5J16A

Crystal structure of inositol monophosphate bound saimpase-ii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
258
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Inositol monophosphate bound SaIMPase-II
rcsb
source organism Staphylococcus aureus (strain mssa476)
total genus 77
structure length 258
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5j16A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j16A02
1NV4A 1JP4A 3A29A 1KA1A 3KC1A 5IZ1A 1NUWA 5F24A 4GWUA 2F3DA 4MJOA 3KBZA 1NV0A 4GWSA 2QFLA 3D1RA 4HE1A 2P3VA 4FBPA 5EQAA 5IZ3A 2QVRA 1CNQA 1FPIA 5J16A 1YXIA 3FBPA 2QVVA 1FBFA 1KZ8A 5I3SA 2F3BA 1FBPA 1LBWA 3QMFA 1YZ0A 4GBWA 4H46A 1IMDA 1FBHA 2PCRA 1QGXA 1Q9DA 5EQ9A 1DBZA 1NV2A 4AS5A 1FSAA 2R8TA 4GWXA 1FPLA 4GWZA 1EYIA 1FBEA 4HE2A 1FPEA 4AS4A 1FJ9A 2Q74A 5DW8A 3BIGA 2DDKA 4HXVA 1FPGA 1LBVA 1SPIA 1BK4A 5EQ7A 3RYDA 1FPKA 4N81A 1EYKA 2OWZA 4O7IA 1FPBA 5ET6A 1FJ6A 5EYGA 1NV5A 2QVUA 2FIXA 1IMBA 4GWYA 5ET8A 1NUZA 1IMEA 1NI9A 5EYHA 1D9QA 1RDXA 4HE0A 4GWWA 5ESYA 2FBPA 5LDZA 1NUYA 2WBBA 3RPLA 1KA0A 4I3YA 1LEVA 2HHMA 3BIHA 1IMAA 4H45A 4GX4A 5FBPA 4I3EA 1FTAA 1FBCA 3B8BA 1NV1A 5IZ3B 1G0HA 1FPJA 1IMFA 1LBZA 1IMCA 2FHYA 1NV6A 5EQ8A 2CZHA 1YYZA 2JJKA 1LBXA 5ET7A 5A5LA 5ET5A 3LUZA 4I40A 2CZKA 2Q8MA 2WEFA 4PTKA 1FPDA 2VT5A 2BJIA 1XI6A 2WBDA 4GBVA 1NV3A 1NV7A 1RDYA 1FRPA 3RPLB 1G0IA 3ROJA 3T0JA 1RDZA 1AWBA 3LV0A 2GQ1A 4QXDA 1K9ZA 1FBGA 4GX3A 1NUXA 2Y5LA 1LBYA 4GX6A 3IFAA 4KXPA 1DCUA 2CZIA 1DK4A 4IR8A 2OX3A 1FPFA 3IFCA 5T3JA 2P3NA 1EYJA 2FIEA 1INPA 2FVZA 2Y5KA 1VDWA 1FBDA 1K9YA 4G61A 3KC0A
chains in the Genus database with same CATH superfamily
4LVQA 1MQDA 2F6PA 4YB5A 3KBZA 3RT6B 4GRKA 2CMOA 3DP8A 3RNNA 1DTZA 1LB8A 3TTMA 4H0WA 4HCWA 3Q29A 3TTLA 3ZS6A 3VVEA 3I5OA 5I7IA 1B2HA 4H5GA 4MHFA 3RTWB 3SESA 4GXSB 2RCBA 4L17A 3C36A 5EQ7A 3QYTA 2OWZA 2DXRA 4KCDA 3U72A 1H3DA 4NMYA 2QVUA 3O6HA 3KZGA 1FW0A 4POWA 4BDMA 4GWYA 3K1NA 3GZGA 4OFOA 4U23A 4KPTA 3TKDA 1UTBA 4O8MA 2XWIA 3RPLA 2ZNTA 1NMUA 3LUYA 4ZEBA 4NHBA 5KZTA 4F31B 2DVZA 3RUMA 2ONKE 4MFIA 1XHYA 5H8FB 2OPDA 4F3BA 1I69A 5ET7A 4ZDMA 1IXGA 3H4ZA 2GH9A 4YZZA 5DT6A 1FPDA 1JW1A 2D21A 5I5PA 2LAOA 5FHNA 4XTCQ 3H6VA 4MEVA 3I3VA 3IB1A 4KFQA 1B3GA 2HAUA 1US5A 4KYDA 3LSWA 3IFAA 1BTJA 1B0LA 2P3NA 1P1WA 2QMWA 3MQ9A 3C4MA 1EZ9A 2L5VA 4GLIA 1ZIUA 3ZKLA 3O6IA 2NUVA 3U93A 1IXHA 1Q1KA 3KFMA 1UTBB 2QVRA 3MJNA 3P7IA 3IOUA 4PE5B 5EHMA 4H46A 2OPEA 1OQGA 1XVXA 3MVYA 1N3XA 2ONRA 1B6HA 1Y4TA 4UACA 1XVYA 1TFAA 3IO6A 2XX8A 3PPPA 4LQ5A 4RYAA 4NQ8A 4JWOA 4QFLA 3A3CA 3MYUA 2ABHA 5ET8A 5DEXA 1N04A 1B52A 2AYSA 2KR0A 3PPQA 1PB8A 1NH8A 3PV0E 5BUUA 1CE2A 1F9BA 2DSFA 2H4IA 5AA2A 4OVPA 2B4MA 4IY6A 4F29A 2F7BA 1SQYA 3ISPA 1IMCA 4EQ9A 3MPKA 3MP1A 1NNPA 4PFYA 2DE4A 4LZ7A 4UA8A 3ROJA 3MWBA 4ECFA 3W15C 3VFJA 3CSBA 2UVIA 4OVTA 2H5YA 1FBDA 3RLFE 1AOVA 1FTJA 3U92A 5DEXB 3RGYA 5F24A 2RKMA 4IO5A 2G93A 2I0BA 5JTYA 4GWSA 4NF6A 4ZZEA 3N26A 3IO4A 1FPIA 3HO7A 3MZBA 3C34A 2ONSA 4OXVA 1SVXB 2P0SA 1N7XA 3FV1A 3CI8A 2VPNA 3B50A 2H99A 4WEPA 5ELVA 5CBRA 3OELA 1MDP1 4KYEA 1MPCA 4P11A 2DWJA 4G2ZA 1B05A 5K2YA 2F34A 1R6ZA 4P0IA 2NXOA 1NUZA 1VR5A 3OO9A 1LAHE 4JSDA 3QUFA 4GD5A 5JTYB 1FTAA 4NF6B 4X1BA 3TELA 2FNCA 4QSDA 1MS7A 4ISUA 4LONB 4KHZE 5EQ8A 4P8BA 5ET5A 3T66A 2WEFA 1B4ZA 2VT5A 1ELJA 3T9VA 2B3BA 2Y7RA 3CFXA 3UP9A 4BDNA 5ISUA 2WKYA 4RK9A 3KC1A 1US4A 4AB5A 1DPEA 2F8DA 1LBCA 2DYXA 2H98A 2QPQA 1NV0A 4YKIA 4F18A 1MY1A 2XXVA 5I59A 4FIMA 5IZZA 3V89B 5H8HA 4GIZA 4U4SA 4F3GA 4IO3A 3FIRA 3VLUA 2V84A 5I56B 3T9UA 2HXWA 4GWZA 3OEMA 3VXCA 4XIGQ 1FJ9A 4Z7EA 2XXTA 4QFNA 4FATA 3VVFA 1B1HA 1URGA 1SDXA 3KSXA 2RC9A 2IEEA 4O3BA 2XD3A 4PGNA 3FXQA 4U1OA 1N84A 3TTKA 3GBAA 5HBCA 1DSNA 4PFTA 4QRZA 1NNKA 1I6AA 4QSEA 4IO7A 4ONYA 4R72A 2XXPA 4RPOA 1G0HA 2VGQA 3VDFA 2XHDA 4LUBA 5H8HB 2OBGA 1URSA 3FJMA 3ZKKA 3VVDA 4GBVA 2AL5A 2Y7PA 4JWXA 3KN7A 3TFLA 1PB7A 2FIEA 1INPA 1FCKA 1SYIA 4N4UA 2ZZWA 1EU8A 4GWUA 1VE4A 3EN3A 3TMGA 3CG1A 1FQAA 2QFLA 3C32A 2Y7IA 1ANFA 4HE1A 4OVSA 3SEXA 3D4CA 3FBPA 4NWDA 3T96B 4NF4A 4RY1A 2RCAA 1KZ8A 5CC2A 3UORA 2RINA 1B9JA 1QGXA 4M1VA 2ZZVA 4AS5A 3TEPA 3S4UA 4R9GA 5HM4B 3FXRA 4NN3A 3KGCA 1SI0A 1FPKA 2XXHA 4P0GA 4BDRA 3TTNA 1YAEA 1NI9A 3LBSA 3V83A 5CM6A 1POTA 4GXAA 1XC1A 2DVCA 2I58A 4I3YA 1DOTA 2PFYA 3S9NC 1M5CA 2D3IA 1ATGA 4G8MA 5B70A 3H6WA 1AH5A 4NF4B 4RNSA 2XWOA 1LFGA 1LBXA 2OWSA 3MUQA 4FORA 3PUXE 1GR2A 4C0RA 1D9YA 3LV0A 1O63A 1K9ZA 4N91A 4OWDA 1IZ1A 1DCUA 1EYJA 4BDOA 4PQJA 2DQVA 1K9YA 1NV4A 1JVYA 3NOHA 4OANA 3RTFB 5IZ1A 1MY2A 5LOMA 3ILUB 1B7UA 4ZEDA 1NL5A 4G77A 4MLQA 4P3LA 2QSXA 3H6UA 4AB6A 2XWVA 4FJPA 1M5EA 2QS4A 3SEUA 5F7VA 4ZS9A 5CMMA 1OVTA 4I8CA 2XX7A 1B3HA 1LBWA 3S9EA 4IO4A 4Z0IA 4G68A 1URDA 4C1TA 2I3VA 1DBZA 5J1DA 4PF8A 2O68A 2Q74A 5DW8A 3MPLA 3ODBA 4IO2A 2KLFA 1SPIA 4PAFA 3BBRA 1MQJA 5H8FA 5CMCA 5M2VA 1TT1A 1FJ6A 3OXNA 1B51A 2FIXA 2HEUA 2QRYA 4U22A 3G3GA 1GVCA 3OO8A 3USDA 4IY5A 2O84X 3FVOA 2XWKA 4YB7A 4DXUA 5A5XA 3JV9A 5I57A 1LAGE 3IB0A 3PPRA 2DE3A 1YPNA 4K3FA 3U8QA 4NGUA 3KOSA 3G3JA 4PC9A 2DXYA 2VP1A 1H45A 3IOWA 3K00A 3G3KA 2CZKA 2Q8MA 1WVJA 4G68B 1FRPA 4RXLA 2VD3A 3ECRA 4PDHA 4KXPA 4KI0E 3EHTA 4E0WA 3C9HA 1SW5A 2Z8FA 4G61A 2DWIA 3K01A 1JP4A 1TXFA 4GF8A 1N76A 3SERA 2F6GA 3IB2A 2Q2AA 2X26A 1I6BA 2XXYA 4O3CA 3N6TA 5EQAA 1L5TA 3K1PA 4OFJA 5A5XB 5I57B 1VFDA 1UIVA 2R6GE 3E3KA 2OCUA 4NG7A 1D3KA 2F3BA 2AL4A 3TZAA 4EF2A 1Q9DA 1LCFA 5FTHA 1FPLA 1MH3A 3K0VA 3KG2A 2XXIA 3BFTA 3KEIA 3BIGA 1VFEA 4XKRA 4PFBA 3FXUA 1MPBA 2HAVA 3SEVA 1P1OA 4QHQA 2X7PA 1SI1A 1Y3QA 2FBPA 1KA0A 1AMFA 4R9FA 3K6UA 5LTCA 3WAEA 3GYYA 2QS3A 4PFRA 4OHNA 1MM6A 1B5HA 1NV1A 1DMBA 3T1BA 4NAPA 4EQ7A 2Z23A 4O94A 2HQ0A 1B1XA 4OERA 4QFPA 3UK4A 1XS5A 1QVSA 3ONMA 3N94A 3OEKA 1MDQA 3T0JA 1RDZA 1NFTA 5L8DA 4IGRA 4DIGA 2YJPA 1FTOA 4DE8A 4QF9A 4RK2A 3MBPA 4XKQA 3G3FA 1VSOA 2I3WA 3IAZA 1B5IA 3IR1A 4KD5A 2FA7A 3EHUA 4X9TA 3E13X 1IXIA 4GL0A 1NKXA 2UYEA 1B7HA 5J16A 3IL1B 1XOCA 1LAFE 1LB9A 3UIFA 2Q9TA 5KDTA 5DVJA 3C33A 2F36A 1SBPA 1MQHA 4OMBA 4OA4A 4F1VA 3UGWA 1YZ0A 3LSLA 3VV5A 4YB6A 4HW8A 3TODA 4NF0A 1JEVA 5EQ9A 4ELRA 4NWCA 2Y84A 3W9VA 4ZEIA 1LBVA 1BK4A 4LN5A 4OENA 3OSRA 1EYKA 1GGGA 4H5FA 4DI3D 4DXBA 2BJJX 3MVWA 1EH3A 4NEDA 5AA2D 5KCJA 1RDXA 4R2BA 2F5XA 2QMXA 3K1MA 3IJXB 2HCAA 3LSFB 2VOZA 2OZZA 4MNIA 3HPIA 4TLMB 1MXUA 2QJEA 2XD2A 1FQDA 2Y7WA 3HHFA 3CVGA 3UA8A 2PX1A 2FHYA 2OJTA 3S9MC 2B4LA 3R6UA 5KDTB 1FTMA 4N8YA 3IOVA 4I40A 5H8NB 5L9SA 4X1DA 1XI6A 2WBDA 2E0SA 2UVJA 4MNPA 4N6KA 4ESXA 3VE1B 2CZIA 1DK4A 1FPFA 2WX9A 4P1EA 5I56A 1Y3NA 2P2AA 3M8UA 5IAIA 2QS2A 4NF5A 5KCJB 3CHGA 3MVXA 4TLLB 2PFZA 5CBSA 2P3VA 5IZ3A 1B3LA 1N3WA 3E79A 1XT8A 3H7MA 5IKBA 2QVVA 4MNCA 3M3FA 2ZYNA 5I58A 4POXA 3DELB 5CMKA 4I62A 1Q35A 1IMDA 2G29A 3PTYA 1P99A 4OEVA 4OVJA 3T9HB 3N5LA 1HSJA 2AIXA 3PGFA 5TPAA 1TWYA 2Z8DA 3B6WA 2F35A 2HPGA 3OSQA 4N13A 2Q8JA 4N81A 1JQFA 5IGAA 1FTKA 3H03A 1JW4A 1NV5A 3N6UA 4P56A 5BWJA 5TP9A 4WKMA 4KQPA 1MXWA 2OWTA 3F11A 2ZZXA 1NUYA 4Q8RA 4P9KA 4I9DA 4NF5B 5EYFA 1LEVA 4GX4A 3DM0A 5ICQA 1P1NA 5IZ3B 3OMBA 1B58A 1D4NA 4YKPA 3D4GA 3PMWA 2CZHA 1SW1A 2XXXA 4WEDA 5I58B 5I2NA 2H25A 2XXUA 4X8RA 1AWBA 5TPAB 1D9VA 3LR1A 4MIJA 4IR8A 4EDPA 4OZ9A 3BFUA 4F19A 2HZLA 4PFWA 1YCJA 3KC0A 3AXFA 2DP8A 1EZOA 1KA1A 1IXCA 2GHBA 5TP9B 3CIJA 3T22A 3G3HA 3L6HA 4H8JA 3D1RA 2UYFA 2DOJA 2V3TA 1YXIA 3I6VA 2B3FA 4JWYA 3H3GA 2ZNSA 1UIUA 3FZVA 4R6KA 3O28A 2NVUB 2WYKA 1FBPA 1PBQA 2F78A 1LSTA 3SEYA 1IUDA 2R8TA 5I2NB 3TCGA 4H8IA 1QW0A 5H8QA 3KJTA 4ZE8A 4R2FA 1ZLQA 1Y4CA 3TDJA 4JVDA 3DP6A 3K6XA 4JDFA 2O69A 4JVCA 1B3EA 1NNFA 1P1QA 4EQBA 4MAGA 4HTGA 2H9BA 5F1QA 2GHAA 3O66A 1USYE 4U4XA 4Q5TA 5AA4A 4GQOA 2I49A 2O7UA 1N7WA 3KOTA 3VLWA 1CB6A 3TPAA 1I6QA 1IMAA 4I3EA 3B8BA 1SYHA 4PAKA 3PUYE 3FASA 3E78A 4H1XA 3ILTB 3PUZE 3TAJA 3O9PA 1Z7NE 3E9XA 5AA1A 5EHSA 2F97A 3TYHA 4MBPA 1P1UA 5H8QB 4FAJA 3IFCA 2I0CA 3IORA 4F1YA 1A8EA 4KCCA 2Y5KA 1VDWA 2O1LA 3CG3A 3PMVA 1KWHA 2I4BA 4MJOA 2R9JA 5AA4B 1S9TA 4LP2B 3K02A 3PD9A 4LZ5A 1MY4A 2D5WA 2ZMBA 4PAIA 2O6AA 5I3SA 3MVZA 4OVQA 2R71A 4XXUA 1O64A 3Q26A 2YPNA 1ZU0A 1FBEA 2REJA 5TU0A 4DCYA 2REGA 3MP8A 2OLBA 1A99A 1HSLA 2Y7KA 4F2OA 5AE4A 1A8FA 2NOOA 1FPBA 4BDLA 5DVFA 4X04A 4OFLA 4P1LA 4PBHA 5L9OA 1LCTA 4MLVA 5DTBA 2ANJA 1UQWA 4DI4B 4OEUA 4GWWA 4PE3A 1DPPA 4N15A 4JB7A 4JXIA 2O51A 1JETA 1QKBA 3A3UA 3PUVE 1S50A 1FBCA 3R26A 5HPQA 2X7QA 1DTGA 2V4CA 4MF3A 5K2XA 1QJMA 3Q25A 4WXJA 3FGSA 1SW2A 1FQFA 5IM2A 1LGBC 4H6DA 4N17A 1QKAA 4YKJA 3FJ7A 1IEJA 2B65A 2VPOA 3IOTA 3TUSA 2VD2A 2GQ1A 4G4PA 1FBGA 3RN8A 1ZBMA 2VHAA 1MXYA 3U1OA 3M3KA 3MSTA 3PU5A 3HSTA 1BIYA 3FV2A 1B5JA 3VLVA 1MXZA 2DWAA 4RJZA 3THIA 2UXAA 2HZKA 1FBFA 1A54A 4ND9A 3ZSFA 1JW5A 3TCFA 4RPNA 3V8XB 1B46A 1OQHA 4Q0CA 1MQGA 3MZ9A 1EYIA 1R1NA 1BLFA 1M5DA 3OO6A 4GOTA 4R6HA 1MPDA 5ET6A 3HFUA 4ZEKA 1IIWA 5DYHA 4AQ4A 4LA9A 1D9QA 4GFRA 3O29A 4HE0A 2CZLA 1B4HA 1A7LA 1MQIA 1PBPA 3G3IA 2HHMA 4PDDA 5L9MA 4YMBA 3K2DA 3HHGA 3BKIB 1OLAA 3KN8A 4UABA 4PETA 4G68C 3CFLA 5A5LA 1MH4A 4MCOA 3U94A 1BKAA 1EZPA 2Q88A 1NH7A 1NV3A 2THIA 4DDDA 3RPLB 1G0IA 3QSLA 2DWHA 4I1DA 1Y9UA 4GL8A 2PYYA 3B7DA 1BP5A 3KBRA 3QUJA 3EKIA 4F3SA 2UVHA 3RY3A 4DLDA 1T0KA 1Z7ME 3V5AA 4ELQA 1JEUA 1N0TA 2A5TA 3IK6B 4R75A 1YTVA 4DZ1A 2ZNUA 3C35A 3DP4A 4BDQA 5H8SA 4G8NA 3S9LC 1CNQA 4XEQA 2XX9A 5I2KA 3M3LA 3RQTA 4QFKA 4ZEFA 4MX6A 4YU0A 1FQCA 4PFIA 4XF5A 2P1SA 3O2AA 3U65A 4XKNA 3QMFA 3TCHA 3PPOA 3TQLA 2Z22A 3MW0A 3HCQA 1FBHA 3TTRA 2F7CA 3EHSA 3QAXA 1POY1 4GWXA 4G8HA 1LFHA 1FPEA 4AS4A 2PMSA 1UTHA 1FPGA 2FYIA 4HCYA 4IGTA 2CEYA 3E4RA 1IITA 1IQ7A 2KQZA 2V3UA 3EF7A 1MG1A 5H8NA 1IMEA 3KSJA 1MRPA 3CR9A 2A5SA 4N8GA 2A5TB 4N6PA 4R6YA 3CSGA 4F1UA 3KJ7A 4U1ZA 1LBZA 5I2KB 1AL3A 4BLAA 5DVIA 2UVGA 5CMBA 2JJKA 4FEBA 1QUKA 1Y1ZA 4OETA 1HSEA 2V25A 1GTKA 4OQOA 2ZYMA 2YLNA 2ZYKA 4EXLA 1ZJLA 1NV7A 1RDYA 3RPWA 3PPNA 4M4GA 2WYPA 1UTHB 5AA2B 1Y20A 1MY0A 2XXKA 4YAHX 3L6GA 3PD8A 3O97A 3GXAA 4LATA 4ZECA 1PB9A 4KR5A 3K6WA 1PEBA 4KYSA 3HN0A 1LBBA 4QFOA 3T9XB 2ZXTA 1GV8A 3EPEA 4FEDA 4NF8A 4OVRA 4IB2A 1QUJA 4LQ2A 1RKMA 3FD3A 3FVKA 3MZ1A 1S7YA 3IX1A 5ITPA 3PMXA 3A09A 2F7AA 4TOZA 1FSAA 1ZKBA 1B7ZA 3OENA 2XXWA 4N07A 2DDKA 3LSXA 2DS9A 2OK2A 1LLSA 2O7IA 1R9QA 4OYVA 1LAXA 5EYGA 1H76A 2V3QA 3EQ1A 1PC3A 2ALUA 1PDAA 1R9LA 2XA5A 4FE8A 5LDZA 3FUZA 1B3FA 4PF6A 3MP6A 3RT8A 1H44A 1OMPA 1IMFA 4ELPA 3H06B 1H43A 2XXQA 4NF8B 1MM7A 1LFIA 1RYXA 1YYZA 4F3PA 3GLBA 4XFEA 4OESA 1B40A 3HV1A 3QIMA 4MH5A 4YICA 1A55A 1II5A 3OO7A 1J1NA 4PP0A 3SDFA 5FTIA 5CI5A 1QULA 2PBWA 3LC8A 2Z8EA 4GX3A 4R74A 1MXVA 2PT1A 1MXXA 5T3JA 2XXRA 1AIVA 2FVZA 1B0HA 1O7TA 4H65A 3UN6A 2QS1A 4U21A 3FVGA 4DXCA 3SETA 3CRBA 4IO6A 4QBAA 3PUWE 5ICTA 4NE4A 4H67A 4U2RA 1USYH 3W9WA 5I84A 4FBPA 3DLNA 4ZZAA 4EF1A 2DE2A 4ESWA 3MC2A 1FTLA 4GBWA 3H6TA 3OOAA 4ZE9A 3FXBA 1NV2A 2Q89A 3QXMA 4GVOA 4R73A 4N6DA 4NTLA 2I6EA 5I59B 3Q28A 2RC8A 5EYHA 1NNTA 2HFBA 3MAMA 5ESYA 4HS7A 2WBBA 1OVBA 3BIHA 1JVXA 4H45A 1B32A 3VXBA 3QK6A 3K6VA 3TQWA 4P47A 2RF1A 4O3AA 3LUZA 2I48A 1M5BA 1MY3A 4DCXA 4PTKA 2BJIA 1Y1MA 1WDNA 2V93A 1M5FA 4JBZA 1FQBA 4MMPA 4THIA 1NUXA 1JNFA 2Y5LA 2I4CA 2IA4A 3JZJA 3SZPA 4NX1A 4JSOA 4GX6A 3A29A 3FVNA 3CFZA 2PT2A 4F2QA 2GRVA 2QL3A 3G7WA 3C31A 1OIBA 1NUWA 2F3DA 4O7MA 4RA1A 5JEIA 2E1SA 1ZMGA 3K4UA 4Q30B 1FQEA 1Y3PA 2PVUA 4YKKA 4OTEA 3SKPA 2ZYOA 1OLCA 2ESNA 2RC7A 1A40A 4EXKA 1TFDA 2PCRA 5FHMA 1SW4A 3B6QA 3O6GA 4HE2A 3S2VA 1ZTYA 3KN3A 3Q27A 4HXVA 4LZ8A 2CEXA 3RYDA 5B7DA 3IJOB 3GBBA 3FJGA 4O7IA 4FECA 1IMBA 3T93B 3FATA 2MKZA 4PFUA 3SEWA 4PBQA 4JVIA 5FBPA 5CRYA 4F39A 5AA3A 4GWOA 1FPJA 1QUIA 5JK4A 4E0XA 1NV6A 4EUOA 3OD7A 4F22A 2M8CA 2W7YA 2O1MA 3WAFA 3R7XA 2HXRA 4PGPA 5FHOA 2GFEA 4TQUQ 1WODA 4QXDA 1RYOA 1LBYA 4QSCA 3B6TA 4X48A 4XKPA 2OX3A 4PCDA 4C1UA 1SD3A 5ITOA 4YMAA 2Q2CA 2NWJA 3JYRA 4ELOA
chains in the Genus database with same CATH topology
3KBZA 3CHGA 2QFLA 2PFZA 4HE1A 4OVSA 2P3VA 5IZ3A 3E79A 1CNQA 4XEQA 4HCWA 3FBPA 4MX6A 2QVVA 5I7IA 1KZ8A 4PFIA 4XF5A 4MNCA 3U65A 3QMFA 4MHFA 1IMDA 1FBHA 3PTYA 1QGXA 4M1VA 2ZZVA 4AS5A 4GWXA 1FPEA 4AS4A 1FPGA 4NN3A 2HPGA 4HCYA 5EQ7A 1FPKA 4N81A 2CEYA 5IGAA 2OWZA 2KQZA 1NV5A 2QVUA 4P56A 4GWYA 1IMEA 1NI9A 5CM6A 2ZZXA 4N8GA 4O8MA 1NUYA 2XWIA 3RPLA 4P9KA 4I3YA 1LEVA 2PFYA 4NHBA 4F1UA 4GX4A 2DVZA 5IZ3B 1LBZA 2CZHA 2XWOA 2JJKA 1LBXA 5ET7A 4YZZA 1FPDA 5I5PA 1NV7A 1RDYA 4MEVA 4X8RA 3LV0A 1AWBA 2WYPA 1K9ZA 4N91A 3IFAA 1DCUA 4MIJA 4IR8A 2XXKA 4F19A 2P3NA 1EYJA 2HZLA 1K9YA 3KC0A 1NV4A 3NOHA 1KA1A 4OANA 5IZ1A 2L5VA 4P3LA 3D1RA 2QVRA 2XWVA 1YXIA 4OVRA 2WYKA 1FBPA 1LBWA 4H46A 1DBZA 5J1DA 1FSAA 2R8TA 4PF8A 2Q74A 5DW8A 2DDKA 1SPIA 4PAFA 4JVDA 4NQ8A 1FJ6A 4JVCA 5EYGA 2V3QA 3MYUA 2FIXA 5ET8A 4MAGA 2KR0A 2XA5A 5LDZA 2XWKA 4PF6A 1IMAA 4OVPA 4I3EA 2B4MA 3B8BA 3ISPA 4PAKA 2DE3A 3E78A 1IMFA 1IMCA 4NGUA 4PC9A 1YYZA 4XFEA 2CZKA 2Q8MA 2DE4A 4YICA 1FRPA 3ROJA 4GX3A 4PDHA 4KXPA 3IFCA 5T3JA 2FVZA 2Y5KA 4OVTA 1VDWA 1FBDA 4G61A 1JP4A 5F24A 4MJOA 4QBAA 4GWSA 3W9WA 4FBPA 5EQAA 1FPIA 2DE2A 4NG7A 4PAIA 5I3SA 4OVQA 2F3BA 4GBWA 2VPNA 3B50A 1Q9DA 3FXBA 1NV2A 1FPLA 1FBEA 4N6DA 3BIGA 4PFBA 1FPBA 4X04A 4P1LA 4PBHA 1NUZA 5EYHA 4DI4B 4GWWA 5ESYA 2FBPA 4PE3A 2WBBA 4N15A 1KA0A 3BIHA 4H45A 5LTCA 1FTAA 1FBCA 3GYYA 4PFRA 3T1BA 1NV1A 4NAPA 4O94A 2V4CA 4P47A 5EQ8A 4P8BA 5ET5A 3LUZA 2WEFA 4PTKA 5IM2A 2VT5A 2BJIA 4N17A 4MMPA 2VPOA 3T0JA 1RDZA 2GQ1A 1FBGA 1NUXA 2Y5LA 3SZPA 4NX1A 4GX6A 3A29A 3KC1A 3MSTA 1NUWA 2F3DA 4O7MA 2QPQA 1NV0A 4X9TA 4F18A 5J16A 5IZZA 2Q9TA 2HZKA 1FBFA 4OA4A 4F1VA 1YZ0A 2PCRA 4NF0A 5EQ9A 4GWZA 1EYIA 4HE2A 1FJ9A 3W9VA 4HXVA 1LBVA 2CEXA 1BK4A 4LN5A 3RYDA 1EYKA 4O7IA 5ET6A 3HFUA 4DI3D 4PGNA 1IMBA 1D9QA 1RDXA 4HE0A 2F5XA 2MKZA 4MNIA 4PBQA 2HHMA 4PDDA 4JVIA 5FBPA 1G0HA 1FPJA 5JK4A 2FHYA 2B4LA 1NV6A 4UABA 4PETA 4N8YA 5A5LA 4I40A 4MCOA 2HXRA 4PGPA 1XI6A 2WBDA 4GBVA 1NV3A 4MNPA 3RPLB 1G0IA 4N6KA 4QXDA 1LBYA 2CZIA 1DK4A 2OX3A 4PCDA 1FPFA 3EKIA 2FIEA 2WX9A 1INPA 4N4UA 2ZZWA 4P1EA 4GWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV4 A;  1JP4 A;  3A29 A;  1KA1 A;  3KC1 A;  5IZ1 A;  1NUW A;  5F24 A;  4GWU A;  2F3D A;  4MJO A;  3KBZ A;  1NV0 A;  4GWS A;  2QFL A;  3D1R A;  4HE1 A;  2P3V A;  4FBP A;  5EQA A;  5IZ3 A;  2QVR A;  1CNQ A;  1FPI A;  5J16 A;  1YXI A;  3FBP A;  2QVV A;  1FBF A;  1KZ8 A;  5I3S A;  2F3B A;  1FBP A;  1LBW A;  3QMF A;  1YZ0 A;  4GBW A;  4H46 A;  1IMD A;  1FBH A;  2PCR A;  1QGX A;  1Q9D A;  5EQ9 A;  1DBZ A;  1NV2 A;  4AS5 A;  1FSA A;  2R8T A;  4GWX A;  1FPL A;  4GWZ A;  1EYI A;  1FBE A;  4HE2 A;  1FPE A;  4AS4 A;  1FJ9 A;  2Q74 A;  5DW8 A;  3BIG A;  2DDK A;  4HXV A;  1FPG A;  1LBV A;  1SPI A;  1BK4 A;  5EQ7 A;  3RYD A;  1FPK A;  4N81 A;  1EYK A;  2OWZ A;  4O7I A;  1FPB A;  5ET6 A;  1FJ6 A;  5EYG A;  1NV5 A;  2QVU A;  2FIX A;  1IMB A;  4GWY A;  5ET8 A;  1NUZ A;  1IME A;  1NI9 A;  5EYH A;  1D9Q A;  1RDX A;  4HE0 A;  4GWW A;  5ESY A;  2FBP A;  5LDZ A;  1NUY A;  2WBB A;  3RPL A;  1KA0 A;  4I3Y A;  1LEV A;  2HHM A;  3BIH A;  1IMA A;  4H45 A;  4GX4 A;  5FBP A;  4I3E A;  1FTA A;  1FBC A;  3B8B A;  1NV1 A;  5IZ3 B;  1G0H A;  1FPJ A;  1IMF A;  1LBZ A;  1IMC A;  2FHY A;  1NV6 A;  5EQ8 A;  2CZH A;  1YYZ A;  2JJK A;  1LBX A;  5ET7 A;  5A5L A;  5ET5 A;  3LUZ A;  4I40 A;  2CZK A;  2Q8M A;  2WEF A;  4PTK A;  1FPD A;  2VT5 A;  2BJI A;  1XI6 A;  2WBD A;  4GBV A;  1NV3 A;  1NV7 A;  1RDY A;  1FRP A;  3RPL B;  1G0I A;  3ROJ A;  3T0J A;  1RDZ A;  1AWB A;  3LV0 A;  2GQ1 A;  4QXD A;  1K9Z A;  1FBG A;  4GX3 A;  1NUX A;  2Y5L A;  1LBY A;  4GX6 A;  3IFA A;  4KXP A;  1DCU A;  2CZI A;  1DK4 A;  4IR8 A;  2OX3 A;  1FPF A;  3IFC A;  5T3J A;  2P3N A;  1EYJ A;  2FIE A;  1INP A;  2FVZ A;  2Y5K A;  1VDW A;  1FBD A;  1K9Y A;  4G61 A;  3KC0 A; 
#chains in the Genus database with same CATH topology
 4LVQ A;  1MQD A;  2F6P A;  4YB5 A;  3KBZ A;  3RT6 B;  4GRK A;  2CMO A;  3DP8 A;  3RNN A;  1DTZ A;  1LB8 A;  3TTM A;  4H0W A;  4HCW A;  3Q29 A;  3TTL A;  3ZS6 A;  3VVE A;  3I5O A;  5I7I A;  1B2H A;  4H5G A;  4MHF A;  3RTW B;  3SES A;  4GXS B;  2RCB A;  4L17 A;  3C36 A;  5EQ7 A;  3QYT A;  2OWZ A;  2DXR A;  4KCD A;  3U72 A;  1H3D A;  4NMY A;  2QVU A;  3O6H A;  3KZG A;  1FW0 A;  4POW A;  4BDM A;  4GWY A;  3K1N A;  3GZG A;  4OFO A;  4U23 A;  4KPT A;  3TKD A;  1UTB A;  4O8M A;  2XWI A;  3RPL A;  2ZNT A;  1NMU A;  3LUY A;  4ZEB A;  4NHB A;  5KZT A;  4F31 B;  2DVZ A;  3RUM A;  2ONK E;  4MFI A;  1XHY A;  5H8F B;  2OPD A;  4F3B A;  1I69 A;  5ET7 A;  4ZDM A;  1IXG A;  3H4Z A;  2GH9 A;  4YZZ A;  5DT6 A;  1FPD A;  1JW1 A;  2D21 A;  5I5P A;  2LAO A;  5FHN A;  4XTC Q;  3H6V A;  4MEV A;  3I3V A;  3IB1 A;  4KFQ A;  1B3G A;  2HAU A;  1US5 A;  4KYD A;  3LSW A;  3IFA A;  1BTJ A;  1B0L A;  2P3N A;  1P1W A;  2QMW A;  3MQ9 A;  3C4M A;  1EZ9 A;  2L5V A;  4GLI A;  1ZIU A;  3ZKL A;  3O6I A;  2NUV A;  3U93 A;  1IXH A;  1Q1K A;  3KFM A;  1UTB B;  2QVR A;  3MJN A;  3P7I A;  3IOU A;  4PE5 B;  5EHM A;  4H46 A;  2OPE A;  1OQG A;  1XVX A;  3MVY A;  1N3X A;  2ONR A;  1B6H A;  1Y4T A;  4UAC A;  1XVY A;  1TFA A;  3IO6 A;  2XX8 A;  3PPP A;  4LQ5 A;  4RYA A;  4NQ8 A;  4JWO A;  4QFL A;  3A3C A;  3MYU A;  2ABH A;  5ET8 A;  5DEX A;  1N04 A;  1B52 A;  2AYS A;  2KR0 A;  3PPQ A;  1PB8 A;  1NH8 A;  3PV0 E;  5BUU A;  1CE2 A;  1F9B A;  2DSF A;  2H4I A;  5AA2 A;  4OVP A;  2B4M A;  4IY6 A;  4F29 A;  2F7B A;  1SQY A;  3ISP A;  1IMC A;  4EQ9 A;  3MPK A;  3MP1 A;  1NNP A;  4PFY A;  2DE4 A;  4LZ7 A;  4UA8 A;  3ROJ A;  3MWB A;  4ECF A;  3W15 C;  3VFJ A;  3CSB A;  2UVI A;  4OVT A;  2H5Y A;  1FBD A;  3RLF E;  1AOV A;  1FTJ A;  3U92 A;  5DEX B;  3RGY A;  5F24 A;  2RKM A;  4IO5 A;  2G93 A;  2I0B A;  5JTY A;  4GWS A;  4NF6 A;  4ZZE A;  3N26 A;  3IO4 A;  1FPI A;  3HO7 A;  3MZB A;  3C34 A;  2ONS A;  4OXV A;  1SVX B;  2P0S A;  1N7X A;  3FV1 A;  3CI8 A;  2VPN A;  3B50 A;  2H99 A;  4WEP A;  5ELV A;  5CBR A;  3OEL A;  1MDP 1;  4KYE A;  1MPC A;  4P11 A;  2DWJ A;  4G2Z A;  1B05 A;  5K2Y A;  2F34 A;  1R6Z A;  4P0I A;  2NXO A;  1NUZ A;  1VR5 A;  3OO9 A;  1LAH E;  4JSD A;  3QUF A;  4GD5 A;  5JTY B;  1FTA A;  4NF6 B;  4X1B A;  3TEL A;  2FNC A;  4QSD A;  1MS7 A;  4ISU A;  4LON B;  4KHZ E;  5EQ8 A;  4P8B A;  5ET5 A;  3T66 A;  2WEF A;  1B4Z A;  2VT5 A;  1ELJ A;  3T9V A;  2B3B A;  2Y7R A;  3CFX A;  3UP9 A;  4BDN A;  5ISU A;  2WKY A;  4RK9 A;  3KC1 A;  1US4 A;  4AB5 A;  1DPE A;  2F8D A;  1LBC A;  2DYX A;  2H98 A;  2QPQ A;  1NV0 A;  4YKI A;  4F18 A;  1MY1 A;  2XXV A;  5I59 A;  4FIM A;  5IZZ A;  3V89 B;  5H8H A;  4GIZ A;  4U4S A;  4F3G A;  4IO3 A;  3FIR A;  3VLU A;  2V84 A;  5I56 B;  3T9U A;  2HXW A;  4GWZ A;  3OEM A;  3VXC A;  4XIG Q;  1FJ9 A;  4Z7E A;  2XXT A;  4QFN A;  4FAT A;  3VVF A;  1B1H A;  1URG A;  1SDX A;  3KSX A;  2RC9 A;  2IEE A;  4O3B A;  2XD3 A;  4PGN A;  3FXQ A;  4U1O A;  1N84 A;  3TTK A;  3GBA A;  5HBC A;  1DSN A;  4PFT A;  4QRZ A;  1NNK A;  1I6A A;  4QSE A;  4IO7 A;  4ONY A;  4R72 A;  2XXP A;  4RPO A;  1G0H A;  2VGQ A;  3VDF A;  2XHD A;  4LUB A;  5H8H B;  2OBG A;  1URS A;  3FJM A;  3ZKK A;  3VVD A;  4GBV A;  2AL5 A;  2Y7P A;  4JWX A;  3KN7 A;  3TFL A;  1PB7 A;  2FIE A;  1INP A;  1FCK A;  1SYI A;  4N4U A;  2ZZW A;  1EU8 A;  4GWU A;  1VE4 A;  3EN3 A;  3TMG A;  3CG1 A;  1FQA A;  2QFL A;  3C32 A;  2Y7I A;  1ANF A;  4HE1 A;  4OVS A;  3SEX A;  3D4C A;  3FBP A;  4NWD A;  3T96 B;  4NF4 A;  4RY1 A;  2RCA A;  1KZ8 A;  5CC2 A;  3UOR A;  2RIN A;  1B9J A;  1QGX A;  4M1V A;  2ZZV A;  4AS5 A;  3TEP A;  3S4U A;  4R9G A;  5HM4 B;  3FXR A;  4NN3 A;  3KGC A;  1SI0 A;  1FPK A;  2XXH A;  4P0G A;  4BDR A;  3TTN A;  1YAE A;  1NI9 A;  3LBS A;  3V83 A;  5CM6 A;  1POT A;  4GXA A;  1XC1 A;  2DVC A;  2I58 A;  4I3Y A;  1DOT A;  2PFY A;  3S9N C;  1M5C A;  2D3I A;  1ATG A;  4G8M A;  5B70 A;  3H6W A;  1AH5 A;  4NF4 B;  4RNS A;  2XWO A;  1LFG A;  1LBX A;  2OWS A;  3MUQ A;  4FOR A;  3PUX E;  1GR2 A;  4C0R A;  1D9Y A;  3LV0 A;  1O63 A;  1K9Z A;  4N91 A;  4OWD A;  1IZ1 A;  1DCU A;  1EYJ A;  4BDO A;  4PQJ A;  2DQV A;  1K9Y A;  1NV4 A;  1JVY A;  3NOH A;  4OAN A;  3RTF B;  5IZ1 A;  1MY2 A;  5LOM A;  3ILU B;  1B7U A;  4ZED A;  1NL5 A;  4G77 A;  4MLQ A;  4P3L A;  2QSX A;  3H6U A;  4AB6 A;  2XWV A;  4FJP A;  1M5E A;  2QS4 A;  3SEU A;  5F7V A;  4ZS9 A;  5CMM A;  1OVT A;  4I8C A;  2XX7 A;  1B3H A;  1LBW A;  3S9E A;  4IO4 A;  4Z0I A;  4G68 A;  1URD A;  4C1T A;  2I3V A;  1DBZ A;  5J1D A;  4PF8 A;  2O68 A;  2Q74 A;  5DW8 A;  3MPL A;  3ODB A;  4IO2 A;  2KLF A;  1SPI A;  4PAF A;  3BBR A;  1MQJ A;  5H8F A;  5CMC A;  5M2V A;  1TT1 A;  1FJ6 A;  3OXN A;  1B51 A;  2FIX A;  2HEU A;  2QRY A;  4U22 A;  3G3G A;  1GVC A;  3OO8 A;  3USD A;  4IY5 A;  2O84 X;  3FVO A;  2XWK A;  4YB7 A;  4DXU A;  5A5X A;  3JV9 A;  5I57 A;  1LAG E;  3IB0 A;  3PPR A;  2DE3 A;  1YPN A;  4K3F A;  3U8Q A;  4NGU A;  3KOS A;  3G3J A;  4PC9 A;  2DXY A;  2VP1 A;  1H45 A;  3IOW A;  3K00 A;  3G3K A;  2CZK A;  2Q8M A;  1WVJ A;  4G68 B;  1FRP A;  4RXL A;  2VD3 A;  3ECR A;  4PDH A;  4KXP A;  4KI0 E;  3EHT A;  4E0W A;  3C9H A;  1SW5 A;  2Z8F A;  4G61 A;  2DWI A;  3K01 A;  1JP4 A;  1TXF A;  4GF8 A;  1N76 A;  3SER A;  2F6G A;  3IB2 A;  2Q2A A;  2X26 A;  1I6B A;  2XXY A;  4O3C A;  3N6T A;  5EQA A;  1L5T A;  3K1P A;  4OFJ A;  5A5X B;  5I57 B;  1VFD A;  1UIV A;  2R6G E;  3E3K A;  2OCU A;  4NG7 A;  1D3K A;  2F3B A;  2AL4 A;  3TZA A;  4EF2 A;  1Q9D A;  1LCF A;  5FTH A;  1FPL A;  1MH3 A;  3K0V A;  3KG2 A;  2XXI A;  3BFT A;  3KEI A;  3BIG A;  1VFE A;  4XKR A;  4PFB A;  3FXU A;  1MPB A;  2HAV A;  3SEV A;  1P1O A;  4QHQ A;  2X7P A;  1SI1 A;  1Y3Q A;  2FBP A;  1KA0 A;  1AMF A;  4R9F A;  3K6U A;  5LTC A;  3WAE A;  3GYY A;  2QS3 A;  4PFR A;  4OHN A;  1MM6 A;  1B5H A;  1NV1 A;  1DMB A;  3T1B A;  4NAP A;  4EQ7 A;  2Z23 A;  4O94 A;  2HQ0 A;  1B1X A;  4OER A;  4QFP A;  3UK4 A;  1XS5 A;  1QVS A;  3ONM A;  3N94 A;  3OEK A;  1MDQ A;  3T0J A;  1RDZ A;  1NFT A;  5L8D A;  4IGR A;  4DIG A;  2YJP A;  1FTO A;  4DE8 A;  4QF9 A;  4RK2 A;  3MBP A;  4XKQ A;  3G3F A;  1VSO A;  2I3W A;  3IAZ A;  1B5I A;  3IR1 A;  4KD5 A;  2FA7 A;  3EHU A;  4X9T A;  3E13 X;  1IXI A;  4GL0 A;  1NKX A;  2UYE A;  1B7H A;  5J16 A;  3IL1 B;  1XOC A;  1LAF E;  1LB9 A;  3UIF A;  2Q9T A;  5KDT A;  5DVJ A;  3C33 A;  2F36 A;  1SBP A;  1MQH A;  4OMB A;  4OA4 A;  4F1V A;  3UGW A;  1YZ0 A;  3LSL A;  3VV5 A;  4YB6 A;  4HW8 A;  3TOD A;  4NF0 A;  1JEV A;  5EQ9 A;  4ELR A;  4NWC A;  2Y84 A;  3W9V A;  4ZEI A;  1LBV A;  1BK4 A;  4LN5 A;  4OEN A;  3OSR A;  1EYK A;  1GGG A;  4H5F A;  4DI3 D;  4DXB A;  2BJJ X;  3MVW A;  1EH3 A;  4NED A;  5AA2 D;  5KCJ A;  1RDX A;  4R2B A;  2F5X A;  2QMX A;  3K1M A;  3IJX B;  2HCA A;  3LSF B;  2VOZ A;  2OZZ A;  4MNI A;  3HPI A;  4TLM B;  1MXU A;  2QJE A;  2XD2 A;  1FQD A;  2Y7W A;  3HHF A;  3CVG A;  3UA8 A;  2PX1 A;  2FHY A;  2OJT A;  3S9M C;  2B4L A;  3R6U A;  5KDT B;  1FTM A;  4N8Y A;  3IOV A;  4I40 A;  5H8N B;  5L9S A;  4X1D A;  1XI6 A;  2WBD A;  2E0S A;  2UVJ A;  4MNP A;  4N6K A;  4ESX A;  3VE1 B;  2CZI A;  1DK4 A;  1FPF A;  2WX9 A;  4P1E A;  5I56 A;  1Y3N A;  2P2A A;  3M8U A;  5IAI A;  2QS2 A;  4NF5 A;  5KCJ B;  3CHG A;  3MVX A;  4TLL B;  2PFZ A;  5CBS A;  2P3V A;  5IZ3 A;  1B3L A;  1N3W A;  3E79 A;  1XT8 A;  3H7M A;  5IKB A;  2QVV A;  4MNC A;  3M3F A;  2ZYN A;  5I58 A;  4POX A;  3DEL B;  5CMK A;  4I62 A;  1Q35 A;  1IMD A;  2G29 A;  3PTY A;  1P99 A;  4OEV A;  4OVJ A;  3T9H B;  3N5L A;  1HSJ A;  2AIX A;  3PGF A;  5TPA A;  1TWY A;  2Z8D A;  3B6W A;  2F35 A;  2HPG A;  3OSQ A;  4N13 A;  2Q8J A;  4N81 A;  1JQF A;  5IGA A;  1FTK A;  3H03 A;  1JW4 A;  1NV5 A;  3N6U A;  4P56 A;  5BWJ A;  5TP9 A;  4WKM A;  4KQP A;  1MXW A;  2OWT A;  3F11 A;  2ZZX A;  1NUY A;  4Q8R A;  4P9K A;  4I9D A;  4NF5 B;  5EYF A;  1LEV A;  4GX4 A;  3DM0 A;  5ICQ A;  1P1N A;  5IZ3 B;  3OMB A;  1B58 A;  1D4N A;  4YKP A;  3D4G A;  3PMW A;  2CZH A;  1SW1 A;  2XXX A;  4WED A;  5I58 B;  5I2N A;  2H25 A;  2XXU A;  4X8R A;  1AWB A;  5TPA B;  1D9V A;  3LR1 A;  4MIJ A;  4IR8 A;  4EDP A;  4OZ9 A;  3BFU A;  4F19 A;  2HZL A;  4PFW A;  1YCJ A;  3KC0 A;  3AXF A;  2DP8 A;  1EZO A;  1KA1 A;  1IXC A;  2GHB A;  5TP9 B;  3CIJ A;  3T22 A;  3G3H A;  3L6H A;  4H8J A;  3D1R A;  2UYF A;  2DOJ A;  2V3T A;  1YXI A;  3I6V A;  2B3F A;  4JWY A;  3H3G A;  2ZNS A;  1UIU A;  3FZV A;  4R6K A;  3O28 A;  2NVU B;  2WYK A;  1FBP A;  1PBQ A;  2F78 A;  1LST A;  3SEY A;  1IUD A;  2R8T A;  5I2N B;  3TCG A;  4H8I A;  1QW0 A;  5H8Q A;  3KJT A;  4ZE8 A;  4R2F A;  1ZLQ A;  1Y4C A;  3TDJ A;  4JVD A;  3DP6 A;  3K6X A;  4JDF A;  2O69 A;  4JVC A;  1B3E A;  1NNF A;  1P1Q A;  4EQB A;  4MAG A;  4HTG A;  2H9B A;  5F1Q A;  2GHA A;  3O66 A;  1USY E;  4U4X A;  4Q5T A;  5AA4 A;  4GQO A;  2I49 A;  2O7U A;  1N7W A;  3KOT A;  3VLW A;  1CB6 A;  3TPA A;  1I6Q A;  1IMA A;  4I3E A;  3B8B A;  1SYH A;  4PAK A;  3PUY E;  3FAS A;  3E78 A;  4H1X A;  3ILT B;  3PUZ E;  3TAJ A;  3O9P A;  1Z7N E;  3E9X A;  5AA1 A;  5EHS A;  2F97 A;  3TYH A;  4MBP A;  1P1U A;  5H8Q B;  4FAJ A;  3IFC A;  2I0C A;  3IOR A;  4F1Y A;  1A8E A;  4KCC A;  2Y5K A;  1VDW A;  2O1L A;  3CG3 A;  3PMV A;  1KWH A;  2I4B A;  4MJO A;  2R9J A;  5AA4 B;  1S9T A;  4LP2 B;  3K02 A;  3PD9 A;  4LZ5 A;  1MY4 A;  2D5W A;  2ZMB A;  4PAI A;  2O6A A;  5I3S A;  3MVZ A;  4OVQ A;  2R71 A;  4XXU A;  1O64 A;  3Q26 A;  2YPN A;  1ZU0 A;  1FBE A;  2REJ A;  5TU0 A;  4DCY A;  2REG A;  3MP8 A;  2OLB A;  1A99 A;  1HSL A;  2Y7K A;  4F2O A;  5AE4 A;  1A8F A;  2NOO A;  1FPB A;  4BDL A;  5DVF A;  4X04 A;  4OFL A;  4P1L A;  4PBH A;  5L9O A;  1LCT A;  4MLV A;  5DTB A;  2ANJ A;  1UQW A;  4DI4 B;  4OEU A;  4GWW A;  4PE3 A;  1DPP A;  4N15 A;  4JB7 A;  4JXI A;  2O51 A;  1JET A;  1QKB A;  3A3U A;  3PUV E;  1S50 A;  1FBC A;  3R26 A;  5HPQ A;  2X7Q A;  1DTG A;  2V4C A;  4MF3 A;  5K2X A;  1QJM A;  3Q25 A;  4WXJ A;  3FGS A;  1SW2 A;  1FQF A;  5IM2 A;  1LGB C;  4H6D A;  4N17 A;  1QKA A;  4YKJ A;  3FJ7 A;  1IEJ A;  2B65 A;  2VPO A;  3IOT A;  3TUS A;  2VD2 A;  2GQ1 A;  4G4P A;  1FBG A;  3RN8 A;  1ZBM A;  2VHA A;  1MXY A;  3U1O A;  3M3K A;  3MST A;  3PU5 A;  3HST A;  1BIY A;  3FV2 A;  1B5J A;  3VLV A;  1MXZ A;  2DWA A;  4RJZ A;  3THI A;  2UXA A;  2HZK A;  1FBF A;  1A54 A;  4ND9 A;  3ZSF A;  1JW5 A;  3TCF A;  4RPN A;  3V8X B;  1B46 A;  1OQH A;  4Q0C A;  1MQG A;  3MZ9 A;  1EYI A;  1R1N A;  1BLF A;  1M5D A;  3OO6 A;  4GOT A;  4R6H A;  1MPD A;  5ET6 A;  3HFU A;  4ZEK A;  1IIW A;  5DYH A;  4AQ4 A;  4LA9 A;  1D9Q A;  4GFR A;  3O29 A;  4HE0 A;  2CZL A;  1B4H A;  1A7L A;  1MQI A;  1PBP A;  3G3I A;  2HHM A;  4PDD A;  5L9M A;  4YMB A;  3K2D A;  3HHG A;  3BKI B;  1OLA A;  3KN8 A;  4UAB A;  4PET A;  4G68 C;  3CFL A;  5A5L A;  1MH4 A;  4MCO A;  3U94 A;  1BKA A;  1EZP A;  2Q88 A;  1NH7 A;  1NV3 A;  2THI A;  4DDD A;  3RPL B;  1G0I A;  3QSL A;  2DWH A;  4I1D A;  1Y9U A;  4GL8 A;  2PYY A;  3B7D A;  1BP5 A;  3KBR A;  3QUJ A;  3EKI A;  4F3S A;  2UVH A;  3RY3 A;  4DLD A;  1T0K A;  1Z7M E;  3V5A A;  4ELQ A;  1JEU A;  1N0T A;  2A5T A;  3IK6 B;  4R75 A;  1YTV A;  4DZ1 A;  2ZNU A;  3C35 A;  3DP4 A;  4BDQ A;  5H8S A;  4G8N A;  3S9L C;  1CNQ A;  4XEQ A;  2XX9 A;  5I2K A;  3M3L A;  3RQT A;  4QFK A;  4ZEF A;  4MX6 A;  4YU0 A;  1FQC A;  4PFI A;  4XF5 A;  2P1S A;  3O2A A;  3U65 A;  4XKN A;  3QMF A;  3TCH A;  3PPO A;  3TQL A;  2Z22 A;  3MW0 A;  3HCQ A;  1FBH A;  3TTR A;  2F7C A;  3EHS A;  3QAX A;  1POY 1;  4GWX A;  4G8H A;  1LFH A;  1FPE A;  4AS4 A;  2PMS A;  1UTH A;  1FPG A;  2FYI A;  4HCY A;  4IGT A;  2CEY A;  3E4R A;  1IIT A;  1IQ7 A;  2KQZ A;  2V3U A;  3EF7 A;  1MG1 A;  5H8N A;  1IME A;  3KSJ A;  1MRP A;  3CR9 A;  2A5S A;  4N8G A;  2A5T B;  4N6P A;  4R6Y A;  3CSG A;  4F1U A;  3KJ7 A;  4U1Z A;  1LBZ A;  5I2K B;  1AL3 A;  4BLA A;  5DVI A;  2UVG A;  5CMB A;  2JJK A;  4FEB A;  1QUK A;  1Y1Z A;  4OET A;  1HSE A;  2V25 A;  1GTK A;  4OQO A;  2ZYM A;  2YLN A;  2ZYK A;  4EXL A;  1ZJL A;  1NV7 A;  1RDY A;  3RPW A;  3PPN A;  4M4G A;  2WYP A;  1UTH B;  5AA2 B;  1Y20 A;  1MY0 A;  2XXK A;  4YAH X;  3L6G A;  3PD8 A;  3O97 A;  3GXA A;  4LAT A;  4ZEC A;  1PB9 A;  4KR5 A;  3K6W A;  1PEB A;  4KYS A;  3HN0 A;  1LBB A;  4QFO A;  3T9X B;  2ZXT A;  1GV8 A;  3EPE A;  4FED A;  4NF8 A;  4OVR A;  4IB2 A;  1QUJ A;  4LQ2 A;  1RKM A;  3FD3 A;  3FVK A;  3MZ1 A;  1S7Y A;  3IX1 A;  5ITP A;  3PMX A;  3A09 A;  2F7A A;  4TOZ A;  1FSA A;  1ZKB A;  1B7Z A;  3OEN A;  2XXW A;  4N07 A;  2DDK A;  3LSX A;  2DS9 A;  2OK2 A;  1LLS A;  2O7I A;  1R9Q A;  4OYV A;  1LAX A;  5EYG A;  1H76 A;  2V3Q A;  3EQ1 A;  1PC3 A;  2ALU A;  1PDA A;  1R9L A;  2XA5 A;  4FE8 A;  5LDZ A;  3FUZ A;  1B3F A;  4PF6 A;  3MP6 A;  3RT8 A;  1H44 A;  1OMP A;  1IMF A;  4ELP A;  3H06 B;  1H43 A;  2XXQ A;  4NF8 B;  1MM7 A;  1LFI A;  1RYX A;  1YYZ A;  4F3P A;  3GLB A;  4XFE A;  4OES A;  1B40 A;  3HV1 A;  3QIM A;  4MH5 A;  4YIC A;  1A55 A;  1II5 A;  3OO7 A;  1J1N A;  4PP0 A;  3SDF A;  5FTI A;  5CI5 A;  1QUL A;  2PBW A;  3LC8 A;  2Z8E A;  4GX3 A;  4R74 A;  1MXV A;  2PT1 A;  1MXX A;  5T3J A;  2XXR A;  1AIV A;  2FVZ A;  1B0H A;  1O7T A;  4H65 A;  3UN6 A;  2QS1 A;  4U21 A;  3FVG A;  4DXC A;  3SET A;  3CRB A;  4IO6 A;  4QBA A;  3PUW E;  5ICT A;  4NE4 A;  4H67 A;  4U2R A;  1USY H;  3W9W A;  5I84 A;  4FBP A;  3DLN A;  4ZZA A;  4EF1 A;  2DE2 A;  4ESW A;  3MC2 A;  1FTL A;  4GBW A;  3H6T A;  3OOA A;  4ZE9 A;  3FXB A;  1NV2 A;  2Q89 A;  3QXM A;  4GVO A;  4R73 A;  4N6D A;  4NTL A;  2I6E A;  5I59 B;  3Q28 A;  2RC8 A;  5EYH A;  1NNT A;  2HFB A;  3MAM A;  5ESY A;  4HS7 A;  2WBB A;  1OVB A;  3BIH A;  1JVX A;  4H45 A;  1B32 A;  3VXB A;  3QK6 A;  3K6V A;  3TQW A;  4P47 A;  2RF1 A;  4O3A A;  3LUZ A;  2I48 A;  1M5B A;  1MY3 A;  4DCX A;  4PTK A;  2BJI A;  1Y1M A;  1WDN A;  2V93 A;  1M5F A;  4JBZ A;  1FQB A;  4MMP A;  4THI A;  1NUX A;  1JNF A;  2Y5L A;  2I4C A;  2IA4 A;  3JZJ A;  3SZP A;  4NX1 A;  4JSO A;  4GX6 A;  3A29 A;  3FVN A;  3CFZ A;  2PT2 A;  4F2Q A;  2GRV A;  2QL3 A;  3G7W A;  3C31 A;  1OIB A;  1NUW A;  2F3D A;  4O7M A;  4RA1 A;  5JEI A;  2E1S A;  1ZMG A;  3K4U A;  4Q30 B;  1FQE A;  1Y3P A;  2PVU A;  4YKK A;  4OTE A;  3SKP A;  2ZYO A;  1OLC A;  2ESN A;  2RC7 A;  1A40 A;  4EXK A;  1TFD A;  2PCR A;  5FHM A;  1SW4 A;  3B6Q A;  3O6G A;  4HE2 A;  3S2V A;  1ZTY A;  3KN3 A;  3Q27 A;  4HXV A;  4LZ8 A;  2CEX A;  3RYD A;  5B7D A;  3IJO B;  3GBB A;  3FJG A;  4O7I A;  4FEC A;  1IMB A;  3T93 B;  3FAT A;  2MKZ A;  4PFU A;  3SEW A;  4PBQ A;  4JVI A;  5FBP A;  5CRY A;  4F39 A;  5AA3 A;  4GWO A;  1FPJ A;  1QUI A;  5JK4 A;  4E0X A;  1NV6 A;  4EUO A;  3OD7 A;  4F22 A;  2M8C A;  2W7Y A;  2O1M A;  3WAF A;  3R7X A;  2HXR A;  4PGP A;  5FHO A;  2GFE A;  4TQU Q;  1WOD A;  4QXD A;  1RYO A;  1LBY A;  4QSC A;  3B6T A;  4X48 A;  4XKP A;  2OX3 A;  4PCD A;  4C1U A;  1SD3 A;  5ITO A;  4YMA A;  2Q2C A;  2NWJ A;  3JYR A;  4ELO A; 
#chains in the Genus database with same CATH homology
 3KBZ A;  3CHG A;  2QFL A;  2PFZ A;  4HE1 A;  4OVS A;  2P3V A;  5IZ3 A;  3E79 A;  1CNQ A;  4XEQ A;  4HCW A;  3FBP A;  4MX6 A;  2QVV A;  5I7I A;  1KZ8 A;  4PFI A;  4XF5 A;  4MNC A;  3U65 A;  3QMF A;  4MHF A;  1IMD A;  1FBH A;  3PTY A;  1QGX A;  4M1V A;  2ZZV A;  4AS5 A;  4GWX A;  1FPE A;  4AS4 A;  1FPG A;  4NN3 A;  2HPG A;  4HCY A;  5EQ7 A;  1FPK A;  4N81 A;  2CEY A;  5IGA A;  2OWZ A;  2KQZ A;  1NV5 A;  2QVU A;  4P56 A;  4GWY A;  1IME A;  1NI9 A;  5CM6 A;  2ZZX A;  4N8G A;  4O8M A;  1NUY A;  2XWI A;  3RPL A;  4P9K A;  4I3Y A;  1LEV A;  2PFY A;  4NHB A;  4F1U A;  4GX4 A;  2DVZ A;  5IZ3 B;  1LBZ A;  2CZH A;  2XWO A;  2JJK A;  1LBX A;  5ET7 A;  4YZZ A;  1FPD A;  5I5P A;  1NV7 A;  1RDY A;  4MEV A;  4X8R A;  3LV0 A;  1AWB A;  2WYP A;  1K9Z A;  4N91 A;  3IFA A;  1DCU A;  4MIJ A;  4IR8 A;  2XXK A;  4F19 A;  2P3N A;  1EYJ A;  2HZL A;  1K9Y A;  3KC0 A;  1NV4 A;  3NOH A;  1KA1 A;  4OAN A;  5IZ1 A;  2L5V A;  4P3L A;  3D1R A;  2QVR A;  2XWV A;  1YXI A;  4OVR A;  2WYK A;  1FBP A;  1LBW A;  4H46 A;  1DBZ A;  5J1D A;  1FSA A;  2R8T A;  4PF8 A;  2Q74 A;  5DW8 A;  2DDK A;  1SPI A;  4PAF A;  4JVD A;  4NQ8 A;  1FJ6 A;  4JVC A;  5EYG A;  2V3Q A;  3MYU A;  2FIX A;  5ET8 A;  4MAG A;  2KR0 A;  2XA5 A;  5LDZ A;  2XWK A;  4PF6 A;  1IMA A;  4OVP A;  4I3E A;  2B4M A;  3B8B A;  3ISP A;  4PAK A;  2DE3 A;  3E78 A;  1IMF A;  1IMC A;  4NGU A;  4PC9 A;  1YYZ A;  4XFE A;  2CZK A;  2Q8M A;  2DE4 A;  4YIC A;  1FRP A;  3ROJ A;  4GX3 A;  4PDH A;  4KXP A;  3IFC A;  5T3J A;  2FVZ A;  2Y5K A;  4OVT A;  1VDW A;  1FBD A;  4G61 A;  1JP4 A;  5F24 A;  4MJO A;  4QBA A;  4GWS A;  3W9W A;  4FBP A;  5EQA A;  1FPI A;  2DE2 A;  4NG7 A;  4PAI A;  5I3S A;  4OVQ A;  2F3B A;  4GBW A;  2VPN A;  3B50 A;  1Q9D A;  3FXB A;  1NV2 A;  1FPL A;  1FBE A;  4N6D A;  3BIG A;  4PFB A;  1FPB A;  4X04 A;  4P1L A;  4PBH A;  1NUZ A;  5EYH A;  4DI4 B;  4GWW A;  5ESY A;  2FBP A;  4PE3 A;  2WBB A;  4N15 A;  1KA0 A;  3BIH A;  4H45 A;  5LTC A;  1FTA A;  1FBC A;  3GYY A;  4PFR A;  3T1B A;  1NV1 A;  4NAP A;  4O94 A;  2V4C A;  4P47 A;  5EQ8 A;  4P8B A;  5ET5 A;  3LUZ A;  2WEF A;  4PTK A;  5IM2 A;  2VT5 A;  2BJI A;  4N17 A;  4MMP A;  2VPO A;  3T0J A;  1RDZ A;  2GQ1 A;  1FBG A;  1NUX A;  2Y5L A;  3SZP A;  4NX1 A;  4GX6 A;  3A29 A;  3KC1 A;  3MST A;  1NUW A;  2F3D A;  4O7M A;  2QPQ A;  1NV0 A;  4X9T A;  4F18 A;  5J16 A;  5IZZ A;  2Q9T A;  2HZK A;  1FBF A;  4OA4 A;  4F1V A;  1YZ0 A;  2PCR A;  4NF0 A;  5EQ9 A;  4GWZ A;  1EYI A;  4HE2 A;  1FJ9 A;  3W9V A;  4HXV A;  1LBV A;  2CEX A;  1BK4 A;  4LN5 A;  3RYD A;  1EYK A;  4O7I A;  5ET6 A;  3HFU A;  4DI3 D;  4PGN A;  1IMB A;  1D9Q A;  1RDX A;  4HE0 A;  2F5X A;  2MKZ A;  4MNI A;  4PBQ A;  2HHM A;  4PDD A;  4JVI A;  5FBP A;  1G0H A;  1FPJ A;  5JK4 A;  2FHY A;  2B4L A;  1NV6 A;  4UAB A;  4PET A;  4N8Y A;  5A5L A;  4I40 A;  4MCO A;  2HXR A;  4PGP A;  1XI6 A;  2WBD A;  4GBV A;  1NV3 A;  4MNP A;  3RPL B;  1G0I A;  4N6K A;  4QXD A;  1LBY A;  2CZI A;  1DK4 A;  2OX3 A;  4PCD A;  1FPF A;  3EKI A;  2FIE A;  2WX9 A;  1INP A;  4N4U A;  2ZZW A;  4P1E A;  4GWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...