5J16A

Crystal structure of inositol monophosphate bound saimpase-ii
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
258
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNTNVDKATEDFIFDTILETYPNHQVLGEEGHGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase family protein
publication title Crystal structure of Inositol monophosphate bound SaIMPase-II
rcsb
source organism Staphylococcus aureus (strain mssa476)
molecule tags Hydrolase
total genus 77
structure length 258
sequence length 271
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5j16A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5j16A02
1EYJA 2QFLA 4HXVA 2WEFA 2F3BA 5LDZA 1FPEA 1K9ZA 1FBEA 1NV0A 1KA1A 1KZ8A 2R8TA 4GBWA 1AWBA 3RYDA 5ET5A 3T0JA 1FBGA 1EYIA 4I40A 1LBWA 3LUZA 1FPIA 4HE2A 4FBPA 1G0HA 5F24A 2GQ1A 3BIHA 1INPA 2F3DA 1RDXA 4H46A 5T3JA 2OX3A 2JJKA 1JP4A 3KC0A 5ET8A 3KC1A 2PCRA 1NV4A 1LBXA 2Q74A 1CNQA 5IZ3A 1DCUA 4GBVA 1NI9A 2HHMA 4H45A 1FPBA 4PTKA 4I3YA 5IZ3B 1DK4A 1YZ0A 1FJ9A 3IFCA 4GX4A 3D1RA 3IFAA 4GWXA 1YYZA 2VT5A 1FTAA 4HE0A 1K9YA 1XI6A 2CZIA 1NUYA 3RPLA 5EYHA 5EQ8A 1DBZA 2P3VA 3RPLB 4GWUA 1NV6A 1YXIA 2FIEA 3FBPA 4GX3A 1FBHA 1SPIA 1VDWA 2WBBA 1NV5A 2CZKA 2FVZA 1FPLA 2QVRA 1FBCA 2P3NA 2WBDA 1FPKA 4GWYA 5EQAA 1FPFA 2QVUA 5ET7A 4O7IA 1RDYA 1IMBA 4G61A 4I3EA 5EYGA 2BJIA 4KXPA 1NUZA 1NV3A 1NUXA 1FRPA 1LBVA 2CZHA 1FPDA 3A29A 1NV2A 1IMFA 1BK4A 1LBYA 1FBDA 4QXDA 1G0IA 3QMFA 4HE1A 4GWZA 1FPJA 1Q9DA 2QVVA 4AS4A 1NV1A 2DDKA 5FBPA 1FBFA 1LBZA 4GX6A 3B8BA 4IR8A 4N81A 5IZ1A 1IMCA 1NUWA 1RDZA 4AS5A 1EYKA 1KA0A 1QGXA 4GWWA 3ROJA 2Y5LA 4GWSA 1FBPA 2Q8MA 5DW8A 1LEVA 2FHYA 2FIXA 3LV0A 1FPGA 4MJOA 5I3SA 5EQ7A 1D9QA 1NV7A 5ESYA 1IMEA 3BIGA 5A5LA 1IMDA 5ET6A 3KBZA 1FJ6A 2Y5KA 1IMAA 2FBPA 5EQ9A 1FSAA 2OWZA 5J16A
chains in the Genus database with same CATH superfamily
4PAIA 3JV9A 4JBZA 4OERA 2Q9TA 1UTHB 5ET5A 2HXRA 1H43A 3IJXB 2QMXA 1J1NA 1GR2A 3MPLA 2L5VA 2OX3A 2OLBA 3KC0A 4O8MA 4U1OA 3KN3A 4P3LA 2OPDA 1MQJA 2AIXA 3PMWA 4MH5A 1FPBA 1FJ9A 4M4GA 4X48A 2D3IA 1KWHA 1M5BA 1XI6A 5CI5A 5AA4B 3N5LA 3QUFA 1FQAA 1FTJA 4POXA 1N7WA 1B4HA 1NV5A 3TKDA 4ND9A 5K2XA 3FZVA 3PMVA 3VLUA 4X04A 5H8FA 1FQCA 5DEXA 1XHYA 5ICQA 1DTGA 3EHUA 4G8NA 1GV8A 2UYFA 4F1VA 4JSOA 1QJMA 2WKYA 1B7HA 4JXIA 4QXDA 1MXWA 4DCYA 5HPQA 5CMKA 2V4CA 3G7WA 4XFEA 4KPTA 3PUXE 4ZECA 4GWOA 3T9VA 2O1LA 3SKPA 3CI8A 2W7YA 2ZYKA 4OEUA 2DOJA 3RNNA 3FGSA 5DTBA 2ZYNA 1NKXA 5IM2A 1EYJA 3JYRA 4YKKA 3RUMA 1KA1A 3MSTA 3MVZA 3LUZA 3M3LA 1FQFA 4RYAA 2XXTA 5CC2A 2ZNTA 3IAZA 1UTBB 4OQOA 3MZ9A 2H25A 4KR5A 1LBXA 2D21A 1LCTA 3MPKA 3FXRA 3OSQA 1YZ0A 1OLAA 1MPBA 3W15C 1OVTA 4GVOA 2QMWA 1Y9UA 3FVGA 2I0BA 4P1EA 3BFUA 3GBBA 4H5FA 3VFJA 5L9MA 1RKMA 2HQ0A 2PT1A 3H6VA 3VLVA 1D9YA 5BWJA 2WBBA 3PPQA 5A5XA 5L9SA 2WBDA 2OPEA 2P1SA 1XS5A 5CMMA 5K2YA 3TTMA 4HW8A 1N84A 3UP9A 3C34A 3O2AA 4N8GA 1SW1A 2Q8JA 3FXUA 3ZKLA 1LBYA 1A7LA 2Z22A 4X1DA 4PGNA 1Q9DA 4AS4A 4ZZAA 2XWVA 4ZEBA 2VOZA 3PUYE 1MY0A 4MJOA 3SZPA 1D9QA 3LR1A 1GGGA 4EUOA 5KZTA 5CMCA 3PTYA 1SI0A 1FPEA 2QJEA 2DVZA 1IXCA 1ZJLA 4P47A 3KJTA 4N07A 4IB2A 3CVGA 3HSTA 2B3FA 4RPOA 1INPA 3MJNA 3Q26A 4R9GA 1RDXA 2F8DA 1NV4A 1DOTA 4YKIA 3I5OA 1B51A 4U4SA 1MXVA 3GLBA 3TFLA 3D1RA 4O7MA 3IB0A 4U4XA 1GTKA 1QKBA 4OZ9A 2FIEA 4UA8A 4KYDA 2FVZA 4MNPA 5KCJA 3QAXA 3RPWA 1WVJA 2OK2A 4ESXA 4BDMA 4G2ZA 4O7IA 2QS4A 1IMBA 1MXZA 2RINA 2X7QA 1N0TA 1NUZA 2FYIA 4F3BA 3H6WA 3CSGA 3T9HB 1BK4A 1ELJA 4TQUQ 2CMOA 2XXHA 3BBRA 2QS2A 1ZMGA 2UYEA 3A3UA 3KSXA 3R6UA 5I59A 1TFAA 2Q89A 5IZ1A 3ZS6A 2FA7A 2I58A 3EPEA 2XXYA 1N3WA 1AH5A 1FBPA 3SEUA 2UVHA 1FTKA 2Q2CA 3RTFB 3RY3A 4WEPA 2D5WA 3G3KA 1FQDA 2HXWA 3SEYA 2F3BA 1FTMA 2HEUA 2FNCA 2ABHA 2X7PA 4GFRA 1OQHA 3RYDA 5EHSA 3T0JA 5F24A 1HSJA 1B32A 3OO9A 1UIUA 3TTLA 5IGAA 5T3JA 1JP4A 2XXKA 4R6KA 2Q74A 4LP2B 4PETA 4H45A 4G68B 4I3YA 3OEKA 2CEXA 4NF5A 2B65A 4P1LA 1FQBA 1JW5A 1MG1A 3Q29A 5ITPA 3MC2A 4YB5A 4F3GA 4Q8RA 3LC8A 5DVFA 1SW5A 2P3VA 1PDAA 3CG1A 3K6WA 3D4GA 1FBHA 1URDA 2P3NA 3OMBA 1FPKA 1PBPA 1FPFA 1B0HA 3HHGA 3ZSFA 4RK2A 1LBVA 2CZHA 2KLFA 4RK9A 5CBRA 5I7IA 3R26A 1S7YA 4PBHA 3E13X 4NF0A 3OEMA 4ELRA 4YMAA 1LAFE 2O69A 1IUDA 3MBPA 4UACA 1O64A 1LAXA 4E0XA 4ZE9A 1NUWA 1ZU0A 3O28A 5H8NB 4ZEKA 1NV7A 3QK6A 4NAPA 4IO3A 5FHMA 3KBZA 3ODBA 5I2NB 5EQ9A 2I48A 1B3HA 3V89B 2WEFA 1UTHA 1Z7NE 2PFYA 4RXLA 2RC7A 4DIGA 2BJJX 2ZYOA 2M8CA 2DE2A 2ZZVA 1FQEA 4Q0CA 5I57B 4FIMA 1N76A 5FHOA 3FJGA 3GZGA 2Y7PA 5CMBA 2PCRA 1CNQA 4NF8B 2IEEA 3KSJA 2RCAA 3C9HA 4GXAA 4MLQA 1P1NA 2AL4A 4GRKA 5AA4A 1VFDA 4R75A 1SQYA 1MY4A 2PVUA 1NUYA 3IB2A 3H6UA 2CZLA 3C35A 2V3QA 4H6DA 1O7TA 1ZIUA 3TPAA 3A3CA 1A55A 3DELB 3RT8A 3USDA 3KOSA 3W9WA 1OMPA 1FPLA 1QKAA 3T1BA 5TPAB 1SD3A 3OOAA 3S9EA 3C31A 1MPDA 2B4MA 1A8EA 4OXVA 5ET7A 3SESA 4KCDA 4MX6A 2Y7IA 3UK4A 1RDYA 4NF5B 2R9JA 1FTLA 1IMFA 1URSA 1MQHA 1B3LA 5H8QB 1AL3A 4ISUA 4DI3D 5FBPA 2XXUA 4KD5A 3M3KA 2V3TA 1MRPA 2XXXA 4AS5A 4DXBA 1PB7A 2R71A 3FIRA 3K1PA 5I3SA 2XA5A 3PPNA 4GL8A 2FBPA 3FJ7A 4XKPA 4IGRA 4N15A 1FTOA 3PPOA 4AB6A 4GQOA 2UVJA 4GXSB 1AWBA 4BDLA 2XXRA 3B6QA 4PFYA 1UTBA 3RGYA 4H1XA 3TTKA 3MAMA 2QS1A 2Z8DA 1NI9A 4QF9A 5IZ3B 2A5SA 2HAUA 5B70A 5BUUA 2CEYA 1NL5A 4NF6B 1TT1A 2CZIA 4XTCQ 3B7DA 1HSLA 2RF1A 3K6XA 2H99A 4F39A 3FBPA 4GX3A 3BKIB 3OD7A 1XVYA 3TAJA 4MF3A 3ILUB 3S9MC 1VDWA 4PFIA 4ONYA 3TEPA 4LONB 4F31B 4GWYA 4JWOA 3KN8A 4ZEIA 1ANFA 3S4UA 3K2DA 1Z7ME 1Y4TA 1MH4A 1SBPA 4LZ5A 4MCOA 5I56B 1B52A 1NV3A 3U65A 5TP9A 1NV2A 4GL0A 4EDPA 1Y1MA 5L9OA 3HO7A 3CRBA 4Q30B 2NXOA 4XEQA 4LZ8A 1R1NA 1D9VA 3Q28A 4YMBA 3G3GA 4ZE8A 1JNFA 2FHYA 1VR5A 4R9FA 1FPGA 5AA2B 3MP1A 5ELVA 1H45A 4O3AA 2O68A 4IO6A 4PDHA 3V8XB 1M5DA 2QFLA 4N91A 3DLNA 4DXCA 1XC1A 4LQ2A 3QSLA 4I40A 1EYIA 3SEVA 4HE2A 1S9TA 4PFBA 4OYVA 4E0WA 1MY1A 2MKZA 2ONSA 1LGBC 2V93A 4F3PA 1M5FA 3K4UA 4IO7A 3FATA 4ZZEA 4PTKA 1DK4A 4MBPA 4NTLA 3O97A 4LATA 5FHNA 2ZMBA 2UVIA 5IKBA 4IGTA 4R6HA 1EH3A 2QL3A 4QFKA 1DBZA 1LCFA 1Q1KA 1LAHE 3HN0A 1FBCA 1YPNA 4F29A 4U2RA 1QUIA 2XX8A 4ZEFA 3C4MA 2XXQA 4RA1A 4OVQA 2OZZA 4OFJA 4NEDA 4OVRA 4KXPA 2F78A 4H5GA 1NUXA 1FRPA 4H0WA 3DP8A 1IXHA 2PMSA 2XXIA 4JSDA 2GFEA 3KFMA 4C1TA 2QVVA 1SYHA 5F1QA 4EF2A 4IR8A 3HPIA 4OEVA 4PC9A 3FD3A 4N6KA 2KR0A 3LSWA 5F7VA 3K6UA 3TYHA 1NFTA 3CFLA 3TCFA 5TP9B 4XIGQ 3IOVA 5IAIA 1TWYA 3TCHA 4HXVA 3N6TA 1DPEA 3FXBA 4GBWA 5I5PA 4EXKA 3KG2A 3F11A 3BIHA 3Q25A 4IY5A 3MVXA 1YAEA 3CIJA 4PFTA 3P7IA 3K1NA 2JJKA 3KOTA 4G68A 3O6IA 1R6ZA 3B50A 3MYUA 2F7BA 1A99A 5B7DA 4NF4B 3RQTA 2Z23A 4PFWA 1AIVA 3EN3A 1A40A 4JWYA 3MP6A 3GYYA 4GWUA 1NV6A 1YXIA 3OO8A 2UVGA 2Y7KA 4K3FA 4YB7A 4OVSA 1MY3A 2WYKA 2QSXA 4N6PA 4U1ZA 3IORA 2DP8A 5EYGA 4IO5A 2DQVA 1BP5A 4I8CA 1FPDA 4FORA 2F97A 3A29A 4QFNA 2ONKE 4YAHX 1FBDA 3MW0A 4JB7A 4BDRA 2PT2A 4OTEA 4ELQA 1IMCA 1ZKBA 1MQIA 1WDNA 5H8NA 5HM4B 5DW8A 3U8QA 2HPGA 2V84A 5I2NA 3BIGA 3SERA 4YZZA 3MQ9A 5ET6A 4OHNA 4F19A 3DM0A 3U92A 5AA1A 1IXGA 1B5JA 4ZEDA 2Q88A 1OIBA 4MLVA 1R9LA 1FBGA 5I57A 2AYSA 1G0HA 1OQGA 2DXYA 1EU8A 1LB8A 1P1WA 3VE1B 2ZNSA 4NF8A 2Y7RA 1LFHA 1D4NA 3IFCA 3CR9A 3IFAA 1IIWA 3VXBA 2F5XA 1BLFA 3N26A 3PUZE 3FUZA 1JVXA 3IOUA 3AXFA 3TTNA 2ZNUA 5TPAA 1SW4A 1SPIA 3K01A 4FEDA 4XF5A 1ZLQA 1Y3NA 4XKRA 2GHAA 1Q35A 2DXRA 4BDQA 3WAFA 5H8QA 1I69A 3KN7A 3L6GA 5FTIA 2A5TA 4QBAA 4HE1A 4N13A 4GWZA 2I49A 4R2FA 4NWDA 3S2VA 2Z8FA 4DDDA 4GIZA 4R74A 1DTZA 3T9UA 3VV5A 1RDZA 1B58A 2F7CA 1EYKA 4H8IA 4NG7A 1CB6A 5HBCA 3B6WA 1USYH 3TMGA 5EYFA 1GVCA 4POWA 4F18A 4GF8A 3ZKKA 5CM6A 4R2BA 4HS7A 1NV0A 2YLNA 2R8TA 2ONRA 4BDNA 2O6AA 4TLMB 3LSFB 4WKMA 5CRYA 1EZ9A 2F3DA 4NE4A 3KC1A 3FVOA 2WX9A 5IZ3A 4HCWA 2ANJA 4NF6A 2REGA 1N3XA 1SI1A 2PYYA 1QUJA 3QIMA 4OENA 5IZZA 4MIJA 2NWJA 2PX1A 1JEVA 3WAEA 4LVQA 2YJPA 3IX1A 1H44A 3MUQA 2QVRA 1JVYA 4MMPA 5ITOA 2F7AA 1NNFA 2VP1A 4QFPA 5I56A 3TQLA 4AB5A 2HZKA 3PPPA 2V3UA 2H9BA 4MFIA 4IY6A 3FASA 1G0IA 3QMFA 4QSEA 3TTRA 1FPJA 1LBCA 4XKNA 3K0VA 4N81A 5I2KB 4KFQA 4EQ9A 5KDTB 4PAFA 3EKIA 3N6UA 2X26A 3LSXA 5AA2A 3PD9A 1DMBA 1PC3A 2REJA 4BDOA 1B1XA 4YKPA 2A5TB 4F3SA 5LDZA 2B4LA 4R73A 4HCYA 2F34A 4YB6A 2VD2A 4F22A 2XX9A 3JZJA 3CFXA 2I3VA 5L8DA 3KJ7A 4LA9A 5DVIA 3TELA 2O7UA 2VD3A 2RCBA 3SDFA 1MQDA 1NH7A 1VFEA 1DCUA 3VXCA 2XXPA 2HHMA 4TLLB 2VPNA 1SVXB 4OMBA 3KZGA 1JW4A 1YYZA 2PBWA 1PB9A 1XT8A 3MVWA 1NNKA 2E1SA 2G93A 1PBQA 1A54A 1LFIA 3HHFA 2GH9A 4PFUA 1RYXA 3PV0E 1TXFA 2OJTA 4YICA 4P8BA 2H5YA 3H4ZA 1B7ZA 4RNSA 4I3EA 2BJIA 1OLCA 3EHSA 3PGFA 1F9BA 1NV1A 3L6HA 4FEBA 3B8BA 4QSCA 1BKAA 1Y3PA 3QUJA 5H8SA 4DI4B 3W9VA 1XVXA 3MWBA 3PUVE 1B05A 4RPNA 4G8MA 3T22A 2XWKA 1FCKA 2XD3A 1SYIA 1N04A 4ZS9A 4YKJA 1IMDA 2Y5KA 4PE5B 3H03A 5ICTA 3TQWA 5AA3A 3FVKA 4EQBA 2DSFA 2XX7A 1FBEA 1ZBMA 1SW2A 2DYXA 1P1QA 1MS7A 3VVFA 1FW0A 3C32A 2HZLA 4NMYA 2VHAA 3OSRA 1BIYA 3MP8A 3FV2A 4P9KA 4P0IA 3FVNA 4NF4A 2VT5A 3D4CA 2GHBA 3IB1A 1USYE 2F35A 1MY2A 2F36A 3RPLB 2H4IA 4G8HA 1MXYA 3R7XA 5I84A 3QXMA 2CZKA 1MXXA 4FECA 5J1DA 3O29A 4DE8A 1Y4CA 1N7XA 4LQ5A 4U21A 1VE4A 4X9TA 4YU0A 1IITA 2B3BA 1B6HA 5JTYB 3CSBA 3I3VA 3H7MA 1JQFA 4LZ7A 2DDKA 1LFGA 1PEBA 1LBZA 4GX6A 2QRYA 3EF7A 3OO7A 4G4PA 1MXUA 4N17A 5DT6A 1R9QA 5I58B 2I4CA 3TDJA 3VVDA 1B40A 1KA0A 1DSNA 5LTCA 2O51A 1B1HA 1YCJA 4F1YA 5H8HB 3QYTA 2OCUA 2P2AA 4P0GA 2O1MA 2DWIA 3C36A 4KYEA 1NH8A 4GD5A 2ZYMA 4RJZA 1S50A 1K9ZA 4X8RA 3A09A 4KI0E 1KZ8A 4OANA 1IZ1A 1BTJA 3UIFA 1B0LA 3PPRA 1FPIA 4FBPA 4PF8A 3NOHA 4OA4A 3OXNA 4MHFA 4OFLA 2PFZA 4U23A 4GBVA 1AOVA 2LAOA 2ALUA 4GX4A 4JVCA 3SEXA 4PAKA 1UQWA 5EYHA 5EQ8A 4JVDA 3G3FA 1I6BA 2NUVA 1P1UA 1LAGE 4Z7EA 3LBSA 1Y3QA 4I62A 2WYPA 2KQZA 3HCQA 3K6VA 5EQAA 1H76A 5H8FB 5DEXB 2F6GA 4IO2A 4FAJA 4WXJA 3ILTB 3UORA 1B5HA 4OVPA 2ZXTA 4Q5TA 2I6EA 1ZTYA 3GXAA 3T66A 2GRVA 2RC8A 3ECRA 3FXQA 3E79A 3SEWA 3UA8A 3FJMA 5LOMA 3M3FA 3O6GA 4QFOA 3PMXA 1POY1 2E0SA 1QGXA 3EQ1A 3T9XB 4PQJA 3MVYA 2Y5LA 1OVBA 2I4BA 1JW1A 3LV0A 5EQ7A 1DPPA 4QSDA 2XD2A 2OWTA 5A5LA 2VPOA 3V83A 1FJ6A 2OWZA 1RYOA 4DLDA 3MZ1A 3HV1A 1T0KA 1EZPA 4EXLA 3IO6A 4NWCA 3C33A 4KHZE 2GQ1A 4EQ7A 3DP6A 4R6YA 3O6HA 1US5A 4H46A 1B9JA 4O94A 3B6TA 3OELA 2QS3A 2Q2AA 3U1OA 1LLSA 1PB8A 1POTA 2THIA 4OESA 2DWAA 4QHQA 1K9YA 3TODA 1CE2A 3CHGA 3DP4A 2HAVA 1UIVA 1NNPA 5EHMA 5AA2D 4KYSA 2I3WA 4F2QA 3VVEA 1B46A 4P11A 4UABA 5AE4A 2DVCA 2NVUB 4DZ1A 5A5XB 4KQPA 4H65A 4PE3A 2ZZXA 4PGPA 4G68C 3O9PA 1YTVA 4N8YA 4NQ8A 4ESWA 4ELPA 3BFTA 1M5EA 4C1UA 4PP0A 4NX1A 1O63A 4MEVA 2HCAA 4F1UA 1A8FA 4ZDMA 3K1MA 5I2KA 4PDDA 3IK6B 5KDTA 2OBGA 4RY1A 2YPNA 3RT6B 2Y7WA 4L17A 4OETA 3KBRA 4GWWA 4N6DA 3U94A 4GWSA 3K02A 1LBBA 2FIXA 1IEJA 1MPCA 3OENA 3I6VA 1QW0A 2IA4A 2XXWA 3IOWA 4DCXA 1TFDA 1IQ7A 3T93B 1D3KA 4QFLA 3UN6A 3ISPA 3G3HA 4G77A 2HFBA 1LBWA 2XWIA 2DE4A 4JVIA 5ISUA 4PBQA 3U72A 2XXVA 3K00A 5ET8A 3H3GA 3E78A 2RC9A 4THIA 3H6TA 4WEDA 1II5A 4PF6A 2QPQA 3HFUA 3OO6A 1FTAA 4HE0A 4NN3A 2P0SA 5JEIA 4KCCA 2R6GE 3IL1B 4P56A 1B5IA 3LUYA 3S9NC 4LN5A 2VGQA 4DXUA 1JETA 4MNIA 4HTGA 1P99A 2O7IA 4OFOA 4GOTA 3G3JA 3GBAA 5KCJB 1JEUA 2DWHA 2V25A 2RKMA 4G61A 4C0RA 1VSOA 4XXUA 4U22A 5TU0A 3IO4A 3IR1A 3V5AA 3N94A 3LSLA 4FJPA 1ATGA 3E4RA 1MQGA 2ESNA 3SETA 1FBFA 4XKQA 1B7UA 3EHTA 1B3FA 3E9XA 5I59B 5FTHA 1I6AA 2AL5A 4I9DA 3G3IA 3T96B 3S9LC 4OVJA 3VLWA 3RN8A 1QULA 5ESYA 1IMEA 4TOZA 1URGA 2Z8EA 3UGWA 4R72A 3TZAA 2G29A 4ELOA 4N4UA 3VDFA 3MZBA 2F6PA 2UXAA 3KEIA 2DE3A 3TCGA 1NNTA 3PD8A 2I0CA 4OVTA 1B2HA 1QUKA 2XHDA 3O66A 4IO4A 4NGUA 2NOOA 4M1VA 3CG3A 2ZZWA 4I1DA 4LUBA 4AQ4A 5DVJA 5JK4A 1WODA 1LSTA 4GWXA 4F2OA 3KGCA 1EZOA 3TUSA 1HSEA 3RPLA 2H98A 4NHBA 1MM6A 4MNCA 1NMUA 5CBSA 5M2VA 4BLAA 2OWSA 1Y1ZA 4FE8A 3E3KA 4O3CA 3CFZA 3IOTA 4Z0IA 2QVUA 4GLIA 3PU5A 1MDQA 2DS9A 4QRZA 3IJOB 1B4ZA 4FATA 4H67A 1US4A 2XWOA 1B3GA 3RLFE 3Q27A 1MH3A 4H8JA 1AMFA 4OWDA 5JTYA 4EF1A 3PUWE 3U93A 1LB9A 2Y84A 2O84X 4ECFA 3RTWB 3H06B 5I58A 4JDFA 4PFRA 1Y20A 1QVSA 1H3DA 4JWXA 3THIA 2DWJA 5H8HA 4MAGA 1MDP1 1M5CA 3ROJA 1SDXA 1B3EA 2Q8MA 3M8UA 1LEVA 1I6QA 1XOCA 1MM7A 4X1BA 1P1OA 4O3BA 3ONMA 1L5TA 1IMAA 3FV1A 5DYHA 1FSAA 4PCDA 5J16A 1IXIA
chains in the Genus database with same CATH topology
2WEFA 1K9ZA 4X8RA 2PFYA 4PAIA 1KZ8A 4OANA 2Q9TA 5ET5A 1FBGA 2HXRA 1FPIA 4FBPA 1G0HA 2DE2A 2ZZVA 4PF8A 3NOHA 4OA4A 4MHFA 2L5VA 2OX3A 3KC0A 4O8MA 2PCRA 4P3LA 1CNQA 2PFZA 4GBVA 1FPBA 1FJ9A 3IFCA 4GX4A 3IFAA 4JVCA 4PAKA 2F5XA 1XI6A 1NUYA 5EYHA 5EQ8A 2V3QA 4JVDA 3W9WA 1SPIA 1NV5A 1FPLA 3T1BA 4XF5A 4X04A 2WYPA 2KQZA 2B4MA 5EQAA 5ET7A 4MX6A 1RDYA 4F1VA 4OVPA 1IMFA 3E79A 4QXDA 4QBAA 4HE1A 4DI3D 4GWZA 5FBPA 2V4CA 4XFEA 1RDZA 4AS5A 1EYKA 1QGXA 4NG7A 2Y5LA 3LV0A 5I3SA 5EQ7A 2XA5A 5A5LA 2VPOA 1FJ6A 2FBPA 2OWZA 4F18A 5IM2A 4N15A 1EYJA 5CM6A 1NV0A 1KA1A 3MSTA 2R8TA 1AWBA 3LUZA 2GQ1A 2F3DA 4H46A 4O94A 3KC1A 1LBXA 2WX9A 5IZ3A 4HCWA 1NI9A 5IZ3B 1YZ0A 2CEYA 1K9YA 2CZIA 3CHGA 5IZZA 4MIJA 4P1EA 3FBPA 4GX3A 1VDWA 2WBBA 4UABA 2QVRA 4PFIA 2WBDA 4MMPA 4GWYA 4PE3A 2ZZXA 4PGPA 2HZKA 4MCOA 4N8GA 1NV3A 3U65A 4N8YA 4NQ8A 1NV2A 4NX1A 1LBYA 1G0IA 3QMFA 4MEVA 4F1UA 1FPJA 1Q9DA 4AS4A 4PGNA 4PDDA 4XEQA 2XWVA 4N81A 4PAFA 3EKIA 4GWWA 4N6DA 4GWSA 2FHYA 2FIXA 1FPGA 4MJOA 3SZPA 1D9QA 4PDHA 2QFLA 3PTYA 4N91A 5LDZA 1FPEA 2B4LA 2DVZA 3ISPA 4HCYA 4P47A 4I40A 1EYIA 1LBWA 2XWIA 2DE4A 4HE2A 4JVIA 4PFBA 1INPA 4PBQA 1RDXA 2MKZA 5ET8A 1NV4A 3E78A 1DCUA 2HHMA 2VPNA 4PTKA 1DK4A 4PF6A 3D1RA 2QPQA 1YYZA 3HFUA 4O7MA 1FTAA 4HE0A 4NN3A 4P56A 1DBZA 4LN5A 2FIEA 4MNIA 2FVZA 4MNPA 1FBCA 4YICA 4P8BA 4O7IA 4OVQA 1IMBA 4G61A 4I3EA 2BJIA 4OVRA 4KXPA 1NUZA 1NUXA 1FRPA 1BK4A 2QVVA 1NV1A 1FBFA 3B8BA 4IR8A 4PC9A 5IZ1A 4N6KA 4DI4B 2KR0A 3W9VA 1FBPA 2XWKA 5ESYA 1IMEA 1IMDA 2Y5KA 4HXVA 4N4UA 2F3BA 1FBEA 3FXBA 4GBWA 5I5PA 3RYDA 3T0JA 2DE3A 2HZLA 4OVTA 5F24A 3BIHA 5IGAA 5T3JA 2JJKA 1JP4A 2XXKA 2Q74A 4NGUA 4M1VA 4PETA 2ZZWA 4P9KA 3B50A 3MYUA 4H45A 5JK4A 4I3YA 4GWXA 2CEXA 2VT5A 4P1LA 3RPLA 4NHBA 4MNCA 3GYYA 2P3VA 3RPLB 4GWUA 1NV6A 1YXIA 1FBHA 2CZKA 5J1DA 2P3NA 4OVSA 1FPKA 2WYKA 1FPFA 2QVUA 5EYGA 4X9TA 2XWOA 1LBVA 2CZHA 1FPDA 3A29A 5I7IA 4PBHA 1FBDA 4NF0A 2DDKA 1LBZA 4PFRA 4GX6A 4N17A 1IMCA 1NUWA 4MAGA 1KA0A 5LTCA 3ROJA 2Q8MA 5DW8A 1LEVA 2HPGA 1NV7A 3BIGA 4NAPA 4YZZA 4F19A 5ET6A 3KBZA 1IMAA 5EQ9A 1FSAA 4PCDA 5J16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYJ A;  2QFL A;  4HXV A;  2WEF A;  2F3B A;  5LDZ A;  1FPE A;  1K9Z A;  1FBE A;  1NV0 A;  1KA1 A;  1KZ8 A;  2R8T A;  4GBW A;  1AWB A;  3RYD A;  5ET5 A;  3T0J A;  1FBG A;  1EYI A;  4I40 A;  1LBW A;  3LUZ A;  1FPI A;  4HE2 A;  4FBP A;  1G0H A;  5F24 A;  2GQ1 A;  3BIH A;  1INP A;  2F3D A;  1RDX A;  4H46 A;  5T3J A;  2OX3 A;  2JJK A;  1JP4 A;  3KC0 A;  5ET8 A;  3KC1 A;  2PCR A;  1NV4 A;  1LBX A;  2Q74 A;  1CNQ A;  5IZ3 A;  1DCU A;  4GBV A;  1NI9 A;  2HHM A;  4H45 A;  1FPB A;  4PTK A;  4I3Y A;  5IZ3 B;  1DK4 A;  1YZ0 A;  1FJ9 A;  3IFC A;  4GX4 A;  3D1R A;  3IFA A;  4GWX A;  1YYZ A;  2VT5 A;  1FTA A;  4HE0 A;  1K9Y A;  1XI6 A;  2CZI A;  1NUY A;  3RPL A;  5EYH A;  5EQ8 A;  1DBZ A;  2P3V A;  3RPL B;  4GWU A;  1NV6 A;  1YXI A;  2FIE A;  3FBP A;  4GX3 A;  1FBH A;  1SPI A;  1VDW A;  2WBB A;  1NV5 A;  2CZK A;  2FVZ A;  1FPL A;  2QVR A;  1FBC A;  2P3N A;  2WBD A;  1FPK A;  4GWY A;  5EQA A;  1FPF A;  2QVU A;  5ET7 A;  4O7I A;  1RDY A;  1IMB A;  4G61 A;  4I3E A;  5EYG A;  2BJI A;  4KXP A;  1NUZ A;  1NV3 A;  1NUX A;  1FRP A;  1LBV A;  2CZH A;  1FPD A;  3A29 A;  1NV2 A;  1IMF A;  1BK4 A;  1LBY A;  1FBD A;  4QXD A;  1G0I A;  3QMF A;  4HE1 A;  4GWZ A;  1FPJ A;  1Q9D A;  2QVV A;  4AS4 A;  1NV1 A;  2DDK A;  5FBP A;  1FBF A;  1LBZ A;  4GX6 A;  3B8B A;  4IR8 A;  4N81 A;  5IZ1 A;  1IMC A;  1NUW A;  1RDZ A;  4AS5 A;  1EYK A;  1KA0 A;  1QGX A;  4GWW A;  3ROJ A;  2Y5L A;  4GWS A;  1FBP A;  2Q8M A;  5DW8 A;  1LEV A;  2FHY A;  2FIX A;  3LV0 A;  1FPG A;  4MJO A;  5I3S A;  5EQ7 A;  1D9Q A;  1NV7 A;  5ESY A;  1IME A;  3BIG A;  5A5L A;  1IMD A;  5ET6 A;  3KBZ A;  1FJ6 A;  2Y5K A;  1IMA A;  2FBP A;  5EQ9 A;  1FSA A;  2OWZ A;  5J16 A; 
#chains in the Genus database with same CATH topology
 4PAI A;  3JV9 A;  4JBZ A;  4OER A;  2Q9T A;  1UTH B;  5ET5 A;  2HXR A;  1H43 A;  3IJX B;  2QMX A;  1J1N A;  1GR2 A;  3MPL A;  2L5V A;  2OX3 A;  2OLB A;  3KC0 A;  4O8M A;  4U1O A;  3KN3 A;  4P3L A;  2OPD A;  1MQJ A;  2AIX A;  3PMW A;  4MH5 A;  1FPB A;  1FJ9 A;  4M4G A;  4X48 A;  2D3I A;  1KWH A;  1M5B A;  1XI6 A;  5CI5 A;  5AA4 B;  3N5L A;  3QUF A;  1FQA A;  1FTJ A;  4POX A;  1N7W A;  1B4H A;  1NV5 A;  3TKD A;  4ND9 A;  5K2X A;  3FZV A;  3PMV A;  3VLU A;  4X04 A;  5H8F A;  1FQC A;  5DEX A;  1XHY A;  5ICQ A;  1DTG A;  3EHU A;  4G8N A;  1GV8 A;  2UYF A;  4F1V A;  4JSO A;  1QJM A;  2WKY A;  1B7H A;  4JXI A;  4QXD A;  1MXW A;  4DCY A;  5HPQ A;  5CMK A;  2V4C A;  3G7W A;  4XFE A;  4KPT A;  3PUX E;  4ZEC A;  4GWO A;  3T9V A;  2O1L A;  3SKP A;  3CI8 A;  2W7Y A;  2ZYK A;  4OEU A;  2DOJ A;  3RNN A;  3FGS A;  5DTB A;  2ZYN A;  1NKX A;  5IM2 A;  1EYJ A;  3JYR A;  4YKK A;  3RUM A;  1KA1 A;  3MST A;  3MVZ A;  3LUZ A;  3M3L A;  1FQF A;  4RYA A;  2XXT A;  5CC2 A;  2ZNT A;  3IAZ A;  1UTB B;  4OQO A;  3MZ9 A;  2H25 A;  4KR5 A;  1LBX A;  2D21 A;  1LCT A;  3MPK A;  3FXR A;  3OSQ A;  1YZ0 A;  1OLA A;  1MPB A;  3W15 C;  1OVT A;  4GVO A;  2QMW A;  1Y9U A;  3FVG A;  2I0B A;  4P1E A;  3BFU A;  3GBB A;  4H5F A;  3VFJ A;  5L9M A;  1RKM A;  2HQ0 A;  2PT1 A;  3H6V A;  3VLV A;  1D9Y A;  5BWJ A;  2WBB A;  3PPQ A;  5A5X A;  5L9S A;  2WBD A;  2OPE A;  2P1S A;  1XS5 A;  5CMM A;  5K2Y A;  3TTM A;  4HW8 A;  1N84 A;  3UP9 A;  3C34 A;  3O2A A;  4N8G A;  1SW1 A;  2Q8J A;  3FXU A;  3ZKL A;  1LBY A;  1A7L A;  2Z22 A;  4X1D A;  4PGN A;  1Q9D A;  4AS4 A;  4ZZA A;  2XWV A;  4ZEB A;  2VOZ A;  3PUY E;  1MY0 A;  4MJO A;  3SZP A;  1D9Q A;  3LR1 A;  1GGG A;  4EUO A;  5KZT A;  5CMC A;  3PTY A;  1SI0 A;  1FPE A;  2QJE A;  2DVZ A;  1IXC A;  1ZJL A;  4P47 A;  3KJT A;  4N07 A;  4IB2 A;  3CVG A;  3HST A;  2B3F A;  4RPO A;  1INP A;  3MJN A;  3Q26 A;  4R9G A;  1RDX A;  2F8D A;  1NV4 A;  1DOT A;  4YKI A;  3I5O A;  1B51 A;  4U4S A;  1MXV A;  3GLB A;  3TFL A;  3D1R A;  4O7M A;  3IB0 A;  4U4X A;  1GTK A;  1QKB A;  4OZ9 A;  2FIE A;  4UA8 A;  4KYD A;  2FVZ A;  4MNP A;  5KCJ A;  3QAX A;  3RPW A;  1WVJ A;  2OK2 A;  4ESX A;  4BDM A;  4G2Z A;  4O7I A;  2QS4 A;  1IMB A;  1MXZ A;  2RIN A;  2X7Q A;  1N0T A;  1NUZ A;  2FYI A;  4F3B A;  3H6W A;  3CSG A;  3T9H B;  1BK4 A;  1ELJ A;  4TQU Q;  2CMO A;  2XXH A;  3BBR A;  2QS2 A;  1ZMG A;  2UYE A;  3A3U A;  3KSX A;  3R6U A;  5I59 A;  1TFA A;  2Q89 A;  5IZ1 A;  3ZS6 A;  2FA7 A;  2I58 A;  3EPE A;  2XXY A;  1N3W A;  1AH5 A;  1FBP A;  3SEU A;  2UVH A;  1FTK A;  2Q2C A;  3RTF B;  3RY3 A;  4WEP A;  2D5W A;  3G3K A;  1FQD A;  2HXW A;  3SEY A;  2F3B A;  1FTM A;  2HEU A;  2FNC A;  2ABH A;  2X7P A;  4GFR A;  1OQH A;  3RYD A;  5EHS A;  3T0J A;  5F24 A;  1HSJ A;  1B32 A;  3OO9 A;  1UIU A;  3TTL A;  5IGA A;  5T3J A;  1JP4 A;  2XXK A;  4R6K A;  2Q74 A;  4LP2 B;  4PET A;  4H45 A;  4G68 B;  4I3Y A;  3OEK A;  2CEX A;  4NF5 A;  2B65 A;  4P1L A;  1FQB A;  1JW5 A;  1MG1 A;  3Q29 A;  5ITP A;  3MC2 A;  4YB5 A;  4F3G A;  4Q8R A;  3LC8 A;  5DVF A;  1SW5 A;  2P3V A;  1PDA A;  3CG1 A;  3K6W A;  3D4G A;  1FBH A;  1URD A;  2P3N A;  3OMB A;  1FPK A;  1PBP A;  1FPF A;  1B0H A;  3HHG A;  3ZSF A;  4RK2 A;  1LBV A;  2CZH A;  2KLF A;  4RK9 A;  5CBR A;  5I7I A;  3R26 A;  1S7Y A;  4PBH A;  3E13 X;  4NF0 A;  3OEM A;  4ELR A;  4YMA A;  1LAF E;  2O69 A;  1IUD A;  3MBP A;  4UAC A;  1O64 A;  1LAX A;  4E0X A;  4ZE9 A;  1NUW A;  1ZU0 A;  3O28 A;  5H8N B;  4ZEK A;  1NV7 A;  3QK6 A;  4NAP A;  4IO3 A;  5FHM A;  3KBZ A;  3ODB A;  5I2N B;  5EQ9 A;  2I48 A;  1B3H A;  3V89 B;  2WEF A;  1UTH A;  1Z7N E;  2PFY A;  4RXL A;  2RC7 A;  4DIG A;  2BJJ X;  2ZYO A;  2M8C A;  2DE2 A;  2ZZV A;  1FQE A;  4Q0C A;  5I57 B;  4FIM A;  1N76 A;  5FHO A;  3FJG A;  3GZG A;  2Y7P A;  5CMB A;  2PCR A;  1CNQ A;  4NF8 B;  2IEE A;  3KSJ A;  2RCA A;  3C9H A;  4GXA A;  4MLQ A;  1P1N A;  2AL4 A;  4GRK A;  5AA4 A;  1VFD A;  4R75 A;  1SQY A;  1MY4 A;  2PVU A;  1NUY A;  3IB2 A;  3H6U A;  2CZL A;  3C35 A;  2V3Q A;  4H6D A;  1O7T A;  1ZIU A;  3TPA A;  3A3C A;  1A55 A;  3DEL B;  3RT8 A;  3USD A;  3KOS A;  3W9W A;  1OMP A;  1FPL A;  1QKA A;  3T1B A;  5TPA B;  1SD3 A;  3OOA A;  3S9E A;  3C31 A;  1MPD A;  2B4M A;  1A8E A;  4OXV A;  5ET7 A;  3SES A;  4KCD A;  4MX6 A;  2Y7I A;  3UK4 A;  1RDY A;  4NF5 B;  2R9J A;  1FTL A;  1IMF A;  1URS A;  1MQH A;  1B3L A;  5H8Q B;  1AL3 A;  4ISU A;  4DI3 D;  5FBP A;  2XXU A;  4KD5 A;  3M3K A;  2V3T A;  1MRP A;  2XXX A;  4AS5 A;  4DXB A;  1PB7 A;  2R71 A;  3FIR A;  3K1P A;  5I3S A;  2XA5 A;  3PPN A;  4GL8 A;  2FBP A;  3FJ7 A;  4XKP A;  4IGR A;  4N15 A;  1FTO A;  3PPO A;  4AB6 A;  4GQO A;  2UVJ A;  4GXS B;  1AWB A;  4BDL A;  2XXR A;  3B6Q A;  4PFY A;  1UTB A;  3RGY A;  4H1X A;  3TTK A;  3MAM A;  2QS1 A;  2Z8D A;  1NI9 A;  4QF9 A;  5IZ3 B;  2A5S A;  2HAU A;  5B70 A;  5BUU A;  2CEY A;  1NL5 A;  4NF6 B;  1TT1 A;  2CZI A;  4XTC Q;  3B7D A;  1HSL A;  2RF1 A;  3K6X A;  2H99 A;  4F39 A;  3FBP A;  4GX3 A;  3BKI B;  3OD7 A;  1XVY A;  3TAJ A;  4MF3 A;  3ILU B;  3S9M C;  1VDW A;  4PFI A;  4ONY A;  3TEP A;  4LON B;  4F31 B;  4GWY A;  4JWO A;  3KN8 A;  4ZEI A;  1ANF A;  3S4U A;  3K2D A;  1Z7M E;  1Y4T A;  1MH4 A;  1SBP A;  4LZ5 A;  4MCO A;  5I56 B;  1B52 A;  1NV3 A;  3U65 A;  5TP9 A;  1NV2 A;  4GL0 A;  4EDP A;  1Y1M A;  5L9O A;  3HO7 A;  3CRB A;  4Q30 B;  2NXO A;  4XEQ A;  4LZ8 A;  1R1N A;  1D9V A;  3Q28 A;  4YMB A;  3G3G A;  4ZE8 A;  1JNF A;  2FHY A;  1VR5 A;  4R9F A;  1FPG A;  5AA2 B;  3MP1 A;  5ELV A;  1H45 A;  4O3A A;  2O68 A;  4IO6 A;  4PDH A;  3V8X B;  1M5D A;  2QFL A;  4N91 A;  3DLN A;  4DXC A;  1XC1 A;  4LQ2 A;  3QSL A;  4I40 A;  1EYI A;  3SEV A;  4HE2 A;  1S9T A;  4PFB A;  4OYV A;  4E0W A;  1MY1 A;  2MKZ A;  2ONS A;  1LGB C;  2V93 A;  4F3P A;  1M5F A;  3K4U A;  4IO7 A;  3FAT A;  4ZZE A;  4PTK A;  1DK4 A;  4MBP A;  4NTL A;  3O97 A;  4LAT A;  5FHN A;  2ZMB A;  2UVI A;  5IKB A;  4IGT A;  4R6H A;  1EH3 A;  2QL3 A;  4QFK A;  1DBZ A;  1LCF A;  1Q1K A;  1LAH E;  3HN0 A;  1FBC A;  1YPN A;  4F29 A;  4U2R A;  1QUI A;  2XX8 A;  4ZEF A;  3C4M A;  2XXQ A;  4RA1 A;  4OVQ A;  2OZZ A;  4OFJ A;  4NED A;  4OVR A;  4KXP A;  2F78 A;  4H5G A;  1NUX A;  1FRP A;  4H0W A;  3DP8 A;  1IXH A;  2PMS A;  2XXI A;  4JSD A;  2GFE A;  3KFM A;  4C1T A;  2QVV A;  1SYH A;  5F1Q A;  4EF2 A;  4IR8 A;  3HPI A;  4OEV A;  4PC9 A;  3FD3 A;  4N6K A;  2KR0 A;  3LSW A;  5F7V A;  3K6U A;  3TYH A;  1NFT A;  3CFL A;  3TCF A;  5TP9 B;  4XIG Q;  3IOV A;  5IAI A;  1TWY A;  3TCH A;  4HXV A;  3N6T A;  1DPE A;  3FXB A;  4GBW A;  5I5P A;  4EXK A;  3KG2 A;  3F11 A;  3BIH A;  3Q25 A;  4IY5 A;  3MVX A;  1YAE A;  3CIJ A;  4PFT A;  3P7I A;  3K1N A;  2JJK A;  3KOT A;  4G68 A;  3O6I A;  1R6Z A;  3B50 A;  3MYU A;  2F7B A;  1A99 A;  5B7D A;  4NF4 B;  3RQT A;  2Z23 A;  4PFW A;  1AIV A;  3EN3 A;  1A40 A;  4JWY A;  3MP6 A;  3GYY A;  4GWU A;  1NV6 A;  1YXI A;  3OO8 A;  2UVG A;  2Y7K A;  4K3F A;  4YB7 A;  4OVS A;  1MY3 A;  2WYK A;  2QSX A;  4N6P A;  4U1Z A;  3IOR A;  2DP8 A;  5EYG A;  4IO5 A;  2DQV A;  1BP5 A;  4I8C A;  1FPD A;  4FOR A;  2F97 A;  3A29 A;  4QFN A;  2ONK E;  4YAH X;  1FBD A;  3MW0 A;  4JB7 A;  4BDR A;  2PT2 A;  4OTE A;  4ELQ A;  1IMC A;  1ZKB A;  1MQI A;  1WDN A;  5H8N A;  5HM4 B;  5DW8 A;  3U8Q A;  2HPG A;  2V84 A;  5I2N A;  3BIG A;  3SER A;  4YZZ A;  3MQ9 A;  5ET6 A;  4OHN A;  4F19 A;  3DM0 A;  3U92 A;  5AA1 A;  1IXG A;  1B5J A;  4ZED A;  2Q88 A;  1OIB A;  4MLV A;  1R9L A;  1FBG A;  5I57 A;  2AYS A;  1G0H A;  1OQG A;  2DXY A;  1EU8 A;  1LB8 A;  1P1W A;  3VE1 B;  2ZNS A;  4NF8 A;  2Y7R A;  1LFH A;  1D4N A;  3IFC A;  3CR9 A;  3IFA A;  1IIW A;  3VXB A;  2F5X A;  1BLF A;  3N26 A;  3PUZ E;  3FUZ A;  1JVX A;  3IOU A;  3AXF A;  3TTN A;  2ZNU A;  5TPA A;  1SW4 A;  1SPI A;  3K01 A;  4FED A;  4XF5 A;  1ZLQ A;  1Y3N A;  4XKR A;  2GHA A;  1Q35 A;  2DXR A;  4BDQ A;  3WAF A;  5H8Q A;  1I69 A;  3KN7 A;  3L6G A;  5FTI A;  2A5T A;  4QBA A;  4HE1 A;  4N13 A;  4GWZ A;  2I49 A;  4R2F A;  4NWD A;  3S2V A;  2Z8F A;  4DDD A;  4GIZ A;  4R74 A;  1DTZ A;  3T9U A;  3VV5 A;  1RDZ A;  1B58 A;  2F7C A;  1EYK A;  4H8I A;  4NG7 A;  1CB6 A;  5HBC A;  3B6W A;  1USY H;  3TMG A;  5EYF A;  1GVC A;  4POW A;  4F18 A;  4GF8 A;  3ZKK A;  5CM6 A;  4R2B A;  4HS7 A;  1NV0 A;  2YLN A;  2R8T A;  2ONR A;  4BDN A;  2O6A A;  4TLM B;  3LSF B;  4WKM A;  5CRY A;  1EZ9 A;  2F3D A;  4NE4 A;  3KC1 A;  3FVO A;  2WX9 A;  5IZ3 A;  4HCW A;  2ANJ A;  4NF6 A;  2REG A;  1N3X A;  1SI1 A;  2PYY A;  1QUJ A;  3QIM A;  4OEN A;  5IZZ A;  4MIJ A;  2NWJ A;  2PX1 A;  1JEV A;  3WAE A;  4LVQ A;  2YJP A;  3IX1 A;  1H44 A;  3MUQ A;  2QVR A;  1JVY A;  4MMP A;  5ITO A;  2F7A A;  1NNF A;  2VP1 A;  4QFP A;  5I56 A;  3TQL A;  4AB5 A;  2HZK A;  3PPP A;  2V3U A;  2H9B A;  4MFI A;  4IY6 A;  3FAS A;  1G0I A;  3QMF A;  4QSE A;  3TTR A;  1FPJ A;  1LBC A;  4XKN A;  3K0V A;  4N81 A;  5I2K B;  4KFQ A;  4EQ9 A;  5KDT B;  4PAF A;  3EKI A;  3N6U A;  2X26 A;  3LSX A;  5AA2 A;  3PD9 A;  1DMB A;  1PC3 A;  2REJ A;  4BDO A;  1B1X A;  4YKP A;  2A5T B;  4F3S A;  5LDZ A;  2B4L A;  4R73 A;  4HCY A;  2F34 A;  4YB6 A;  2VD2 A;  4F22 A;  2XX9 A;  3JZJ A;  3CFX A;  2I3V A;  5L8D A;  3KJ7 A;  4LA9 A;  5DVI A;  3TEL A;  2O7U A;  2VD3 A;  2RCB A;  3SDF A;  1MQD A;  1NH7 A;  1VFE A;  1DCU A;  3VXC A;  2XXP A;  2HHM A;  4TLL B;  2VPN A;  1SVX B;  4OMB A;  3KZG A;  1JW4 A;  1YYZ A;  2PBW A;  1PB9 A;  1XT8 A;  3MVW A;  1NNK A;  2E1S A;  2G93 A;  1PBQ A;  1A54 A;  1LFI A;  3HHF A;  2GH9 A;  4PFU A;  1RYX A;  3PV0 E;  1TXF A;  2OJT A;  4YIC A;  4P8B A;  2H5Y A;  3H4Z A;  1B7Z A;  4RNS A;  4I3E A;  2BJI A;  1OLC A;  3EHS A;  3PGF A;  1F9B A;  1NV1 A;  3L6H A;  4FEB A;  3B8B A;  4QSC A;  1BKA A;  1Y3P A;  3QUJ A;  5H8S A;  4DI4 B;  3W9V A;  1XVX A;  3MWB A;  3PUV E;  1B05 A;  4RPN A;  4G8M A;  3T22 A;  2XWK A;  1FCK A;  2XD3 A;  1SYI A;  1N04 A;  4ZS9 A;  4YKJ A;  1IMD A;  2Y5K A;  4PE5 B;  3H03 A;  5ICT A;  3TQW A;  5AA3 A;  3FVK A;  4EQB A;  2DSF A;  2XX7 A;  1FBE A;  1ZBM A;  1SW2 A;  2DYX A;  1P1Q A;  1MS7 A;  3VVF A;  1FW0 A;  3C32 A;  2HZL A;  4NMY A;  2VHA A;  3OSR A;  1BIY A;  3MP8 A;  3FV2 A;  4P9K A;  4P0I A;  3FVN A;  4NF4 A;  2VT5 A;  3D4C A;  2GHB A;  3IB1 A;  1USY E;  2F35 A;  1MY2 A;  2F36 A;  3RPL B;  2H4I A;  4G8H A;  1MXY A;  3R7X A;  5I84 A;  3QXM A;  2CZK A;  1MXX A;  4FEC A;  5J1D A;  3O29 A;  4DE8 A;  1Y4C A;  1N7X A;  4LQ5 A;  4U21 A;  1VE4 A;  4X9T A;  4YU0 A;  1IIT A;  2B3B A;  1B6H A;  5JTY B;  3CSB A;  3I3V A;  3H7M A;  1JQF A;  4LZ7 A;  2DDK A;  1LFG A;  1PEB A;  1LBZ A;  4GX6 A;  2QRY A;  3EF7 A;  3OO7 A;  4G4P A;  1MXU A;  4N17 A;  5DT6 A;  1R9Q A;  5I58 B;  2I4C A;  3TDJ A;  3VVD A;  1B40 A;  1KA0 A;  1DSN A;  5LTC A;  2O51 A;  1B1H A;  1YCJ A;  4F1Y A;  5H8H B;  3QYT A;  2OCU A;  2P2A A;  4P0G A;  2O1M A;  2DWI A;  3C36 A;  4KYE A;  1NH8 A;  4GD5 A;  2ZYM A;  4RJZ A;  1S50 A;  1K9Z A;  4X8R A;  3A09 A;  4KI0 E;  1KZ8 A;  4OAN A;  1IZ1 A;  1BTJ A;  3UIF A;  1B0L A;  3PPR A;  1FPI A;  4FBP A;  4PF8 A;  3NOH A;  4OA4 A;  3OXN A;  4MHF A;  4OFL A;  2PFZ A;  4U23 A;  4GBV A;  1AOV A;  2LAO A;  2ALU A;  4GX4 A;  4JVC A;  3SEX A;  4PAK A;  1UQW A;  5EYH A;  5EQ8 A;  4JVD A;  3G3F A;  1I6B A;  2NUV A;  1P1U A;  1LAG E;  4Z7E A;  3LBS A;  1Y3Q A;  4I62 A;  2WYP A;  2KQZ A;  3HCQ A;  3K6V A;  5EQA A;  1H76 A;  5H8F B;  5DEX B;  2F6G A;  4IO2 A;  4FAJ A;  4WXJ A;  3ILT B;  3UOR A;  1B5H A;  4OVP A;  2ZXT A;  4Q5T A;  2I6E A;  1ZTY A;  3GXA A;  3T66 A;  2GRV A;  2RC8 A;  3ECR A;  3FXQ A;  3E79 A;  3SEW A;  3UA8 A;  3FJM A;  5LOM A;  3M3F A;  3O6G A;  4QFO A;  3PMX A;  1POY 1;  2E0S A;  1QGX A;  3EQ1 A;  3T9X B;  4PQJ A;  3MVY A;  2Y5L A;  1OVB A;  2I4B A;  1JW1 A;  3LV0 A;  5EQ7 A;  1DPP A;  4QSD A;  2XD2 A;  2OWT A;  5A5L A;  2VPO A;  3V83 A;  1FJ6 A;  2OWZ A;  1RYO A;  4DLD A;  3MZ1 A;  3HV1 A;  1T0K A;  1EZP A;  4EXL A;  3IO6 A;  4NWC A;  3C33 A;  4KHZ E;  2GQ1 A;  4EQ7 A;  3DP6 A;  4R6Y A;  3O6H A;  1US5 A;  4H46 A;  1B9J A;  4O94 A;  3B6T A;  3OEL A;  2QS3 A;  2Q2A A;  3U1O A;  1LLS A;  1PB8 A;  1POT A;  2THI A;  4OES A;  2DWA A;  4QHQ A;  1K9Y A;  3TOD A;  1CE2 A;  3CHG A;  3DP4 A;  2HAV A;  1UIV A;  1NNP A;  5EHM A;  5AA2 D;  4KYS A;  2I3W A;  4F2Q A;  3VVE A;  1B46 A;  4P11 A;  4UAB A;  5AE4 A;  2DVC A;  2NVU B;  4DZ1 A;  5A5X B;  4KQP A;  4H65 A;  4PE3 A;  2ZZX A;  4PGP A;  4G68 C;  3O9P A;  1YTV A;  4N8Y A;  4NQ8 A;  4ESW A;  4ELP A;  3BFT A;  1M5E A;  4C1U A;  4PP0 A;  4NX1 A;  1O63 A;  4MEV A;  2HCA A;  4F1U A;  1A8F A;  4ZDM A;  3K1M A;  5I2K A;  4PDD A;  3IK6 B;  5KDT A;  2OBG A;  4RY1 A;  2YPN A;  3RT6 B;  2Y7W A;  4L17 A;  4OET A;  3KBR A;  4GWW A;  4N6D A;  3U94 A;  4GWS A;  3K02 A;  1LBB A;  2FIX A;  1IEJ A;  1MPC A;  3OEN A;  3I6V A;  1QW0 A;  2IA4 A;  2XXW A;  3IOW A;  4DCX A;  1TFD A;  1IQ7 A;  3T93 B;  1D3K A;  4QFL A;  3UN6 A;  3ISP A;  3G3H A;  4G77 A;  2HFB A;  1LBW A;  2XWI A;  2DE4 A;  4JVI A;  5ISU A;  4PBQ A;  3U72 A;  2XXV A;  3K00 A;  5ET8 A;  3H3G A;  3E78 A;  2RC9 A;  4THI A;  3H6T A;  4WED A;  1II5 A;  4PF6 A;  2QPQ A;  3HFU A;  3OO6 A;  1FTA A;  4HE0 A;  4NN3 A;  2P0S A;  5JEI A;  4KCC A;  2R6G E;  3IL1 B;  4P56 A;  1B5I A;  3LUY A;  3S9N C;  4LN5 A;  2VGQ A;  4DXU A;  1JET A;  4MNI A;  4HTG A;  1P99 A;  2O7I A;  4OFO A;  4GOT A;  3G3J A;  3GBA A;  5KCJ B;  1JEU A;  2DWH A;  2V25 A;  2RKM A;  4G61 A;  4C0R A;  1VSO A;  4XXU A;  4U22 A;  5TU0 A;  3IO4 A;  3IR1 A;  3V5A A;  3N94 A;  3LSL A;  4FJP A;  1ATG A;  3E4R A;  1MQG A;  2ESN A;  3SET A;  1FBF A;  4XKQ A;  1B7U A;  3EHT A;  1B3F A;  3E9X A;  5I59 B;  5FTH A;  1I6A A;  2AL5 A;  4I9D A;  3G3I A;  3T96 B;  3S9L C;  4OVJ A;  3VLW A;  3RN8 A;  1QUL A;  5ESY A;  1IME A;  4TOZ A;  1URG A;  2Z8E A;  3UGW A;  4R72 A;  3TZA A;  2G29 A;  4ELO A;  4N4U A;  3VDF A;  3MZB A;  2F6P A;  2UXA A;  3KEI A;  2DE3 A;  3TCG A;  1NNT A;  3PD8 A;  2I0C A;  4OVT A;  1B2H A;  1QUK A;  2XHD A;  3O66 A;  4IO4 A;  4NGU A;  2NOO A;  4M1V A;  3CG3 A;  2ZZW A;  4I1D A;  4LUB A;  4AQ4 A;  5DVJ A;  5JK4 A;  1WOD A;  1LST A;  4GWX A;  4F2O A;  3KGC A;  1EZO A;  3TUS A;  1HSE A;  3RPL A;  2H98 A;  4NHB A;  1MM6 A;  4MNC A;  1NMU A;  5CBS A;  5M2V A;  4BLA A;  2OWS A;  1Y1Z A;  4FE8 A;  3E3K A;  4O3C A;  3CFZ A;  3IOT A;  4Z0I A;  2QVU A;  4GLI A;  3PU5 A;  1MDQ A;  2DS9 A;  4QRZ A;  3IJO B;  1B4Z A;  4FAT A;  4H67 A;  1US4 A;  2XWO A;  1B3G A;  3RLF E;  3Q27 A;  1MH3 A;  4H8J A;  1AMF A;  4OWD A;  5JTY A;  4EF1 A;  3PUW E;  3U93 A;  1LB9 A;  2Y84 A;  2O84 X;  4ECF A;  3RTW B;  3H06 B;  5I58 A;  4JDF A;  4PFR A;  1Y20 A;  1QVS A;  1H3D A;  4JWX A;  3THI A;  2DWJ A;  5H8H A;  4MAG A;  1MDP 1;  1M5C A;  3ROJ A;  1SDX A;  1B3E A;  2Q8M A;  3M8U A;  1LEV A;  1I6Q A;  1XOC A;  1MM7 A;  4X1B A;  1P1O A;  4O3B A;  3ONM A;  1L5T A;  1IMA A;  3FV1 A;  5DYH A;  1FSA A;  4PCD A;  5J16 A;  1IXI A; 
#chains in the Genus database with same CATH homology
 2WEF A;  1K9Z A;  4X8R A;  2PFY A;  4PAI A;  1KZ8 A;  4OAN A;  2Q9T A;  5ET5 A;  1FBG A;  2HXR A;  1FPI A;  4FBP A;  1G0H A;  2DE2 A;  2ZZV A;  4PF8 A;  3NOH A;  4OA4 A;  4MHF A;  2L5V A;  2OX3 A;  3KC0 A;  4O8M A;  2PCR A;  4P3L A;  1CNQ A;  2PFZ A;  4GBV A;  1FPB A;  1FJ9 A;  3IFC A;  4GX4 A;  3IFA A;  4JVC A;  4PAK A;  2F5X A;  1XI6 A;  1NUY A;  5EYH A;  5EQ8 A;  2V3Q A;  4JVD A;  3W9W A;  1SPI A;  1NV5 A;  1FPL A;  3T1B A;  4XF5 A;  4X04 A;  2WYP A;  2KQZ A;  2B4M A;  5EQA A;  5ET7 A;  4MX6 A;  1RDY A;  4F1V A;  4OVP A;  1IMF A;  3E79 A;  4QXD A;  4QBA A;  4HE1 A;  4DI3 D;  4GWZ A;  5FBP A;  2V4C A;  4XFE A;  1RDZ A;  4AS5 A;  1EYK A;  1QGX A;  4NG7 A;  2Y5L A;  3LV0 A;  5I3S A;  5EQ7 A;  2XA5 A;  5A5L A;  2VPO A;  1FJ6 A;  2FBP A;  2OWZ A;  4F18 A;  5IM2 A;  4N15 A;  1EYJ A;  5CM6 A;  1NV0 A;  1KA1 A;  3MST A;  2R8T A;  1AWB A;  3LUZ A;  2GQ1 A;  2F3D A;  4H46 A;  4O94 A;  3KC1 A;  1LBX A;  2WX9 A;  5IZ3 A;  4HCW A;  1NI9 A;  5IZ3 B;  1YZ0 A;  2CEY A;  1K9Y A;  2CZI A;  3CHG A;  5IZZ A;  4MIJ A;  4P1E A;  3FBP A;  4GX3 A;  1VDW A;  2WBB A;  4UAB A;  2QVR A;  4PFI A;  2WBD A;  4MMP A;  4GWY A;  4PE3 A;  2ZZX A;  4PGP A;  2HZK A;  4MCO A;  4N8G A;  1NV3 A;  3U65 A;  4N8Y A;  4NQ8 A;  1NV2 A;  4NX1 A;  1LBY A;  1G0I A;  3QMF A;  4MEV A;  4F1U A;  1FPJ A;  1Q9D A;  4AS4 A;  4PGN A;  4PDD A;  4XEQ A;  2XWV A;  4N81 A;  4PAF A;  3EKI A;  4GWW A;  4N6D A;  4GWS A;  2FHY A;  2FIX A;  1FPG A;  4MJO A;  3SZP A;  1D9Q A;  4PDH A;  2QFL A;  3PTY A;  4N91 A;  5LDZ A;  1FPE A;  2B4L A;  2DVZ A;  3ISP A;  4HCY A;  4P47 A;  4I40 A;  1EYI A;  1LBW A;  2XWI A;  2DE4 A;  4HE2 A;  4JVI A;  4PFB A;  1INP A;  4PBQ A;  1RDX A;  2MKZ A;  5ET8 A;  1NV4 A;  3E78 A;  1DCU A;  2HHM A;  2VPN A;  4PTK A;  1DK4 A;  4PF6 A;  3D1R A;  2QPQ A;  1YYZ A;  3HFU A;  4O7M A;  1FTA A;  4HE0 A;  4NN3 A;  4P56 A;  1DBZ A;  4LN5 A;  2FIE A;  4MNI A;  2FVZ A;  4MNP A;  1FBC A;  4YIC A;  4P8B A;  4O7I A;  4OVQ A;  1IMB A;  4G61 A;  4I3E A;  2BJI A;  4OVR A;  4KXP A;  1NUZ A;  1NUX A;  1FRP A;  1BK4 A;  2QVV A;  1NV1 A;  1FBF A;  3B8B A;  4IR8 A;  4PC9 A;  5IZ1 A;  4N6K A;  4DI4 B;  2KR0 A;  3W9V A;  1FBP A;  2XWK A;  5ESY A;  1IME A;  1IMD A;  2Y5K A;  4HXV A;  4N4U A;  2F3B A;  1FBE A;  3FXB A;  4GBW A;  5I5P A;  3RYD A;  3T0J A;  2DE3 A;  2HZL A;  4OVT A;  5F24 A;  3BIH A;  5IGA A;  5T3J A;  2JJK A;  1JP4 A;  2XXK A;  2Q74 A;  4NGU A;  4M1V A;  4PET A;  2ZZW A;  4P9K A;  3B50 A;  3MYU A;  4H45 A;  5JK4 A;  4I3Y A;  4GWX A;  2CEX A;  2VT5 A;  4P1L A;  3RPL A;  4NHB A;  4MNC A;  3GYY A;  2P3V A;  3RPL B;  4GWU A;  1NV6 A;  1YXI A;  1FBH A;  2CZK A;  5J1D A;  2P3N A;  4OVS A;  1FPK A;  2WYK A;  1FPF A;  2QVU A;  5EYG A;  4X9T A;  2XWO A;  1LBV A;  2CZH A;  1FPD A;  3A29 A;  5I7I A;  4PBH A;  1FBD A;  4NF0 A;  2DDK A;  1LBZ A;  4PFR A;  4GX6 A;  4N17 A;  1IMC A;  1NUW A;  4MAG A;  1KA0 A;  5LTC A;  3ROJ A;  2Q8M A;  5DW8 A;  1LEV A;  2HPG A;  1NV7 A;  3BIG A;  4NAP A;  4YZZ A;  4F19 A;  5ET6 A;  3KBZ A;  1IMA A;  5EQ9 A;  1FSA A;  4PCD A;  5J16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...