C A;  2UXA A;  2ZYN A;  1MM6 A;  1IUD A;  4U21 A;  1NKX A;  2VOZ A;  2Q88 A;  5LOM A;  3AXF A;  2GH9 A;  4P47 A;  3SEV A;  4OA4 A;  3QUF A;  3OO6 A;  3ILU B;  4BDN A;  1I6A A;  1SW5 A;  4MBP A;  3M3F A;  3THI A;  4NX1 A;  3U72 A;  2HHM A;  1MXY A;  2XX7 A;  1FPE A;  4GL8 A;  1XI6 A;  4IY6 A;  3LUY A;  3PPO A;  3U93 A;  5IM2 A;  5TPA B;  1SVX B;  1SW4 A;  1BIY A;  3W9V A;  4XEQ A;  1MQJ A;  5K2Y A;  3ZKK A;  5LTC A;  2B4M A;  3IOU A;  4O7M A;  4N15 A;  3BIG A;  4I3Y A;  3IFA A;  1SPI A;  4TOZ A;  4H5G A;  1FPI A;  4O3A A;  4MF3 A;  3V83 A;  1YYZ A;  4H8I A;  1QGX A;  3KN7 A;  1XT8 A;  4MLV A;  1B4H A;  3CSB A;  4G8N A;  1EZ9 A;  3KSJ A;  2RKM A;  4EUO A;  1LBX A;  5I59 B;  1JVX A;  1Y3P A;  2HCA A;  2Z8D A;  2Q89 A;  3LC8 A;  1MY4 A;  1QVS A;  4GF8 A;  2QFL A;  2F7B A;  4YB5 A;  4LVQ A;  4IGT A;  5F7V A;  1ELJ A;  1P1U A;  3KBR A;  3FVN A;  5IZ3 B;  4JB7 A;  3FV1 A;  3EN3 A;  1UIV A;  2V93 A;  4MHF A;  3KFM A;  1YCJ A;  1Q1K A;  1B32 A;  2ZYK A;  4IGR A;  3TZA A;  1GTK A;  5DT6 A;  1NUY A;  3BIH A;  2YJP A;  1BKA A;  1ZLQ A;  3S9E A;  3MWB A;  1FPB A;  3RT6 B;  4YZZ A;  1KWH A;  4OFL A;  1BP5 A;  1XS5 A;  4GBW A;  3G3K A;  1Z7N E;  3PPR A;  3VVE A;  5FTH A;  4QRZ A;  3TCH A;  2D21 A;  3FVG A;  2WYP A;  4P9K A;  1FW0 A;  3FV2 A;  1AIV A;  1LFH A;  2A5T A;  3MPL A;  1D3K A;  5DVI A;  3KSX A;  2D3I A;  2P2A A;  2V25 A;  4DCX A;  4Q8R A;  3RGY A;  1MQD A;  3OSQ A;  1B5H A;  3PTY A;  4MX6 A;  1DMB A;  4Z0I A;  4YB6 A;  1IMA A;  1N7X A;  2AL5 A;  5AE4 A;  1UTH B;  3PMV A;  3E79 A;  2CZK A;  1IIT A;  3LBS A;  3G3F A;  4G8M A;  3PPQ A;  2FIE A;  3R6U A;  3EPE A;  4QSE A;  5ET7 A;  1RYO A;  2Y5K A;  1LAF E;  4PFI A;  1NNF A;  5CC2 A;  4GQO A;  2HFB A;  2XXP A;  2QVU A;  5TPA A;  4MEV A;  4KD5 A;  4NF0 A;  2CZL A;  4DI4 B;  4U22 A;  4P8B A;  1CB6 A;  2XD2 A;  2QVV A;  2X26 A;  4OQO A;  3HHG A;  1H3D A;  1L5T A;  5DTB A;  1NUZ A;  3D1R A;  5CMM A;  3FJM A;  3RNN A;  3MZB A;  1WVJ A;  2HAU A;  5IAI A;  3OSR A;  4LN5 A;  4E0W A;  4NE4 A;  5IZ1 A;  4UA8 A;  2QSX A;  3OOA A;  4NF5 A;  3MAM A;  2YPN A;  4LAT A;  3K6X A;  2HQ0 A;  1T0K A;  5TP9 B;  1RDZ A;  2AIX A;  2V4C A;  3OXN A;  1RYX A;  1SBP A;  2XXY A;  3CFX A;  3MVY A;  1BK4 A;  4GWZ A;  4MNI A;  4H45 A;  4X1D A;  3CFZ A;  5HBC A;  4H0W A;  4AS4 A;  4PDD A;  1ZTY A;  2DXR A;  3SEW A;  2DYX A;  1IMB A;  2E0S A;  3IB2 A;  3KC0 A;  4AB6 A;  2DWI A;  2DE4 A;  4NN3 A;  2F97 A;  1I69 A;  4O94 A;  4POW A;  2FNC A;  3TYH A;  4OEN A;  1ANF A;  3FAS A;  5I58 A;  1AL3 A;  4K3F A;  3RY3 A;  4YAH X;  3T9U A;  2Z8E A;  4DCY A;  1HSJ A;  1USY E;  1N3X A;  1FQD A;  2L5V A;  2Y5L A;  4H65 A;  2O84 X;  4RPO A;  2NVU B;  3LSX A;  3T96 B;  3UGW A;  4JWO A;  5ITP A;  4MIJ A;  4OVP A;  3H7M A;  4PFB A;  1II5 A;  4OET A;  3PMW A;  2QPQ A;  1PDA A;  1MG1 A;  3DP8 A;  1N04 A;  3BFU A;  2Y7I A;  2B65 A;  2AL4 A;  2THI A;  3K02 A;  4IO4 A;  1FBP A;  3SEY A;  1Y3Q A;  3RPL A;  1K9Y A;  4N6P A;  1VE4 A;  2DVC A;  2X7Q A;  3MYU A;  1PB9 A;  4MCO A;  5IKB A;  2R8T A;  4I9D A;  3MZ9 A;  1QJM A;  3ROJ A;  3M3L A;  5F24 A;  1A54 A;  2DE2 A;  1IXH A;  3SEU A;  2UVG A;  4IO5 A;  3LV0 A;  1LCT A;  4EXK A;  3MJN A;  5ISU A;  1N84 A;  2VD3 A;  3BKI B;  1IXC A;  2G93 A;  2CMO A;  4QBA A;  4IR8 A;  5B7D A;  1MQH A;  1NV0 A;  4NF4 B;  2Y7R A;  2ONR A;  4PFU A;  2ZZV A;  1VFE A;  4DI3 D;  1XHY A;  2ZNU A;  4NF5 B;  5ET5 A;  3E3K A;  4F1V A;  1US5 A;  4N91 A;  5EQ9 A;  4KQP A;  4XTC Q;  2GQ1 A;  3FGS A;  4R6K A;  2OWT A;  1NNT A;  3PUV E;  3Q25 A;  5CMC A;  4XXU A;  4NHB A;  1DBZ A;  5DYH A;  3MW0 A;  3VV5 A;  3BFT A;  3DP4 A;  4YU0 A;  2R71 A;  3LSF B;  3VXB A;  3N6T A;  3MVZ A;  1Y20 A;  2VD2 A;  2WX9 A;  5EHS A;  2B3B A;  4FEC A;  1URD A;  3O66 A;  4R9F A;  3UP9 A;  1MXU A;  4IO2 A;  2ZYM A;  1FCK A;  4WED A;  3A3U A;  3N6U A;  1NMU A;  3EQ1 A;  3V5A A;  4GIZ A;  2WKY A;  4GWY A;  1R6Z A;  3V8X B;  2FHY A;  3S4U A;  2WYK A;  3QSL A;  3FZV A;  2V84 A;  3P7I A;  1MH3 A;  3HCQ A;  4LON B;  4ZZA A;  2XD3 A;  2O51 A;  3VXC A;  1JW4 A;  2H99 A;  4X9T A;  4QFO A;  4R9G A;  3U65 A;  3GYY A;  4I40 A;  1SD3 A;  1URG A;  4ESW A;  3MP8 A;  3RPL B;  3M8U A;  1B7U A;  4PCD A;  1SYI A;  1SW1 A;  2BJI A;  3UN6 A;  2E1S A;  4TLL B;  4P3L A;  3TOD A;  1DSN A;  1B0L A;  1EYK A;  5ET8 A;  5EQ7 A;  3KZG A;  4PE5 B;  1LFG A;  3O6I A;  3FD3 A;  3C36 A;  1G0I A;  3LSL A;  1QW0 A;  3FUZ A;  4ZE9 A;  4PAI A;  1POT A;  2OWS A;  3ZKL A;  1AOV A;  1LAH E;  4GX4 A;  3MUQ A;  4I8C A;  2HZK A;  4N8Y A;  3L6G A;  1EZP A;  1URS A;  2B3F A;  1FTL A;  1B5J A;  5I2K A;  3MZ1 A;  3TEL A;  3OO8 A;  3EHS A;  4U4S A;  4OYV A;  4F31 B;  4QSD A;  4IO7 A;  2NOO A;  4LUB A;  2Q9T A;  3A09 A;  1H76 A;  4OEU A;  4R73 A;  1M5E A;  1P1W A;  2HXW A;  1AH5 A;  1LEV A;  1NH8 A;  1HSL A;  3DP6 A;  1B1X A;  3A29 A;  5K2X A;  1P1Q A;  4FIM A;  2QRY A;  1O63 A;  4JXI A;  1JQF A;  2NXO A;  4PFT A;  3B6T A;  1A8F A;  3RT8 A;  1S9T A;  4RXL A;  4F39 A;  2XXR A;  4P56 A;  4E0X A;  3RQT A;  5CI5 A;  3FJG A;  3RUM A;  3K6U A;  4OEV A;  1FQF A;  2KQZ A;  4ELP A;  3S9L C;  4C0R A;  4I62 A;  3KJT A;  4IY5 A;  2ZNS A;  2HEU A;  1G0H A;  4OES A;  4I1D A;  4F3G A;  3S9M C;  3EF7 A;  5H8Q A;  2HPG A;  3VVF A;  3TUS A;  3O6G A;  5FHM A;  3U92 A;  4U2R A;  2BJJ X;  5DVJ A;  4NQ8 A;  5KDT B;  3O97 A;  3T9V A;  2Y7K A;  5I56 A;  4ELO A;  1CE2 A;  3H4Z A;  1A55 A;  4GXS B;  5JK4 A;  2RC9 A;  4GXA A;  3GLB A;  4MH5 A;  1A7L A;  1FJ6 A;  2RC7 A;  1FPL A;  3RYD A;  2LAO A;  1IXG A;  3GZG A;  4OER A;  4N17 A;  3TMG A;  1FTO A;  1Y1Z A;  5J16 A;  4P0I A;  4HXV A;  2GRV A;  3O2A A;  4GWO A;  2FVZ A;  1JVY A;  3N94 A;  2F7A A;  4LQ2 A;  3CIJ A;  1VR5 A;  4GOT A;  3G3I A;  3OEL A;  3FBP A;  2QS2 A;  4MLQ A;  3TTR A;  1MRP A;  2F3D A;  4YKJ A;  1QUJ A;  1SQY A;  1OMP A;  2F35 A;  5L9O A;  3RPW A;  2OLB A;  1MPC A;  4N6K A;  1AMF A;  1KA0 A;  4HE2 A;  1MH4 A;  2I48 A;  3IJX B;  4F2Q A;  4LZ5 A;  2Z22 A;  2ALU A;  2PYY A;  2ZZX A;  1DOT A;  1JW1 A;  5H8N A;  4JVD A;  2VPN A;  4NAP A;  2I4B A;  3PV0 E;  1VSO A;  5EYG A;  4BDO A;  3KBZ A;  5EYF A;  1INP A;  3MST A;  3B50 A;  4U23 A;  3T9X B;  2RF1 A;  4POX A;  2HAV A;  5F1Q A;  3RLF E;  1FQA A;  4HW8 A;  1B9J A;  3WAF A;  1M5F A;  4HE1 A;  1B3L A;  3ZSF A;  5AA2 B;  3V89 B;  4H46 A;  1FSA A;  1B5I A;  2XWO A;  5CMB A;  4GWS A;  2XXV A;  2QMX A;  5DW8 A;  4EF2 A;  4X1B A;  1RKM A;  1ZIU A;  3CR9 A;  3UA8 A;  4GL0 A;  4ZDM A;  1B6H A;  4KYD A;  4ZZE A;  5I2N B;  3ECR A;  1B3E A;  3IOT A;  1IMF A;  2AYS A;  4KR5 A;  2Y84 A;  4OWD A;  5AA2 D;  3PUX E;  4ZS9 A;  5L9M A;  1DTG A;  3CG1 A;  4PTK A;  2ESN A;  4LZ7 A;  1FPG A;  1JEV A;  1MDQ A;  1MPB A;  1A99 A;  4EXL A;  5IGA A;  4R6H A;  3MPK A;  4NTL A;  2XA5 A;  4KXP A;  4N07 A;  1Q35 A;  3HHF A;  3UOR A;  1YTV A;  4G68 A;  1N7W A;  4JDF A;  5TU0 A;  2I0B A;  4Q5T A;  3C33 A;  1CNQ A;  4BLA A;  4PBH A;  3M3K A;  2RCA A;  2VPO A;  5A5X A;  1OVT A;  2MKZ A;  3VVD A;  3EHT A;  1B51 A;  4X48 A;  2OBG A;  4OHN A;  3FVK A;  3OD7 A;  1TFD A;  5JTY A;  2DQV A;  4PAK A;  2FA7 A;  3QK6 A;  5H8N B;  1H44 A;  4R72 A;  2XXU A;  3IOW A;  4GBV A;  2OK2 A;  5LDZ A;  4NED A;  3T9H B;  1Z7M E;  2O1L A;  1JW5 A;  1FBH A;  4TQU Q;  3K1M A;  3T1B A;  1PB7 A;  2Z23 A;  3K6W A;  4YIC A;  3A3C A;  3E9X A;  4N6D A;  1YAE A;  3T66 A;  1XVY A;  2KR0 A;  2W7Y A;  3IO4 A;  4L17 A;  5KDT A;  4RK2 A;  1ZMG A;  3T93 B;  2F3B A;  1JEU A;  1Y3N A;  1QUL A;  3IK6 B;  1ZJL A;  2XXH A;  1LST A;  1N76 A;  5KCJ A;  4OFO A;  3QMF A;  4DXC A;  1FTA A;  2XWV A;  3IB1 A;  2VHA A;  3N5L A;  4U1O A;  4GFR A;  4MMP A;  4YMB A;  5J1D A;  4XF5 A;  3O29 A;  3F11 A;  2F8D A;  1XOC A;  4MNC A;  4ELR A;  1O64 A;  4OTE A;  1SW2 A;  3H03 A;  2Y7P A;  1D9V A;  2O7U A;  3GBA A;  1B3F A;  3S2V A;  1FJ9 A;  4KYE A;  1LBW A;  4G2Z A;  4ONY A;  2PFY A;  4H8J A;  1MXX A;  2QS3 A;  3K4U A;  4EQB A;  3Q28 A;  2DP8 A;  3MBP A;  1B3G A;  3VDF A;  3UIF A;  1FPK A;  3RTW B;  1NI9 A;  5B70 A;  1I6Q A;  4JBZ A;  4RNS A;  4UAC A;  4R2B A;  4P11 A;  4OVQ A;  4PFY A;  4LP2 B;  1IMC A;  3HO7 A;  4OAN A;  4PC9 A;  1LB9 A;  4F1Y A;  1DK4 A;  4G4P A;  2REG A;  2HXR A;  3IJO B;  3C4M A;  1M5B A;  3TTN A;  3H6T A;  3D4G A;  1LLS A;  1FQB A;  2XHD A;  2GHA A;  4JWY A;  4C1U A;  3KOT A;  5HM4 B;  1B46 A;  5AA1 A;  4KFQ A;  1GR2 A;  1UTB A;  2PT1 A;  5I2N A;  3GXA A;  1LBV A;  3H06 B;  1SI1 A;  3S9N C;  3HV1 A;  4ND9 A;  4IO6 A;  4MFI A;  4PBQ A;  3HFU A;  4R74 A;  2PMS A;  2F36 A;  3KN3 A;  1NUX A;  2XWI A;  3KC1 A;  1H45 A;  3ILT B;  1UQW A;  2DS9 A;  3KJ7 A;  3R7X A;  5M2V A;  3K00 A;  1POY 1;  4KCD A;  1M5D A;  3MC2 A;  2DXY A;  1B1H A;  1P1N A;  4P1E A;  2CZI A;  4PE3 A;  1MDP 1;  1WOD A;  4YB7 A;  4G68 B;  3USD A;  1IXI A;  3IOV A;  1PC3 A;  3D4C A;  4U4X A;  2O68 A;  4YKK A;  3QAX A;  1NNK A;  3VLW A;  4ZEK A;  4U1Z A;  5I7I A;  1NV7 A;  3QXM A;  3WAE A;  2VT5 A;  2A5T B;  4F1U A;  1QUI A;  1DPP A;  1A40 A;  5FHN A;  4GWU A;  4F3S A;  4PET A;  1OQG A;  4ZEF A;  4TLM B;  2O69 A;  1US4 A;  1MQG A;  4F29 A;  1FPF A;  4NG7 A;  5I58 B;  4XIG Q;  2Q8J A;  4OVR A;  2UYF A;  1GGG A;  4EQ7 A;  4GWW A;  1FPD A;  2RCB A;  4RA1 A;  3PUY E;  2Z8F A;  1NV5 A;  1LBY A;  5AA4 A;  2I3W A;  2O6A A;  1NV1 A;  3E78 A;  4GRK A;  3K1N A;  5FBP A;  3CHG A;  1B2H A;  4NGU A;  2ZZW A;  1R1N A;  3I3V A;  3C9H A;  1DTZ A;  1I6B A;  3OEK A;  3G3H A;  4BDM A;  4ELQ A;  3C31 A;  1UTB B;  1QKB A;  3H6U A;  4M4G A;  5I56 B;  1NNP A;  4WEP A;  4MAG A;  4ZED A;  2I58 A;  5ITO A;  2PVU A;  4RPN A;  5JEI A;  4FAJ A;  1OLA A;  4N8G A;  1TFA A;  2A5S A;  1QUK A;  3TCF A;  3CRB A;  5BUU A;  1IIW A; 
#chains in the Genus database with same CATH homology
 1RDX A;  2Y5K A;  3T1B A;  1FPL A;  4GX3 A;  3RYD A;  4PFI A;  5DW8 A;  4YIC A;  1LBX A;  4MJO A;  4N6D A;  4PF8 A;  1YXI A;  2WX9 A;  5IZZ A;  2WBB A;  4MIJ A;  4N81 A;  1FPJ A;  2QVU A;  4OVP A;  2HZL A;  1JP4 A;  4MEV A;  4N17 A;  1NV7 A;  5I7I A;  2KR0 A;  1AWB A;  2V3Q A;  2QFL A;  5J1D A;  4NF0 A;  2Q9T A;  4HE0 A;  4PFB A;  2VT5 A;  5I3S A;  4PGN A;  4DI4 B;  5J16 A;  4OVQ A;  3IFC A;  4F1U A;  5EQ8 A;  1KA1 A;  4HXV A;  2QPQ A;  4P8B A;  1IMC A;  4GWU A;  2QVV A;  4M1V A;  4PET A;  4OAN A;  2F3B A;  4AS5 A;  1IMF A;  1FBF A;  5EYH A;  4PF6 A;  4P1L A;  5I5P A;  1LBZ A;  1VDW A;  2FVZ A;  2P3N A;  4PC9 A;  4N8G A;  1NV2 A;  5T3J A;  1DK4 A;  1LEV A;  1FBD A;  1D9Q A;  4QXD A;  5IZ3 B;  1NUZ A;  1FBC A;  3D1R A;  2DE3 A;  1FPF A;  3A29 A;  4GWY A;  4NG7 A;  1FBP A;  2HXR A;  3RPL A;  2FHY A;  4MHF A;  1K9Y A;  2PFZ A;  2WYK A;  3QMF A;  2JJK A;  4PTK A;  1NUW A;  2Q8M A;  4OVR A;  4O8M A;  1FTA A;  4FBP A;  2XWV A;  1NV6 A;  1FPG A;  1NUY A;  3MYU A;  3BIH A;  4MCO A;  4GWW A;  1FRP A;  5ESY A;  2R8T A;  3NOH A;  4LN5 A;  2QVR A;  2B4L A;  5IGA A;  3FBP A;  1FPD A;  5IZ1 A;  1NV5 A;  2PCR A;  2XXK A;  4X04 A;  5CM6 A;  4GX6 A;  2DVZ A;  4MMP A;  3ROJ A;  2F5X A;  1FPB A;  1NV4 A;  2F3D A;  5F24 A;  4KXP A;  2XA5 A;  4X9T A;  4XFE A;  4XF5 A;  1LBY A;  1KZ8 A;  4YZZ A;  2CZH A;  2DE2 A;  4F18 A;  4GBW A;  1FBG A;  2OWZ A;  1DCU A;  1NV1 A;  2OX3 A;  3FXB A;  4HCW A;  1YZ0 A;  1RDZ A;  3U65 A;  4N6K A;  2V4C A;  1RDY A;  1LBV A;  3LV0 A;  1EYJ A;  4MNC A;  3GYY A;  4P56 A;  4I40 A;  1KA0 A;  4HE2 A;  1K9Z A;  2WYP A;  1IME A;  5EQA A;  4P9K A;  2ZZX A;  1BK4 A;  3E78 A;  2WBD A;  3RPL B;  4GWZ A;  4JVD A;  2CEX A;  4P47 A;  4OA4 A;  4MNI A;  4H45 A;  2VPN A;  4PCD A;  4PBQ A;  3HFU A;  2P3V A;  2KQZ A;  4NAP A;  4F19 A;  5FBP A;  3ISP A;  4JVI A;  2DDK A;  4AS4 A;  2BJI A;  3CHG A;  4PDD A;  4QBA A;  1FJ9 A;  4IR8 A;  4PFR A;  1LBW A;  4NGU A;  5EYG A;  1NV0 A;  4MNP A;  4OVT A;  4PGP A;  1NUX A;  2ZZW A;  1IMB A;  1CNQ A;  1G0H A;  3KBZ A;  3KC1 A;  2XWI A;  4PBH A;  1INP A;  2ZZV A;  4JVC A;  3KC0 A;  4P3L A;  4DI3 D;  2DE4 A;  3MST A;  2VPO A;  2PFY A;  4NN3 A;  4NX1 A;  4PAF A;  2WEF A;  2MKZ A;  2HPG A;  4O94 A;  2FBP A;  1FBE A;  2HHM A;  5ET5 A;  1EYK A;  5ET8 A;  3B50 A;  5EQ7 A;  3EKI A;  4O7I A;  1FPE A;  5A5L A;  4G61 A;  3PTY A;  1XI6 A;  4F1V A;  1NV3 A;  4N91 A;  2CEY A;  4MX6 A;  1G0I A;  2XWK A;  5IM2 A;  4NQ8 A;  4PAK A;  4P1E A;  1IMA A;  5EQ9 A;  4UAB A;  4N4U A;  2CZI A;  4MAG A;  4PDH A;  4XEQ A;  3W9V A;  3SZP A;  5LTC A;  4PE3 A;  2GQ1 A;  2B4M A;  2FIX A;  4O7M A;  1IMD A;  1Q9D A;  4N15 A;  4HE1 A;  3BIG A;  4I3Y A;  4I3E A;  2CZK A;  3E79 A;  4PAI A;  3IFA A;  4GBV A;  1SPI A;  5LDZ A;  4HCY A;  4OVS A;  1FPI A;  4GX4 A;  5IZ3 A;  2L5V A;  3W9W A;  2FIE A;  4X8R A;  1YYZ A;  2Y5L A;  4NHB A;  1FPK A;  5JK4 A;  4H46 A;  2Q74 A;  1FSA A;  1QGX A;  5ET6 A;  2HZK A;  1DBZ A;  1EYI A;  4GWX A;  5ET7 A;  2XWO A;  3B8B A;  4N8Y A;  1NI9 A;  1FJ6 A;  3LUZ A;  1FBH A;  4GWS A;  3T0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...