5J16A

Crystal structure of inositol monophosphate bound saimpase-ii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
258
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Inositol monophosphate bound SaIMPase-II
rcsb
source organism Staphylococcus aureus (strain mssa476)
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 77
structure length 258
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5j16A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j16A02
4FBPA 4N81A 5ESYA 3BIHA 1FBEA 2GQ1A 1FPJA 1RDXA 1NV7A 2Q8MA 4IR8A 1CNQA 1K9YA 2CZHA 1IMBA 2WBDA 1INPA 1FBGA 2PCRA 1IMAA 4I3YA 3ROJA 2F3BA 1FPBA 1NUWA 1EYIA 1NUXA 2P3VA 5ET6A 5IZ3B 4PTKA 1NV1A 4HXVA 5IZ1A 1G0IA 1IMFA 5EQ8A 1FPFA 2R8TA 1FPGA 2QVVA 4GX6A 4AS5A 5FBPA 1G0HA 3KC1A 1IMEA 5ET8A 1FPKA 4AS4A 3IFCA 1SPIA 2JJKA 3BIGA 3KC0A 5EYGA 4GX4A 1RDYA 1FPDA 1IMCA 1EYKA 2OWZA 1NV4A 4GWUA 3QMFA 1DCUA 1FBCA 2CZIA 1NV5A 4GBWA 5IZ3A 2P3NA 1KA1A 4MJOA 1FBHA 1BK4A 2FIXA 2Y5KA 4HE2A 1QGXA 2BJIA 1KA0A 2OX3A 3KBZA 5ET5A 1XI6A 1LBWA 1LBZA 5EQ7A 2HHMA 1FJ9A 3A29A 4QXDA 3B8BA 2FIEA 4HE0A 2QFLA 1LBVA 1FPIA 3FBPA 1DK4A 1NI9A 4H45A 3T0JA 1YYZA 1FPLA 1K9ZA 4GWXA 5EQAA 1JP4A 2FVZA 4O7IA 2DDKA 4GX3A 1FJ6A 2QVUA 3LV0A 1KZ8A 2FBPA 1DBZA 4GWWA 4I40A 1FTAA 2FHYA 4G61A 5ET7A 5EYHA 1LBXA 2QVRA 1D9QA 2CZKA 2Y5LA 4GBVA 2Q74A 5A5LA 3IFAA 5I3SA 4GWYA 1RDZA 1FBPA 1Q9DA 2VT5A 4KXPA 4GWZA 1NV0A 5F24A 2WBBA 1NV6A 3D1RA 4GWSA 4H46A 4I3EA 2F3DA 1EYJA 4HE1A 5J16A 5EQ9A 1FBDA 1FPEA 1NUYA 3RYDA 5LDZA 5DW8A 1YXIA 1LBYA 2WEFA 1YZ0A 1AWBA 1NV2A 1FRPA 1FSAA 1IMDA 5T3JA 1NUZA 3RPLA 3LUZA 1LEVA 3RPLB 1NV3A 1FBFA 1VDWA
chains in the Genus database with same CATH superfamily
2GQ1A 1EZ9A 3O6IA 3D4GA 1ZU0A 3T96B 4MEVA 1CB6A 2XWVA 3FVNA 2V84A 4R2BA 3MVXA 3FXBA 1Y4TA 2IA4A 1VSOA 4U23A 3RGYA 2HXWA 5EQ8A 4AQ4A 3MZBA 2D3IA 4AS4A 1B4ZA 4O3AA 4F2OA 3WAEA 1POY1 3I6VA 3M3LA 4OVSA 4G2ZA 2CZIA 4NF8B 3OO9A 4NTLA 5HPQA 1POTA 4G68C 1LAFE 3R6UA 2REJA 1XVYA 3GYYA 2ZYOA 2DQVA 3FBPA 4PAIA 4WKMA 3EQ1A 1FQCA 1CE2A 3U93A 1Z7NE 2Z23A 3TTLA 5ET7A 4NG7A 4NF4B 4GIZA 1ANFA 4TLLB 1OMPA 3G3JA 3K0VA 1N04A 1Q9DA 2HAUA 1Y1MA 5I2KA 2WX9A 3FVOA 1B51A 1NV0A 1SW2A 1P1WA 3D1RA 2HQ0A 4PFTA 5I57A 4X48A 5TPAB 2O69A 3O66A 2WEFA 2I4CA 2ONKE 1HSJA 1LFIA 4H1XA 4G77A 4YKJA 4P8BA 2QSXA 2A5TA 4DIGA 2VD2A 1UQWA 2VP1A 2Q9TA 1B3LA 2V93A 4HS7A 3I3VA 1FBEA 3W9WA 4H8JA 4X9TA 1SW5A 2Y7RA 3PUZE 1IZ1A 4HXVA 3S4UA 1JNFA 5KZTA 2XX8A 5CMMA 1IMEA 4QSEA 5ET8A 3U94A 5ICQA 1QKBA 4Q30B 2XA5A 4LA9A 3Q26A 1A8EA 3M8UA 4JVCA 1RYOA 4GF8A 2F36A 3QUJA 4IO3A 1KA1A 1FBHA 1JETA 3CFXA 2R9JA 1NNKA 4Z7EA 1QGXA 3ONMA 2RC7A 1S7YA 4IGTA 3EPEA 1FJ9A 3V8XB 2I6EA 3FV2A 4H65A 1NKXA 3N94A 2RKMA 3MSTA 3UK4A 2DVCA 3MAMA 4OENA 1J1NA 5AA4A 4MIJA 2HXRA 4R9GA 2XXWA 1B40A 4P1LA 2QS4A 1D4NA 3H06B 3IFAA 2FA7A 4N6DA 1RDZA 5FTIA 4RNSA 1OVBA 4F3SA 4NX1A 1FQEA 3VVFA 5CRYA 5LOMA 5IM2A 4F1YA 4QRZA 4OXVA 4U21A 4MLQA 1EZOA 3PPOA 1ZTYA 5I2NB 3PPPA 3CG3A 1WODA 3KOSA 4HCYA 4OTEA 4ESWA 3RYDA 2WYKA 4JBZA 3SEWA 4G68A 1DOTA 3E79A 3K6WA 3KOTA 2F6PA 3MYUA 2PT1A 4PE3A 1FTMA 1DTGA 4KYSA 4RXLA 1B0HA 1JW5A 1ZBMA 4F19A 2O84X 3KN3A 1QUJA 4ESXA 1XS5A 4OVTA 4P11A 3MZ9A 3IJXB 1Y3NA 4U4SA 4PFYA 2DE2A 3PMXA 3FD3A 2JJKA 4YMAA 2ABHA 3WAFA 4NF8A 4R6KA 1TFAA 3QMFA 4PE5B 2V4CA 5CM6A 3V89B 4C1TA 2F6GA 5ISUA 3QUFA 1UTHA 2BJIA 3GZGA 2XD2A 1BLFA 1D3KA 1M5CA 1R1NA 4UA8A 4HE0A 1FQBA 4F18A 3T0JA 2UXAA 5AA2B 4DZ1A 2FVZA 2VD3A 5ITOA 2QVUA 3OO8A 3LV0A 2RC8A 2R6GE 1ZKBA 4DXBA 4PFBA 3C34A 5J1DA 1GGGA 4EDPA 4OESA 5AA3A 2V3TA 4GWZA 3G3GA 2O51A 3C35A 4OZ9A 1MQIA 4F2QA 1MM7A 4POWA 1JEVA 1DPPA 1YXIA 1AWBA 1EU8A 3IB2A 5AE4A 1YPNA 3HO7A 5JTYA 4XKQA 2ZNTA 1FTLA 1T0KA 3SKPA 4QSCA 2XX7A 2PVUA 1RDXA 3G3IA 2RCBA 4PAKA 4IR8A 1ELJA 2AIXA 2REGA 1SVXB 1A7LA 4O7MA 1FTOA 1GTKA 3BFUA 3LR1A 3K01A 3FJGA 3VLVA 2Z22A 1AOVA 2R8TA 5BWJA 3MBPA 1LFGA 3PUXE 3N26A 5EYGA 1XVXA 1YTVA 3S9EA 2I4BA 2OJTA 1Y4CA 4RJZA 4TQUQ 3QXMA 2PFYA 4TOZA 3HFUA 4PF6A 4PP0A 1ZLQA 2F35A 2Y7KA 2QS3A 1JP4A 3IOTA 3KSJA 2PMSA 5F1QA 3DM0A 3GBBA 3TELA 3UP9A 4MFIA 3SEYA 2ANJA 4NN3A 1PBQA 4EF2A 4ZECA 5I7IA 1SYIA 3UORA 3CFZA 3CSBA 5I3SA 3H4ZA 4F29A 2A5SA 3OO6A 3BBRA 4OVPA 1EYJA 2I0BA 3H6VA 4EXLA 1FBDA 4NF6A 5H8FA 2AYSA 1YZ0A 1NV2A 5DEXB 4KCCA 4XIGQ 1DPEA 4NF0A 3GLBA 1QJMA 4RK9A 4XKPA 4LVQA 4JXIA 4POXA 3O2AA 3SDFA 2XXPA 2PT2A 3C32A 1QKAA 2L5VA 1FPBA 2F34A 3IJOB 1URSA 4BDRA 3U65A 1DTZA 1PC3A 1I69A 2F7BA 1IQ7A 1JEUA 4GOTA 3KC0A 5FTHA 2OWZA 1IMCA 2D5WA 1NV4A 1R9LA 1MH3A 1OLAA 2MKZA 5IZ3A 4YICA 3TTRA 4PDHA 4F3BA 4ELRA 2H9BA 1LBWA 1LBZA 1M5BA 1B5IA 1IXHA 2NXOA 3MPLA 1MDP1 2PFZA 3E78A 4EQ7A 1ZIUA 2F8DA 1MPBA 4MHFA 4EF1A 3CI8A 3LSFB 5H8FB 4F3GA 2Q89A 1FJ6A 2DVZA 1KZ8A 5KCJA 4E0WA 4OEVA 3QAXA 4HW8A 3OSRA 4H5FA 1B32A 4ISUA 1DMBA 3B50A 2Z8DA 4F39A 4DXUA 1B7ZA 4X1BA 2VT5A 3DELB 4QHQA 1LSTA 3IB0A 2XXTA 4G8HA 4THIA 3VE1B 1LBCA 4PBHA 2V25A 4R6YA 2E1SA 2V3QA 2ALUA 3KEIA 5I2NA 4XXUA 3RT6B 3K6XA 4XFEA 4LUBA 1MXVA 4GL8A 1VFEA 2FNCA 1TXFA 5CBSA 2GRVA 4LATA 3V83A 1TT1A 3MQ9A 3E13X 4P47A 4R72A 2CMOA 1L5TA 4I3YA 1NMUA 4F3PA 3PU5A 3H6UA 2XXQA 3KG2A 4IO7A 4IGRA 1JVXA 5L9MA 3TKDA 4H0WA 4DCXA 5CBRA 4KHZE 3IB1A 1FCKA 4AB6A 1P1UA 5L8DA 4R74A 2AL4A 3H03A 2M8CA 3PMVA 3C9HA 4ZDMA 4JDFA 2ONSA 2VPOA 1XI6A 1LBBA 2DWJA 4UACA 1HSEA 4G68B 4QFOA 4P9KA 3MZ1A 4O7IA 1ZMGA 4O3BA 4FIMA 4GWWA 1B2HA 4NF5A 1NH7A 5CMCA 1B05A 3VDFA 2QVRA 2Y5LA 4GL0A 4GWYA 1B1XA 1M5DA 1II5A 2P1SA 2QS1A 5JEIA 1N3XA 3G3KA 4I9DA 2ZZXA 4I3EA 5K2XA 1UIUA 3KN8A 2QRYA 4KCDA 2DXYA 3VLUA 4MMPA 2PBWA 2HZKA 4NMYA 4OA4A 1NNTA 4OVQA 1LFHA 2PX1A 3ISPA 4PETA 4QFPA 4N81A 1URDA 2GFEA 4P3LA 3PMWA 1JQFA 4YMBA 4JWOA 4ZS9A 1N76A 4N6PA 1PB9A 3SZPA 4G8MA 1BTJA 4OYVA 4MF3A 3K2DA 3SEXA 5IZ3B 1EH3A 1PDAA 5I2KB 2F7CA 3CRBA 3EHTA 5CI5A 3PPQA 5AA2A 3K1NA 4GQOA 1FPDA 2ZNSA 1FTJA 2ZMBA 3OMBA 4Q0CA 3K4UA 2OPDA 3LUYA 3TMGA 1M5EA 5CMKA 4M1VA 2GHBA 4N8YA 4PDDA 3TQLA 3HCQA 3OD7A 1LB9A 4NHBA 3QSLA 2QL3A 4FECA 2DS9A 1OVTA 4NQ8A 1LAGE 3PV0E 3UGWA 4I40A 4OETA 2XXUA 2CZLA 4N91A 3O9PA 2XXIA 2ZYNA 1FBPA 1Y3QA 4PFWA 3HSTA 3RN8A 3OEKA 5IKBA 3O6GA 4C1UA 4RY1A 3MP1A 1UTBB 4NWDA 1Y20A 5DW8A 1OIBA 2X7QA 1YCJA 2KQZA 2UVIA 1FW0A 4OANA 2KR0A 2I3VA 3TODA 5I57B 3DP8A 3M3KA 1GVCA 3DLNA 1Y3PA 1MY3A 4H6DA 3C33A 1S9TA 3RNNA 1NUWA 3FJMA 2P3VA 3LSLA 4GLIA 1Y1ZA 5IZ1A 1R9QA 4OMBA 4YAHX 2Q2CA 4PCDA 1AL3A 2DYXA 3PUWE 2ESNA 1QVSA 5ELVA 1LGBC 3E3KA 5LTCA 5A5XB 2XXKA 3MWBA 5DTBA 2P2AA 4PQJA 4KI0E 1US4A 2HHMA 4GXAA 1MPDA 1IIWA 4YZZA 3N6TA 4P56A 1BKAA 4YKKA 4F1UA 5I84A 2ZZVA 3B6WA 2OCUA 2OLBA 1MQGA 1DBZA 1NNFA 1LBXA 5ITPA 2CZKA 4PF8A 3MVYA 3PPNA 3TTKA 2WBBA 1GV8A 1LCTA 3K02A 2RINA 4H46A 2UYFA 3L6GA 3ZS6A 2CEXA 4YKPA 1P99A 3SERA 3IOVA 4OFLA 1TFDA 4K3FA 3UA8A 4DXCA 1NNPA 2WYPA 5I58A 3CG1A 2RC9A 3LUZA 1SYHA 5DVJA 1N7WA 4BDMA 3MP8A 5ESYA 3KGCA 4FE8A 3THIA 3BKIB 1NV7A 1Y9UA 1O63A 5B70A 3CFLA 3Q25A 1MY1A 2OWTA 5TPAA 2HPGA 2B3BA 4NEDA 4JVDA 5DEXA 3JZJA 5H8NA 3FGSA 3O28A 4GX6A 5FBPA 1AMFA 2FYIA 1SPIA 1B7HA 2YJPA 1NFTA 4KD5A 3MW0A 1DCUA 2XXHA 3FVKA 5KDTB 4LONB 2HAVA 4H67A 4NWCA 5DYHA 1B52A 2Y5KA 5FHOA 3KBZA 2IEEA 4XKNA 3LC8A 2FIEA 4QFKA 3QYTA 1ATGA 3PD9A 1MY2A 2DWHA 3KSXA 1H43A 1P1QA 4JSDA 3MVWA 1XHYA 4DE8A 1BIYA 2I48A 1SBPA 2FHYA 4R73A 3FXQA 1IEJA 4XKRA 1Q35A 4U22A 3E9XA 4N4UA 3A3CA 2H4IA 2P0SA 3SETA 2DOJA 4U2RA 4XEQA 4HE1A 3M3FA 4NGUA 3LSWA 4X1DA 1FPEA 1N0TA 1FSAA 1FQAA 4QFNA 4ZEIA 4MNPA 4LZ5A 1Q1KA 3H7MA 5L9OA 4KYEA 4PGNA 1VDWA 4BDNA 4IO4A 3HV1A 1P1NA 3G3FA 5DVIA 2ZYMA 1FBGA 2XWKA 3TTNA 3A09A 4OWDA 4QSDA 4FEDA 5IGAA 4I62A 5L9SA 4ZEDA 4C0RA 1FPGA 2XXRA 1TWYA 1IUDA 5FHNA 3BIGA 3N6UA 3FVGA 1EYKA 2O7UA 2Q2AA 3OENA 3IO6A 1NV5A 4P0GA 4OERA 2R71A 3VVDA 3IK6B 4NF5B 2OK2A 2H5YA 3NOHA 4U1OA 2DSFA 2A5TB 1N3WA 3S9MC 3I5OA 3OEMA 2HZLA 4JB7A 1RKMA 3TCGA 3TCHA 3KN7A 4ZEBA 5EYHA 1MG1A 4DI3D 1A8FA 4GBVA 4AB5A 3B7DA 3IL1B 2QMWA 1B46A 3OO7A 3ZSFA 3KZGA 4GWOA 2Q88A 2UVHA 3SEUA 4FAJA 4ZZEA 3RPLB 1FTKA 4OEUA 2OPEA 5H8QA 3BIHA 2NVUB 3K1PA 3USDA 4M4GA 2CZHA 2PCRA 2Y7WA 2F3BA 5AA1A 4MCOA 1EYIA 1MXXA 2UYEA 4TLMB 3T9UA 2NWJA 5B7DA 3UN6A 1OQHA 2F97A 4YB7A 1O7TA 1USYH 3U8QA 1MM6A 1SD3A 3Q27A 5IAIA 2H98A 3EHSA 4GFRA 5K2YA 2V3UA 3AXFA 3ODBA 2O7IA 4F31B 1MH4A 1Z7ME 2PYYA 3OELA 4OQOA 5I5PA 3CVGA 4WEPA 4OHNA 1ZJLA 3DP6A 3PGFA 4H45A 4EXKA 3GBAA 3SESA 1FPLA 4QF9A 3C4MA 1IITA 1YAEA 1I6BA 4IO6A 3FIRA 4YB5A 4Q5TA 1D9QA 2Q74A 1FQDA 2XD3A 5F24A 3IOUA 3SEVA 3S9LC 1N84A 1LLSA 4ECFA 2QS2A 4OFOA 1B58A 4DCYA 1NUYA 1URGA 2BJJX 2X26A 2G93A 2Q8JA 3VXCA 2XXXA 4JWYA 5BUUA 1B4HA 3P7IA 1LCFA 4F1VA 1F9BA 5JTYB 4FBPA 5EHSA 4Z0IA 3D4CA 2DWAA 4R2FA 2NOOA 1IMBA 4PGPA 5I58B 1IMAA 1SQYA 4N15A 4NE4A 1B3EA 4PTKA 1G0IA 3N5LA 3IAZA 5JK4A 2F78A 4N8GA 3IFCA 2DXRA 4XF5A 5ICTA 2GHAA 4FORA 4GWUA 4FATA 5KDTA 4MLVA 3VXBA 2ZNUA 1US5A 4KQPA 1VFDA 1A54A 3O29A 2ZYKA 5CC2A 2I49A 1R6ZA 3C31A 5H8HB 1USYE 3MJNA 3Q28A 4LZ8A 3K1MA 2QFLA 1FPIA 2DWIA 4WEDA 1YYZA 2B4LA 5DVFA 1K9ZA 4GWXA 4KPTA 3H3GA 2DE3A 2LAOA 3Q29A 1EZPA 1WVJA 4R75A 3RUMA 5TP9A 4MNCA 2OBGA 3T1BA 2KLFA 4DDDA 5I56A 2XX9A 5A5XA 4KXPA 1NV6A 1P1OA 2AL5A 2F3DA 4XTCQ 4YU0A 1SW4A 4IY6A 2I0CA 1UTBA 4O8MA 1MRPA 3TAJA 1QUKA 4QBAA 4ONYA 3JYRA 3RLFE 2Y7PA 2VPNA 3W9VA 3VFJA 1XOCA 1NUZA 1JW4A 4LQ2A 4PFIA 4MNIA 1B3FA 2XWIA 2DP8A 1LAXA 1WDNA 3CHGA 3UIFA 3HPIA 5I59A 4P1EA 2Y84A 3MC2A 1FPJA 3EHUA 4MAGA 3K6UA 2Q8MA 4ND9A 1B1HA 1CNQA 3C36A 2CEYA 1PB7A 1LB8A 4RA1A 1O64A 2YPNA 3TFLA 3ROJA 4PFUA 2O68A 1UTHB 4G4PA 5TP9B 2Z8EA 3U92A 1FPFA 3KC1A 2O1MA 4NF4A 3EF7A 4X8RA 1RDYA 4L17A 3L6HA 3T9XB 3FXUA 2X7PA 4PBQA 2P3NA 4ZEFA 4KFQA 1KA0A 1B0LA 2W7YA 3MP6A 3QK6A 4ELPA 5M2VA 3B8BA 2VOZA 3U1OA 1A99A 3ILUB 4NAPA 1QULA 4LP2B 5HM4B 1I6AA 2HFBA 1B9JA 3ZKKA 3TCFA 3PUVE 2G29A 3OXNA 4EQBA 3VV5A 4U1ZA 4EUOA 5A5LA 3FJ7A 3ILTB 4PAFA 4LN5A 4F22A 1AIVA 1B3HA 2E0SA 2VGQA 3W15C 1MPCA 3IR1A 4GD5A 1SW1A 3MVZA 4ZZAA 5EHMA 2H99A 3FUZA 2B65A 3IX1A 5T3JA 1PB8A 2Y7IA 4FJPA 4KYDA 3EN3A 3ECRA 1D9YA 1NV3A 1VR5A 5H8NB 3H6TA 3O6HA 4DLDA 1K9YA 3S9NC 2WBDA 1H44A 1INPA 3EKIA 3R7XA 2GH9A 3G3HA 1UIVA 2XWOA 2QMXA 4Q8RA 3T93B 1NV1A 4GRKA 1G0HA 4P0IA 1FPKA 2F7AA 4FEBA 3FXRA 4N17A 5HBCA 3R26A 1PEBA 1QUIA 2XXVA 4PFRA 1FBCA 4HCWA 4R9FA 4HE2A 5CMBA 3A29A 1H76A 3V5AA 4EQ9A 4IB2A 3G7WA 2ZXTA 1LBVA 4N07A 4IO2A 3DP4A 3OSQA 1RYXA 1MY0A 3TEPA 4IO5A 2DE4A 5FHMA 5F7VA 4WXJA 4G61A 4MH5A 1A40A 2WKYA 3FATA 1IXIA 1MQHA 2ZZWA 3CR9A 3KJTA 3RTWB 1B5JA 3MUQA 2ONRA 1VE4A 2RCAA 4GWSA 4I1DA 4ZE8A 3A3UA 5H8QB 1B6HA 2UVJA 3F11A 5J16A 1LAHE 5EQ9A 1NL5A 5IZZA 4GXSB 4ELOA 3IO4A 2OZZA 1MXYA 1LEVA 4U4XA 1FBFA 1MXZA 3LSXA 3TUSA 1MQDA 1S50A 1SI0A 3CIJA 4N6KA 1AH5A 1N7XA 4G8NA 2H25A 1NUXA 1D9VA 4JSOA 1B3GA 2B4MA 2QVVA 3RTFB 2OWSA 4JWXA 4BDLA 5I56B 3FASA 3T22A 2O1LA 4BLAA 5H8SA 3KFMA 1B7UA 3VVEA 2Z8FA 4GBWA 1BK4A 1MDQA 2FIXA 2D21A 4JVIA 2OX3A 3T66A 5KCJB 5ET5A 5EQ7A 4QXDA 5AA4B 1HSLA 2XHDA 3RT8A 3PTYA 5H8HA 1I6QA 3RQTA 1OQGA 4ELQA 1DK4A 3B6TA 1NI9A 4LZ7A 4R6HA 5EQAA 3LBSA 3B6QA 2I3WA 3IOWA 3IORA 4N13A 1XC1A 4OFJA 3JV9A 3U72A 5TU0A 2QJEA 3RY3A 3BFTA 4ZE9A 1B5HA 3H6WA 3T9VA 1QW0A 4NF6B 3PPRA 4O94A 2YLNA 1NH8A 3K6VA 1MXWA 1FQFA 2F5XA 2QPQA 4RPNA 2HEUA 1MXUA 1OLCA 3KJ7A 4MBPA 4MX6A 4UABA 3RPLA 1SDXA 5EYFA 4LQ5A 3TTMA 4ZEKA 3TDJA 3E4RA 3TPAA 1XT8A 1SI1A 3OOAA 2I58A 4I8CA 4KR5A 3TQWA 4OVRA 3O97A 1H3DA 5ET6A 1A55A 3ZKLA 4GVOA 3GXAA 1IMFA 4AS5A 2HCAA 3CSGA 4YB6A 4E0XA 1MY4A 4GX4A 4RPOA 1H45A 4YKIA 3FZVA 1JVYA 5DT6A 3PUYE 2RF1A 4MJOA 4HTGA 3FV1A 4RYAA 1DSNA 4BDOA 2B3FA 4OVJA 3KBRA 2NUVA 4X04A 4O3CA 4DI4B 3MPKA 3S2VA 4H8IA 3VLWA 4PC9A 2DDKA 3RPWA 4GX3A 4BDQA 2FBPA 1MQJA 1FTAA 2UVGA 3T9HB 3TZAA 1BP5A 3K00A 2VHAA 3HHGA 1PBPA 5AA2D 1KWHA 3PD8A 1IXCA 2O6AA 4H5GA 1M5FA 4IY5A 3TYHA 1GR2A 1MS7A 5I59B 2XXYA 2THIA 3QIMA 5LDZA 4RK2A 1LBYA 1FRPA 1IMDA 1JW1A 4QFLA 3HHFA 1IXGA 3HN0A
chains in the Genus database with same CATH topology
4FBPA 4N81A 5ESYA 3BIHA 4P1EA 3W9WA 1FBEA 2GQ1A 1FPJA 4MAGA 1RDXA 4P3LA 1NV7A 4X9TA 2Q8MA 4PAKA 4IR8A 1CNQA 1K9YA 2CEYA 4MEVA 2XWVA 2CZHA 1IMBA 2WBDA 4PGPA 4F19A 4P47A 1INPA 3EKIA 4O7MA 1FBGA 2PCRA 2HPGA 2L5VA 1IMAA 4I3YA 2XWKA 4N6KA 4JVDA 3ROJA 4N15A 2F3BA 1FPBA 1NUWA 2XWOA 4MCOA 3FXBA 1EYIA 1NUXA 2P3VA 5ET6A 5IGAA 4OVTA 5IZ3B 4PTKA 1NV1A 3U65A 4HXVA 5IZ1A 2B4MA 1G0IA 1IMFA 5EQ8A 1FPFA 2R8TA 1FPGA 2QVVA 4GX6A 4AS5A 4PCDA 5FBPA 5JK4A 1G0HA 3KC1A 4X8RA 1IMEA 5ET8A 1FPKA 4AS4A 2DE2A 4N8GA 3IFCA 1SPIA 2JJKA 3BIGA 3KC0A 5EYGA 4GX4A 1RDYA 2XA5A 4N17A 1FPDA 1IMCA 1EYKA 2OWZA 1NV4A 4GWUA 5LTCA 4JVCA 3QMFA 2XXKA 4OVSA 2V4CA 5CM6A 1DCUA 4PFRA 1FBCA 4PBQA 2CZIA 2MKZA 1NV5A 4GBWA 5IZ3A 2P3NA 1KA1A 4MJOA 2PFYA 1FBHA 4HCWA 4PDHA 4YICA 4M1VA 1BK4A 2FIXA 2Y5KA 4HE2A 1QGXA 2BJIA 1KA0A 2OX3A 3HFUA 4JVIA 4N8YA 3KBZA 5ET5A 1XI6A 1LBWA 1LBZA 5EQ7A 2HHMA 1FJ9A 3A29A 4QXDA 2VPOA 3NOHA 5I5PA 3B8BA 3GYYA 3PTYA 4YZZA 2FIEA 4HE0A 2QFLA 4P56A 1LBVA 4X04A 4NAPA 1FPIA 4F18A 3FBPA 2PFZA 1DK4A 4PAIA 1NI9A 4H45A 3T0JA 3MSTA 4NHBA 3E78A 4DI4B 4MHFA 1YYZA 2B4LA 4P9KA 4F1UA 1FPLA 2ZZVA 1K9ZA 4GWXA 5EQAA 1JP4A 2FVZA 4NQ8A 4O7IA 2DE3A 4PC9A 2DDKA 4GX3A 2HZLA 1FJ6A 2QVUA 2DVZA 3LV0A 4MIJA 2HXRA 1KZ8A 2FBPA 1DBZA 4GWWA 4I40A 2DE4A 4P1LA 1FTAA 2FHYA 4NN3A 4G61A 5ET7A 5EYHA 4DI3D 1LBXA 4NG7A 4OVRA 2QVRA 1D9QA 2CZKA 2Y5LA 4GBVA 4MNCA 4N91A 4PFBA 2Q74A 5A5LA 3T1BA 5I7IA 5J1DA 3B50A 4PF8A 3IFAA 5I3SA 4PAFA 4GWYA 1RDZA 4N6DA 1FBPA 1Q9DA 4LN5A 2VT5A 2WX9A 4XF5A 4KXPA 4GWZA 2ZZWA 4PGNA 1NV0A 4NX1A 5F24A 2WBBA 4N4UA 2ZZXA 4OVPA 1NV6A 4PF6A 3D1RA 5IM2A 4GWSA 4H46A 4I3EA 2F3DA 2CEXA 1EYJA 4XEQA 4HE1A 4PBHA 5J16A 4NGUA 3CHGA 4O8MA 4MMPA 5EQ9A 4O94A 4HCYA 1FBDA 2V3QA 1FPEA 1NUYA 3RYDA 4PDDA 2HZKA 5LDZA 5IZZA 2WYKA 5DW8A 1YXIA 1LBYA 3SZPA 2WEFA 1YZ0A 1AWBA 4OA4A 1NV2A 1FRPA 2F5XA 2QPQA 1FSAA 1IMDA 2WYPA 4QBAA 3E79A 2KQZA 2VPNA 4NF0A 4OVQA 4P8BA 4XFEA 5T3JA 3MYUA 3W9VA 4PE3A 4MNPA 1NUZA 4MX6A 3RPLA 4UABA 4OANA 3ISPA 3LUZA 1LEVA 4PETA 2KR0A 2Q9TA 4PFIA 4MNIA 3RPLB 2XWIA 4F1VA 1NV3A 1FBFA 1VDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBP A;  4N81 A;  5ESY A;  3BIH A;  1FBE A;  2GQ1 A;  1FPJ A;  1RDX A;  1NV7 A;  2Q8M A;  4IR8 A;  1CNQ A;  1K9Y A;  2CZH A;  1IMB A;  2WBD A;  1INP A;  1FBG A;  2PCR A;  1IMA A;  4I3Y A;  3ROJ A;  2F3B A;  1FPB A;  1NUW A;  1EYI A;  1NUX A;  2P3V A;  5ET6 A;  5IZ3 B;  4PTK A;  1NV1 A;  4HXV A;  5IZ1 A;  1G0I A;  1IMF A;  5EQ8 A;  1FPF A;  2R8T A;  1FPG A;  2QVV A;  4GX6 A;  4AS5 A;  5FBP A;  1G0H A;  3KC1 A;  1IME A;  5ET8 A;  1FPK A;  4AS4 A;  3IFC A;  1SPI A;  2JJK A;  3BIG A;  3KC0 A;  5EYG A;  4GX4 A;  1RDY A;  1FPD A;  1IMC A;  1EYK A;  2OWZ A;  1NV4 A;  4GWU A;  3QMF A;  1DCU A;  1FBC A;  2CZI A;  1NV5 A;  4GBW A;  5IZ3 A;  2P3N A;  1KA1 A;  4MJO A;  1FBH A;  1BK4 A;  2FIX A;  2Y5K A;  4HE2 A;  1QGX A;  2BJI A;  1KA0 A;  2OX3 A;  3KBZ A;  5ET5 A;  1XI6 A;  1LBW A;  1LBZ A;  5EQ7 A;  2HHM A;  1FJ9 A;  3A29 A;  4QXD A;  3B8B A;  2FIE A;  4HE0 A;  2QFL A;  1LBV A;  1FPI A;  3FBP A;  1DK4 A;  1NI9 A;  4H45 A;  3T0J A;  1YYZ A;  1FPL A;  1K9Z A;  4GWX A;  5EQA A;  1JP4 A;  2FVZ A;  4O7I A;  2DDK A;  4GX3 A;  1FJ6 A;  2QVU A;  3LV0 A;  1KZ8 A;  2FBP A;  1DBZ A;  4GWW A;  4I40 A;  1FTA A;  2FHY A;  4G61 A;  5ET7 A;  5EYH A;  1LBX A;  2QVR A;  1D9Q A;  2CZK A;  2Y5L A;  4GBV A;  2Q74 A;  5A5L A;  3IFA A;  5I3S A;  4GWY A;  1RDZ A;  1FBP A;  1Q9D A;  2VT5 A;  4KXP A;  4GWZ A;  1NV0 A;  5F24 A;  2WBB A;  1NV6 A;  3D1R A;  4GWS A;  4H46 A;  4I3E A;  2F3D A;  1EYJ A;  4HE1 A;  5J16 A;  5EQ9 A;  1FBD A;  1FPE A;  1NUY A;  3RYD A;  5LDZ A;  5DW8 A;  1YXI A;  1LBY A;  2WEF A;  1YZ0 A;  1AWB A;  1NV2 A;  1FRP A;  1FSA A;  1IMD A;  5T3J A;  1NUZ A;  3RPL A;  3LUZ A;  1LEV A;  3RPL B;  1NV3 A;  1FBF A;  1VDW A; 
#chains in the Genus database with same CATH topology
 2GQ1 A;  1EZ9 A;  3O6I A;  3D4G A;  1ZU0 A;  3T96 B;  4MEV A;  1CB6 A;  2XWV A;  3FVN A;  2V84 A;  4R2B A;  3MVX A;  3FXB A;  1Y4T A;  2IA4 A;  1VSO A;  4U23 A;  3RGY A;  2HXW A;  5EQ8 A;  4AQ4 A;  3MZB A;  2D3I A;  4AS4 A;  1B4Z A;  4O3A A;  4F2O A;  3WAE A;  1POY 1;  3I6V A;  3M3L A;  4OVS A;  4G2Z A;  2CZI A;  4NF8 B;  3OO9 A;  4NTL A;  5HPQ A;  1POT A;  4G68 C;  1LAF E;  3R6U A;  2REJ A;  1XVY A;  3GYY A;  2ZYO A;  2DQV A;  3FBP A;  4PAI A;  4WKM A;  3EQ1 A;  1FQC A;  1CE2 A;  3U93 A;  1Z7N E;  2Z23 A;  3TTL A;  5ET7 A;  4NG7 A;  4NF4 B;  4GIZ A;  1ANF A;  4TLL B;  1OMP A;  3G3J A;  3K0V A;  1N04 A;  1Q9D A;  2HAU A;  1Y1M A;  5I2K A;  2WX9 A;  3FVO A;  1B51 A;  1NV0 A;  1SW2 A;  1P1W A;  3D1R A;  2HQ0 A;  4PFT A;  5I57 A;  4X48 A;  5TPA B;  2O69 A;  3O66 A;  2WEF A;  2I4C A;  2ONK E;  1HSJ A;  1LFI A;  4H1X A;  4G77 A;  4YKJ A;  4P8B A;  2QSX A;  2A5T A;  4DIG A;  2VD2 A;  1UQW A;  2VP1 A;  2Q9T A;  1B3L A;  2V93 A;  4HS7 A;  3I3V A;  1FBE A;  3W9W A;  4H8J A;  4X9T A;  1SW5 A;  2Y7R A;  3PUZ E;  1IZ1 A;  4HXV A;  3S4U A;  1JNF A;  5KZT A;  2XX8 A;  5CMM A;  1IME A;  4QSE A;  5ET8 A;  3U94 A;  5ICQ A;  1QKB A;  4Q30 B;  2XA5 A;  4LA9 A;  3Q26 A;  1A8E A;  3M8U A;  4JVC A;  1RYO A;  4GF8 A;  2F36 A;  3QUJ A;  4IO3 A;  1KA1 A;  1FBH A;  1JET A;  3CFX A;  2R9J A;  1NNK A;  4Z7E A;  1QGX A;  3ONM A;  2RC7 A;  1S7Y A;  4IGT A;  3EPE A;  1FJ9 A;  3V8X B;  2I6E A;  3FV2 A;  4H65 A;  1NKX A;  3N94 A;  2RKM A;  3MST A;  3UK4 A;  2DVC A;  3MAM A;  4OEN A;  1J1N A;  5AA4 A;  4MIJ A;  2HXR A;  4R9G A;  2XXW A;  1B40 A;  4P1L A;  2QS4 A;  1D4N A;  3H06 B;  3IFA A;  2FA7 A;  4N6D A;  1RDZ A;  5FTI A;  4RNS A;  1OVB A;  4F3S A;  4NX1 A;  1FQE A;  3VVF A;  5CRY A;  5LOM A;  5IM2 A;  4F1Y A;  4QRZ A;  4OXV A;  4U21 A;  4MLQ A;  1EZO A;  3PPO A;  1ZTY A;  5I2N B;  3PPP A;  3CG3 A;  1WOD A;  3KOS A;  4HCY A;  4OTE A;  4ESW A;  3RYD A;  2WYK A;  4JBZ A;  3SEW A;  4G68 A;  1DOT A;  3E79 A;  3K6W A;  3KOT A;  2F6P A;  3MYU A;  2PT1 A;  4PE3 A;  1FTM A;  1DTG A;  4KYS A;  4RXL A;  1B0H A;  1JW5 A;  1ZBM A;  4F19 A;  2O84 X;  3KN3 A;  1QUJ A;  4ESX A;  1XS5 A;  4OVT A;  4P11 A;  3MZ9 A;  3IJX B;  1Y3N A;  4U4S A;  4PFY A;  2DE2 A;  3PMX A;  3FD3 A;  2JJK A;  4YMA A;  2ABH A;  3WAF A;  4NF8 A;  4R6K A;  1TFA A;  3QMF A;  4PE5 B;  2V4C A;  5CM6 A;  3V89 B;  4C1T A;  2F6G A;  5ISU A;  3QUF A;  1UTH A;  2BJI A;  3GZG A;  2XD2 A;  1BLF A;  1D3K A;  1M5C A;  1R1N A;  4UA8 A;  4HE0 A;  1FQB A;  4F18 A;  3T0J A;  2UXA A;  5AA2 B;  4DZ1 A;  2FVZ A;  2VD3 A;  5ITO A;  2QVU A;  3OO8 A;  3LV0 A;  2RC8 A;  2R6G E;  1ZKB A;  4DXB A;  4PFB A;  3C34 A;  5J1D A;  1GGG A;  4EDP A;  4OES A;  5AA3 A;  2V3T A;  4GWZ A;  3G3G A;  2O51 A;  3C35 A;  4OZ9 A;  1MQI A;  4F2Q A;  1MM7 A;  4POW A;  1JEV A;  1DPP A;  1YXI A;  1AWB A;  1EU8 A;  3IB2 A;  5AE4 A;  1YPN A;  3HO7 A;  5JTY A;  4XKQ A;  2ZNT A;  1FTL A;  1T0K A;  3SKP A;  4QSC A;  2XX7 A;  2PVU A;  1RDX A;  3G3I A;  2RCB A;  4PAK A;  4IR8 A;  1ELJ A;  2AIX A;  2REG A;  1SVX B;  1A7L A;  4O7M A;  1FTO A;  1GTK A;  3BFU A;  3LR1 A;  3K01 A;  3FJG A;  3VLV A;  2Z22 A;  1AOV A;  2R8T A;  5BWJ A;  3MBP A;  1LFG A;  3PUX E;  3N26 A;  5EYG A;  1XVX A;  1YTV A;  3S9E A;  2I4B A;  2OJT A;  1Y4C A;  4RJZ A;  4TQU Q;  3QXM A;  2PFY A;  4TOZ A;  3HFU A;  4PF6 A;  4PP0 A;  1ZLQ A;  2F35 A;  2Y7K A;  2QS3 A;  1JP4 A;  3IOT A;  3KSJ A;  2PMS A;  5F1Q A;  3DM0 A;  3GBB A;  3TEL A;  3UP9 A;  4MFI A;  3SEY A;  2ANJ A;  4NN3 A;  1PBQ A;  4EF2 A;  4ZEC A;  5I7I A;  1SYI A;  3UOR A;  3CFZ A;  3CSB A;  5I3S A;  3H4Z A;  4F29 A;  2A5S A;  3OO6 A;  3BBR A;  4OVP A;  1EYJ A;  2I0B A;  3H6V A;  4EXL A;  1FBD A;  4NF6 A;  5H8F A;  2AYS A;  1YZ0 A;  1NV2 A;  5DEX B;  4KCC A;  4XIG Q;  1DPE A;  4NF0 A;  3GLB A;  1QJM A;  4RK9 A;  4XKP A;  4LVQ A;  4JXI A;  4POX A;  3O2A A;  3SDF A;  2XXP A;  2PT2 A;  3C32 A;  1QKA A;  2L5V A;  1FPB A;  2F34 A;  3IJO B;  1URS A;  4BDR A;  3U65 A;  1DTZ A;  1PC3 A;  1I69 A;  2F7B A;  1IQ7 A;  1JEU A;  4GOT A;  3KC0 A;  5FTH A;  2OWZ A;  1IMC A;  2D5W A;  1NV4 A;  1R9L A;  1MH3 A;  1OLA A;  2MKZ A;  5IZ3 A;  4YIC A;  3TTR A;  4PDH A;  4F3B A;  4ELR A;  2H9B A;  1LBW A;  1LBZ A;  1M5B A;  1B5I A;  1IXH A;  2NXO A;  3MPL A;  1MDP 1;  2PFZ A;  3E78 A;  4EQ7 A;  1ZIU A;  2F8D A;  1MPB A;  4MHF A;  4EF1 A;  3CI8 A;  3LSF B;  5H8F B;  4F3G A;  2Q89 A;  1FJ6 A;  2DVZ A;  1KZ8 A;  5KCJ A;  4E0W A;  4OEV A;  3QAX A;  4HW8 A;  3OSR A;  4H5F A;  1B32 A;  4ISU A;  1DMB A;  3B50 A;  2Z8D A;  4F39 A;  4DXU A;  1B7Z A;  4X1B A;  2VT5 A;  3DEL B;  4QHQ A;  1LST A;  3IB0 A;  2XXT A;  4G8H A;  4THI A;  3VE1 B;  1LBC A;  4PBH A;  2V25 A;  4R6Y A;  2E1S A;  2V3Q A;  2ALU A;  3KEI A;  5I2N A;  4XXU A;  3RT6 B;  3K6X A;  4XFE A;  4LUB A;  1MXV A;  4GL8 A;  1VFE A;  2FNC A;  1TXF A;  5CBS A;  2GRV A;  4LAT A;  3V83 A;  1TT1 A;  3MQ9 A;  3E13 X;  4P47 A;  4R72 A;  2CMO A;  1L5T A;  4I3Y A;  1NMU A;  4F3P A;  3PU5 A;  3H6U A;  2XXQ A;  3KG2 A;  4IO7 A;  4IGR A;  1JVX A;  5L9M A;  3TKD A;  4H0W A;  4DCX A;  5CBR A;  4KHZ E;  3IB1 A;  1FCK A;  4AB6 A;  1P1U A;  5L8D A;  4R74 A;  2AL4 A;  3H03 A;  2M8C A;  3PMV A;  3C9H A;  4ZDM A;  4JDF A;  2ONS A;  2VPO A;  1XI6 A;  1LBB A;  2DWJ A;  4UAC A;  1HSE A;  4G68 B;  4QFO A;  4P9K A;  3MZ1 A;  4O7I A;  1ZMG A;  4O3B A;  4FIM A;  4GWW A;  1B2H A;  4NF5 A;  1NH7 A;  5CMC A;  1B05 A;  3VDF A;  2QVR A;  2Y5L A;  4GL0 A;  4GWY A;  1B1X A;  1M5D A;  1II5 A;  2P1S A;  2QS1 A;  5JEI A;  1N3X A;  3G3K A;  4I9D A;  2ZZX A;  4I3E A;  5K2X A;  1UIU A;  3KN8 A;  2QRY A;  4KCD A;  2DXY A;  3VLU A;  4MMP A;  2PBW A;  2HZK A;  4NMY A;  4OA4 A;  1NNT A;  4OVQ A;  1LFH A;  2PX1 A;  3ISP A;  4PET A;  4QFP A;  4N81 A;  1URD A;  2GFE A;  4P3L A;  3PMW A;  1JQF A;  4YMB A;  4JWO A;  4ZS9 A;  1N76 A;  4N6P A;  1PB9 A;  3SZP A;  4G8M A;  1BTJ A;  4OYV A;  4MF3 A;  3K2D A;  3SEX A;  5IZ3 B;  1EH3 A;  1PDA A;  5I2K B;  2F7C A;  3CRB A;  3EHT A;  5CI5 A;  3PPQ A;  5AA2 A;  3K1N A;  4GQO A;  1FPD A;  2ZNS A;  1FTJ A;  2ZMB A;  3OMB A;  4Q0C A;  3K4U A;  2OPD A;  3LUY A;  3TMG A;  1M5E A;  5CMK A;  4M1V A;  2GHB A;  4N8Y A;  4PDD A;  3TQL A;  3HCQ A;  3OD7 A;  1LB9 A;  4NHB A;  3QSL A;  2QL3 A;  4FEC A;  2DS9 A;  1OVT A;  4NQ8 A;  1LAG E;  3PV0 E;  3UGW A;  4I40 A;  4OET A;  2XXU A;  2CZL A;  4N91 A;  3O9P A;  2XXI A;  2ZYN A;  1FBP A;  1Y3Q A;  4PFW A;  3HST A;  3RN8 A;  3OEK A;  5IKB A;  3O6G A;  4C1U A;  4RY1 A;  3MP1 A;  1UTB B;  4NWD A;  1Y20 A;  5DW8 A;  1OIB A;  2X7Q A;  1YCJ A;  2KQZ A;  2UVI A;  1FW0 A;  4OAN A;  2KR0 A;  2I3V A;  3TOD A;  5I57 B;  3DP8 A;  3M3K A;  1GVC A;  3DLN A;  1Y3P A;  1MY3 A;  4H6D A;  3C33 A;  1S9T A;  3RNN A;  1NUW A;  3FJM A;  2P3V A;  3LSL A;  4GLI A;  1Y1Z A;  5IZ1 A;  1R9Q A;  4OMB A;  4YAH X;  2Q2C A;  4PCD A;  1AL3 A;  2DYX A;  3PUW E;  2ESN A;  1QVS A;  5ELV A;  1LGB C;  3E3K A;  5LTC A;  5A5X B;  2XXK A;  3MWB A;  5DTB A;  2P2A A;  4PQJ A;  4KI0 E;  1US4 A;  2HHM A;  4GXA A;  1MPD A;  1IIW A;  4YZZ A;  3N6T A;  4P56 A;  1BKA A;  4YKK A;  4F1U A;  5I84 A;  2ZZV A;  3B6W A;  2OCU A;  2OLB A;  1MQG A;  1DBZ A;  1NNF A;  1LBX A;  5ITP A;  2CZK A;  4PF8 A;  3MVY A;  3PPN A;  3TTK A;  2WBB A;  1GV8 A;  1LCT A;  3K02 A;  2RIN A;  4H46 A;  2UYF A;  3L6G A;  3ZS6 A;  2CEX A;  4YKP A;  1P99 A;  3SER A;  3IOV A;  4OFL A;  1TFD A;  4K3F A;  3UA8 A;  4DXC A;  1NNP A;  2WYP A;  5I58 A;  3CG1 A;  2RC9 A;  3LUZ A;  1SYH A;  5DVJ A;  1N7W A;  4BDM A;  3MP8 A;  5ESY A;  3KGC A;  4FE8 A;  3THI A;  3BKI B;  1NV7 A;  1Y9U A;  1O63 A;  5B70 A;  3CFL A;  3Q25 A;  1MY1 A;  2OWT A;  5TPA A;  2HPG A;  2B3B A;  4NED A;  4JVD A;  5DEX A;  3JZJ A;  5H8N A;  3FGS A;  3O28 A;  4GX6 A;  5FBP A;  1AMF A;  2FYI A;  1SPI A;  1B7H A;  2YJP A;  1NFT A;  4KD5 A;  3MW0 A;  1DCU A;  2XXH A;  3FVK A;  5KDT B;  4LON B;  2HAV A;  4H67 A;  4NWC A;  5DYH A;  1B52 A;  2Y5K A;  5FHO A;  3KBZ A;  2IEE A;  4XKN A;  3LC8 A;  2FIE A;  4QFK A;  3QYT A;  1ATG A;  3PD9 A;  1MY2 A;  2DWH A;  3KSX A;  1H43 A;  1P1Q A;  4JSD A;  3MVW A;  1XHY A;  4DE8 A;  1BIY A;  2I48 A;  1SBP A;  2FHY A;  4R73 A;  3FXQ A;  1IEJ A;  4XKR A;  1Q35 A;  4U22 A;  3E9X A;  4N4U A;  3A3C A;  2H4I A;  2P0S A;  3SET A;  2DOJ A;  4U2R A;  4XEQ A;  4HE1 A;  3M3F A;  4NGU A;  3LSW A;  4X1D A;  1FPE A;  1N0T A;  1FSA A;  1FQA A;  4QFN A;  4ZEI A;  4MNP A;  4LZ5 A;  1Q1K A;  3H7M A;  5L9O A;  4KYE A;  4PGN A;  1VDW A;  4BDN A;  4IO4 A;  3HV1 A;  1P1N A;  3G3F A;  5DVI A;  2ZYM A;  1FBG A;  2XWK A;  3TTN A;  3A09 A;  4OWD A;  4QSD A;  4FED A;  5IGA A;  4I62 A;  5L9S A;  4ZED A;  4C0R A;  1FPG A;  2XXR A;  1TWY A;  1IUD A;  5FHN A;  3BIG A;  3N6U A;  3FVG A;  1EYK A;  2O7U A;  2Q2A A;  3OEN A;  3IO6 A;  1NV5 A;  4P0G A;  4OER A;  2R71 A;  3VVD A;  3IK6 B;  4NF5 B;  2OK2 A;  2H5Y A;  3NOH A;  4U1O A;  2DSF A;  2A5T B;  1N3W A;  3S9M C;  3I5O A;  3OEM A;  2HZL A;  4JB7 A;  1RKM A;  3TCG A;  3TCH A;  3KN7 A;  4ZEB A;  5EYH A;  1MG1 A;  4DI3 D;  1A8F A;  4GBV A;  4AB5 A;  3B7D A;  3IL1 B;  2QMW A;  1B46 A;  3OO7 A;  3ZSF A;  3KZG A;  4GWO A;  2Q88 A;  2UVH A;  3SEU A;  4FAJ A;  4ZZE A;  3RPL B;  1FTK A;  4OEU A;  2OPE A;  5H8Q A;  3BIH A;  2NVU B;  3K1P A;  3USD A;  4M4G A;  2CZH A;  2PCR A;  2Y7W A;  2F3B A;  5AA1 A;  4MCO A;  1EYI A;  1MXX A;  2UYE A;  4TLM B;  3T9U A;  2NWJ A;  5B7D A;  3UN6 A;  1OQH A;  2F97 A;  4YB7 A;  1O7T A;  1USY H;  3U8Q A;  1MM6 A;  1SD3 A;  3Q27 A;  5IAI A;  2H98 A;  3EHS A;  4GFR A;  5K2Y A;  2V3U A;  3AXF A;  3ODB A;  2O7I A;  4F31 B;  1MH4 A;  1Z7M E;  2PYY A;  3OEL A;  4OQO A;  5I5P A;  3CVG A;  4WEP A;  4OHN A;  1ZJL A;  3DP6 A;  3PGF A;  4H45 A;  4EXK A;  3GBA A;  3SES A;  1FPL A;  4QF9 A;  3C4M A;  1IIT A;  1YAE A;  1I6B A;  4IO6 A;  3FIR A;  4YB5 A;  4Q5T A;  1D9Q A;  2Q74 A;  1FQD A;  2XD3 A;  5F24 A;  3IOU A;  3SEV A;  3S9L C;  1N84 A;  1LLS A;  4ECF A;  2QS2 A;  4OFO A;  1B58 A;  4DCY A;  1NUY A;  1URG A;  2BJJ X;  2X26 A;  2G93 A;  2Q8J A;  3VXC A;  2XXX A;  4JWY A;  5BUU A;  1B4H A;  3P7I A;  1LCF A;  4F1V A;  1F9B A;  5JTY B;  4FBP A;  5EHS A;  4Z0I A;  3D4C A;  2DWA A;  4R2F A;  2NOO A;  1IMB A;  4PGP A;  5I58 B;  1IMA A;  1SQY A;  4N15 A;  4NE4 A;  1B3E A;  4PTK A;  1G0I A;  3N5L A;  3IAZ A;  5JK4 A;  2F78 A;  4N8G A;  3IFC A;  2DXR A;  4XF5 A;  5ICT A;  2GHA A;  4FOR A;  4GWU A;  4FAT A;  5KDT A;  4MLV A;  3VXB A;  2ZNU A;  1US5 A;  4KQP A;  1VFD A;  1A54 A;  3O29 A;  2ZYK A;  5CC2 A;  2I49 A;  1R6Z A;  3C31 A;  5H8H B;  1USY E;  3MJN A;  3Q28 A;  4LZ8 A;  3K1M A;  2QFL A;  1FPI A;  2DWI A;  4WED A;  1YYZ A;  2B4L A;  5DVF A;  1K9Z A;  4GWX A;  4KPT A;  3H3G A;  2DE3 A;  2LAO A;  3Q29 A;  1EZP A;  1WVJ A;  4R75 A;  3RUM A;  5TP9 A;  4MNC A;  2OBG A;  3T1B A;  2KLF A;  4DDD A;  5I56 A;  2XX9 A;  5A5X A;  4KXP A;  1NV6 A;  1P1O A;  2AL5 A;  2F3D A;  4XTC Q;  4YU0 A;  1SW4 A;  4IY6 A;  2I0C A;  1UTB A;  4O8M A;  1MRP A;  3TAJ A;  1QUK A;  4QBA A;  4ONY A;  3JYR A;  3RLF E;  2Y7P A;  2VPN A;  3W9V A;  3VFJ A;  1XOC A;  1NUZ A;  1JW4 A;  4LQ2 A;  4PFI A;  4MNI A;  1B3F A;  2XWI A;  2DP8 A;  1LAX A;  1WDN A;  3CHG A;  3UIF A;  3HPI A;  5I59 A;  4P1E A;  2Y84 A;  3MC2 A;  1FPJ A;  3EHU A;  4MAG A;  3K6U A;  2Q8M A;  4ND9 A;  1B1H A;  1CNQ A;  3C36 A;  2CEY A;  1PB7 A;  1LB8 A;  4RA1 A;  1O64 A;  2YPN A;  3TFL A;  3ROJ A;  4PFU A;  2O68 A;  1UTH B;  4G4P A;  5TP9 B;  2Z8E A;  3U92 A;  1FPF A;  3KC1 A;  2O1M A;  4NF4 A;  3EF7 A;  4X8R A;  1RDY A;  4L17 A;  3L6H A;  3T9X B;  3FXU A;  2X7P A;  4PBQ A;  2P3N A;  4ZEF A;  4KFQ A;  1KA0 A;  1B0L A;  2W7Y A;  3MP6 A;  3QK6 A;  4ELP A;  5M2V A;  3B8B A;  2VOZ A;  3U1O A;  1A99 A;  3ILU B;  4NAP A;  1QUL A;  4LP2 B;  5HM4 B;  1I6A A;  2HFB A;  1B9J A;  3ZKK A;  3TCF A;  3PUV E;  2G29 A;  3OXN A;  4EQB A;  3VV5 A;  4U1Z A;  4EUO A;  5A5L A;  3FJ7 A;  3ILT B;  4PAF A;  4LN5 A;  4F22 A;  1AIV A;  1B3H A;  2E0S A;  2VGQ A;  3W15 C;  1MPC A;  3IR1 A;  4GD5 A;  1SW1 A;  3MVZ A;  4ZZA A;  5EHM A;  2H99 A;  3FUZ A;  2B65 A;  3IX1 A;  5T3J A;  1PB8 A;  2Y7I A;  4FJP A;  4KYD A;  3EN3 A;  3ECR A;  1D9Y A;  1NV3 A;  1VR5 A;  5H8N B;  3H6T A;  3O6H A;  4DLD A;  1K9Y A;  3S9N C;  2WBD A;  1H44 A;  1INP A;  3EKI A;  3R7X A;  2GH9 A;  3G3H A;  1UIV A;  2XWO A;  2QMX A;  4Q8R A;  3T93 B;  1NV1 A;  4GRK A;  1G0H A;  4P0I A;  1FPK A;  2F7A A;  4FEB A;  3FXR A;  4N17 A;  5HBC A;  3R26 A;  1PEB A;  1QUI A;  2XXV A;  4PFR A;  1FBC A;  4HCW A;  4R9F A;  4HE2 A;  5CMB A;  3A29 A;  1H76 A;  3V5A A;  4EQ9 A;  4IB2 A;  3G7W A;  2ZXT A;  1LBV A;  4N07 A;  4IO2 A;  3DP4 A;  3OSQ A;  1RYX A;  1MY0 A;  3TEP A;  4IO5 A;  2DE4 A;  5FHM A;  5F7V A;  4WXJ A;  4G61 A;  4MH5 A;  1A40 A;  2WKY A;  3FAT A;  1IXI A;  1MQH A;  2ZZW A;  3CR9 A;  3KJT A;  3RTW B;  1B5J A;  3MUQ A;  2ONR A;  1VE4 A;  2RCA A;  4GWS A;  4I1D A;  4ZE8 A;  3A3U A;  5H8Q B;  1B6H A;  2UVJ A;  3F11 A;  5J16 A;  1LAH E;  5EQ9 A;  1NL5 A;  5IZZ A;  4GXS B;  4ELO A;  3IO4 A;  2OZZ A;  1MXY A;  1LEV A;  4U4X A;  1FBF A;  1MXZ A;  3LSX A;  3TUS A;  1MQD A;  1S50 A;  1SI0 A;  3CIJ A;  4N6K A;  1AH5 A;  1N7X A;  4G8N A;  2H25 A;  1NUX A;  1D9V A;  4JSO A;  1B3G A;  2B4M A;  2QVV A;  3RTF B;  2OWS A;  4JWX A;  4BDL A;  5I56 B;  3FAS A;  3T22 A;  2O1L A;  4BLA A;  5H8S A;  3KFM A;  1B7U A;  3VVE A;  2Z8F A;  4GBW A;  1BK4 A;  1MDQ A;  2FIX A;  2D21 A;  4JVI A;  2OX3 A;  3T66 A;  5KCJ B;  5ET5 A;  5EQ7 A;  4QXD A;  5AA4 B;  1HSL A;  2XHD A;  3RT8 A;  3PTY A;  5H8H A;  1I6Q A;  3RQT A;  1OQG A;  4ELQ A;  1DK4 A;  3B6T A;  1NI9 A;  4LZ7 A;  4R6H A;  5EQA A;  3LBS A;  3B6Q A;  2I3W A;  3IOW A;  3IOR A;  4N13 A;  1XC1 A;  4OFJ A;  3JV9 A;  3U72 A;  5TU0 A;  2QJE A;  3RY3 A;  3BFT A;  4ZE9 A;  1B5H A;  3H6W A;  3T9V A;  1QW0 A;  4NF6 B;  3PPR A;  4O94 A;  2YLN A;  1NH8 A;  3K6V A;  1MXW A;  1FQF A;  2F5X A;  2QPQ A;  4RPN A;  2HEU A;  1MXU A;  1OLC A;  3KJ7 A;  4MBP A;  4MX6 A;  4UAB A;  3RPL A;  1SDX A;  5EYF A;  4LQ5 A;  3TTM A;  4ZEK A;  3TDJ A;  3E4R A;  3TPA A;  1XT8 A;  1SI1 A;  3OOA A;  2I58 A;  4I8C A;  4KR5 A;  3TQW A;  4OVR A;  3O97 A;  1H3D A;  5ET6 A;  1A55 A;  3ZKL A;  4GVO A;  3GXA A;  1IMF A;  4AS5 A;  2HCA A;  3CSG A;  4YB6 A;  4E0X A;  1MY4 A;  4GX4 A;  4RPO A;  1H45 A;  4YKI A;  3FZV A;  1JVY A;  5DT6 A;  3PUY E;  2RF1 A;  4MJO A;  4HTG A;  3FV1 A;  4RYA A;  1DSN A;  4BDO A;  2B3F A;  4OVJ A;  3KBR A;  2NUV A;  4X04 A;  4O3C A;  4DI4 B;  3MPK A;  3S2V A;  4H8I A;  3VLW A;  4PC9 A;  2DDK A;  3RPW A;  4GX3 A;  4BDQ A;  2FBP A;  1MQJ A;  1FTA A;  2UVG A;  3T9H B;  3TZA A;  1BP5 A;  3K00 A;  2VHA A;  3HHG A;  1PBP A;  5AA2 D;  1KWH A;  3PD8 A;  1IXC A;  2O6A A;  4H5G A;  1M5F A;  4IY5 A;  3TYH A;  1GR2 A;  1MS7 A;  5I59 B;  2XXY A;  2THI A;  3QIM A;  5LDZ A;  4RK2 A;  1LBY A;  1FRP A;  1IMD A;  1JW1 A;  4QFL A;  3HHF A;  1IXG A;  3HN0 A; 
#chains in the Genus database with same CATH homology
 4FBP A;  4N81 A;  5ESY A;  3BIH A;  4P1E A;  3W9W A;  1FBE A;  2GQ1 A;  1FPJ A;  4MAG A;  1RDX A;  4P3L A;  1NV7 A;  4X9T A;  2Q8M A;  4PAK A;  4IR8 A;  1CNQ A;  1K9Y A;  2CEY A;  4MEV A;  2XWV A;  2CZH A;  1IMB A;  2WBD A;  4PGP A;  4F19 A;  4P47 A;  1INP A;  3EKI A;  4O7M A;  1FBG A;  2PCR A;  2HPG A;  2L5V A;  1IMA A;  4I3Y A;  2XWK A;  4N6K A;  4JVD A;  3ROJ A;  4N15 A;  2F3B A;  1FPB A;  1NUW A;  2XWO A;  4MCO A;  3FXB A;  1EYI A;  1NUX A;  2P3V A;  5ET6 A;  5IGA A;  4OVT A;  5IZ3 B;  4PTK A;  1NV1 A;  3U65 A;  4HXV A;  5IZ1 A;  2B4M A;  1G0I A;  1IMF A;  5EQ8 A;  1FPF A;  2R8T A;  1FPG A;  2QVV A;  4GX6 A;  4AS5 A;  4PCD A;  5FBP A;  5JK4 A;  1G0H A;  3KC1 A;  4X8R A;  1IME A;  5ET8 A;  1FPK A;  4AS4 A;  2DE2 A;  4N8G A;  3IFC A;  1SPI A;  2JJK A;  3BIG A;  3KC0 A;  5EYG A;  4GX4 A;  1RDY A;  2XA5 A;  4N17 A;  1FPD A;  1IMC A;  1EYK A;  2OWZ A;  1NV4 A;  4GWU A;  5LTC A;  4JVC A;  3QMF A;  2XXK A;  4OVS A;  2V4C A;  5CM6 A;  1DCU A;  4PFR A;  1FBC A;  4PBQ A;  2CZI A;  2MKZ A;  1NV5 A;  4GBW A;  5IZ3 A;  2P3N A;  1KA1 A;  4MJO A;  2PFY A;  1FBH A;  4HCW A;  4PDH A;  4YIC A;  4M1V A;  1BK4 A;  2FIX A;  2Y5K A;  4HE2 A;  1QGX A;  2BJI A;  1KA0 A;  2OX3 A;  3HFU A;  4JVI A;  4N8Y A;  3KBZ A;  5ET5 A;  1XI6 A;  1LBW A;  1LBZ A;  5EQ7 A;  2HHM A;  1FJ9 A;  3A29 A;  4QXD A;  2VPO A;  3NOH A;  5I5P A;  3B8B A;  3GYY A;  3PTY A;  4YZZ A;  2FIE A;  4HE0 A;  2QFL A;  4P56 A;  1LBV A;  4X04 A;  4NAP A;  1FPI A;  4F18 A;  3FBP A;  2PFZ A;  1DK4 A;  4PAI A;  1NI9 A;  4H45 A;  3T0J A;  3MST A;  4NHB A;  3E78 A;  4DI4 B;  4MHF A;  1YYZ A;  2B4L A;  4P9K A;  4F1U A;  1FPL A;  2ZZV A;  1K9Z A;  4GWX A;  5EQA A;  1JP4 A;  2FVZ A;  4NQ8 A;  4O7I A;  2DE3 A;  4PC9 A;  2DDK A;  4GX3 A;  2HZL A;  1FJ6 A;  2QVU A;  2DVZ A;  3LV0 A;  4MIJ A;  2HXR A;  1KZ8 A;  2FBP A;  1DBZ A;  4GWW A;  4I40 A;  2DE4 A;  4P1L A;  1FTA A;  2FHY A;  4NN3 A;  4G61 A;  5ET7 A;  5EYH A;  4DI3 D;  1LBX A;  4NG7 A;  4OVR A;  2QVR A;  1D9Q A;  2CZK A;  2Y5L A;  4GBV A;  4MNC A;  4N91 A;  4PFB A;  2Q74 A;  5A5L A;  3T1B A;  5I7I A;  5J1D A;  3B50 A;  4PF8 A;  3IFA A;  5I3S A;  4PAF A;  4GWY A;  1RDZ A;  4N6D A;  1FBP A;  1Q9D A;  4LN5 A;  2VT5 A;  2WX9 A;  4XF5 A;  4KXP A;  4GWZ A;  2ZZW A;  4PGN A;  1NV0 A;  4NX1 A;  5F24 A;  2WBB A;  4N4U A;  2ZZX A;  4OVP A;  1NV6 A;  4PF6 A;  3D1R A;  5IM2 A;  4GWS A;  4H46 A;  4I3E A;  2F3D A;  2CEX A;  1EYJ A;  4XEQ A;  4HE1 A;  4PBH A;  5J16 A;  4NGU A;  3CHG A;  4O8M A;  4MMP A;  5EQ9 A;  4O94 A;  4HCY A;  1FBD A;  2V3Q A;  1FPE A;  1NUY A;  3RYD A;  4PDD A;  2HZK A;  5LDZ A;  5IZZ A;  2WYK A;  5DW8 A;  1YXI A;  1LBY A;  3SZP A;  2WEF A;  1YZ0 A;  1AWB A;  4OA4 A;  1NV2 A;  1FRP A;  2F5X A;  2QPQ A;  1FSA A;  1IMD A;  2WYP A;  4QBA A;  3E79 A;  2KQZ A;  2VPN A;  4NF0 A;  4OVQ A;  4P8B A;  4XFE A;  5T3J A;  3MYU A;  3W9V A;  4PE3 A;  4MNP A;  1NUZ A;  4MX6 A;  3RPL A;  4UAB A;  4OAN A;  3ISP A;  3LUZ A;  1LEV A;  4PET A;  2KR0 A;  2Q9T A;  4PFI A;  4MNI A;  3RPL B;  2XWI A;  4F1V A;  1NV3 A;  1FBF A;  1VDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...