5EYHA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+ at ph 7.0
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eyhA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eyhA02
2Y5KA 1LBYA 1IMDA 1YYZA 3LUZA 1NV7A 1VDWA 4G61A 1RDYA 1IMAA 4PTKA 1LBXA 1NV5A 2QVUA 2CZHA 3RYDA 1FJ6A 5EQ8A 1BK4A 1NUZA 1IMFA 4I3EA 2F3BA 1RDZA 3RPLA 4GX6A 3ROJA 4AS5A 1NV4A 5EQ9A 1DCUA 4GWYA 2P3NA 2GQ1A 3KBZA 4GBWA 2BJIA 1KZ8A 1NV2A 5J16A 2OWZA 5EYHA 1FPFA 2QFLA 2PCRA 4KXPA 1KA0A 1FPDA 4N81A 3A29A 5ET6A 1DBZA 1QGXA 2CZKA 4AS4A 1FPJA 4O7IA 5FBPA 4GWUA 4H45A 2WEFA 1FPEA 1IMEA 2QVRA 2VT5A 3BIGA 4GWSA 4MJOA 1FJ9A 1RDXA 2Y5LA 1YZ0A 3KC0A 1FPGA 2FIEA 1FTAA 1DK4A 2R8TA 1FBCA 1FSAA 1D9QA 4I40A 1NV0A 2QVVA 5IZ3A 4GX3A 1FBFA 5T3JA 1AWBA 3T0JA 2FVZA 5LDZA 4QXDA 3RPLB 4HE0A 5ET7A 3IFCA 4I3YA 5DW8A 1SPIA 1FBEA 2WBDA 4GWZA 5IZ1A 5EQ7A 2Q74A 1FPIA 1LBWA 2P3VA 2DDKA 4GWXA 3FBPA 2FIXA 5A5LA 1NV3A 3D1RA 1LBZA 4GWWA 3BIHA 1CNQA 1FRPA 1FBDA 2JJKA 1LBVA 1XI6A 1EYJA 1FBHA 5EYGA 4IR8A 5ET8A 4HXVA 1NV6A 3LV0A 2CZIA 4GBVA 3IFAA 4GX4A 1NUWA 5I3SA 1G0HA 2Q8MA 1NUYA 3KC1A 1JP4A 5ESYA 5IZ3B 1LEVA 4HE1A 4HE2A 1IMCA 1FBPA 1FPBA 1K9YA 1YXIA 1INPA 1FPLA 2F3DA 3B8BA 1Q9DA 1KA1A 1NV1A 2HHMA 1NI9A 1K9ZA 2FBPA 4H46A 1FBGA 1EYIA 5EQAA 1FPKA 1EYKA 3QMFA 2OX3A 2WBBA 1G0IA 5F24A 4FBPA 1IMBA 5ET5A 2FHYA 1NUXA
chains in the Genus database with same CATH superfamily
4KR5A 4YB6A 3TODA 1B3LA 1NV7A 4JWYA 3IR1A 4LQ2A 3RYDA 4DCYA 1B58A 2V93A 2F97A 5M2VA 4BDLA 3PU5A 2PBWA 3RTFB 2BJJX 4XF5A 1FPFA 3K4UA 2Z8FA 1UTHA 2QSXA 2Y7WA 2DWIA 3QSLA 4YKPA 4GWSA 2XXXA 2IA4A 3O29A 4RA1A 4ELRA 1FTAA 4BDRA 4HTGA 2QJEA 3H6UA 4MIJA 4P0IA 4GX3A 3I5OA 2ZYOA 4HE0A 4I3YA 1FTJA 2RCAA 3S9LC 2FNCA 2XX7A 1S50A 2DDKA 5AA2D 2E0SA 5AA4B 1MY3A 3LSFB 3USDA 2RC7A 3CRBA 2Z8DA 4F2OA 3E3KA 2V3TA 4DXCA 5L8DA 1MM7A 5DYHA 4FEDA 3U1OA 2CZIA 4GBVA 5AE4A 1S7YA 5IM2A 2WYPA 4AQ4A 1EH3A 4OMBA 3KJ7A 1J1NA 4P0GA 1LEVA 3MWBA 3K6UA 1Y3NA 3OSQA 4F19A 2F3DA 1EU8A 3FVOA 1NI9A 4YKIA 1JW1A 2O51A 3CG1A 3LSXA 1Q1KA 3DLNA 2FHYA 2Y5KA 1LBYA 3K6VA 1SW5A 1FTMA 3TTNA 1N0TA 3FXUA 1QKBA 4N17A 2NXOA 2XXYA 3SEWA 5DVFA 2A5TB 2I49A 4OEVA 4GX6A 1B3EA 5EQ9A 2XXTA 1FQDA 2PMSA 3Q29A 4DI4B 4QFOA 1PBQA 4N81A 1B2HA 5FTHA 4G8HA 1ELJA 1AH5A 5KCJA 1B0HA 1VFEA 2Y5LA 3G7WA 1B5IA 1A8EA 5I2NB 2O1LA 2O6AA 5H8SA 4NEDA 3RPWA 2Q9TA 4R2BA 4H0WA 4XKRA 4EF1A 3VDFA 2XHDA 4G68B 3GYYA 3FV1A 2O1MA 3SETA 5F1QA 2B3BA 3RY3A 1FRPA 2YPNA 1EYJA 4OVQA 3G3FA 2L5VA 1JVXA 1NV6A 4JB7A 2G29A 4ESXA 4R9GA 5ITPA 4N91A 3CFXA 4NHBA 5DTBA 1GGGA 1IEJA 3MVXA 3OO7A 1S9TA 1IXHA 2WBBA 4U2RA 4FATA 2VOZA 4BDQA 2WBDA 1EZPA 4YU0A 1B1XA 4ISUA 4G8MA 1JW5A 3OEMA 1SDXA 1IMAA 3IB0A 1QW0A 5F7VA 2QVUA 2RC8A 3MPLA 1MXVA 4UABA 2OK2A 4O3AA 4OANA 2ALUA 1Y3PA 2Y7KA 3TAJA 1NV4A 1CE2A 4R74A 3T9UA 3TQWA 5EHSA 3K02A 4PFYA 3C33A 4RNSA 1KZ8A 3VE1B 5EYHA 1WVJA 3TYHA 4C1UA 4H65A 1N3XA 3A29A 3FATA 4F18A 5HPQA 1M5CA 2UVHA 2CMOA 4GWUA 2OBGA 1CB6A 3FXRA 4ZE8A 3B6QA 1MRPA 4H67A 1URSA 2XA5A 3UGWA 3H6VA 3SZPA 1D4NA 3TTKA 1RYXA 4P11A 4GLIA 1IQ7A 1AWBA 4HCWA 3K1MA 2V84A 3PUZE 2OPEA 5ISUA 4H6DA 4OEUA 5A5LA 4E0WA 1A55A 2I4BA 5IKBA 4I1DA 4WEDA 1H3DA 2Q2CA 5JK4A 1ZBMA 3K0VA 3MZ1A 3JYRA 2Y7PA 1JP4A 2VP1A 1ZLQA 3B8BA 2A5SA 4ZDMA 2IEEA 2WX9A 3N5LA 4F3GA 2PT2A 4RK9A 2I4CA 2X7QA 3TMGA 1SI1A 4FBPA 1IMBA 1YYZA 1A40A 1H43A 2XXVA 1POY1 2DP8A 2P1SA 3KZGA 1QVSA 1T0KA 1D9VA 2PFYA 3KN3A 3SERA 3OO6A 5I57A 3K2DA 4X04A 5K2XA 3MBPA 5J16A 1FQFA 1LB9A 3IK6B 4EUOA 4HCYA 4DI3D 5ET6A 1NH7A 2CZKA 1NMUA 1LBBA 1Y4CA 4RY1A 3Q28A 4N8GA 4PP0A 1FPEA 1P99A 3BKIB 3N6TA 1Y3QA 3G3IA 1OMPA 3E78A 1B9JA 1N7XA 5L9SA 1FBCA 2XWKA 1SQYA 1MQDA 4NAPA 3FJMA 2V3UA 3IFCA 1LAHE 5DEXB 1FQCA 3PPRA 1FPIA 2FA7A 5TPAB 3S2VA 1NNTA 2X26A 2O69A 4PFRA 1OQGA 3MVWA 3MZBA 3KOSA 1PB7A 1P1WA 3TDJA 4NG7A 4BDMA 1IXGA 2KQZA 3H03A 3IOUA 4MNPA 3CVGA 4PFWA 1FPBA 4OVPA 4TLLB 4KHZE 3CR9A 1OVTA 3SEVA 2HHMA 2PX1A 4POWA 2F6PA 3A09A 1P1UA 2OX3A 2F7CA 4QHQA 3ECRA 2ZYKA 3FD3A 3C32A 4P3LA 3VXCA 2CEYA 4PE5B 2NUVA 3K01A 2QRYA 2P2AA 1GTKA 4NN3A 5JEIA 2Y7IA 3B7DA 3PGFA 3UK4A 1UTBA 1MXYA 3EQ1A 3EF7A 3K1NA 5JTYB 4DIGA 3T96B 4F2QA 4TQUQ 2D5WA 3JZJA 2OCUA 4FECA 2XXWA 4YZZA 5K2YA 2F8DA 1IMEA 2ZNUA 1B32A 4PGPA 3VV5A 1FTOA 2FIEA 3ISPA 3IJOB 5KDTB 4KCDA 3MZ9A 2R71A 4QXDA 1TT1A 2GHBA 4XKPA 3BFTA 1FBEA 4RJZA 4QSEA 5I5PA 4O94A 2Q74A 2O7IA 3FVKA 1SI0A 2XWOA 4MF3A 3OSRA 4I9DA 1H76A 3ZKKA 2XD2A 3WAFA 3QXMA 3MJNA 4Q30B 2I0BA 4NQ8A 4KCCA 4KD5A 4G4PA 4IY6A 2R6GE 4IR8A 4PQJA 3H6TA 4KQPA 4P1LA 2WYKA 4H5GA 4OETA 4N6DA 1NUWA 3O2AA 1A54A 1G0HA 5I2KB 3KC1A 4QF9A 1I6AA 4HE2A 1YXIA 1INPA 1FPLA 3C31A 3OENA 5BWJA 3PV0E 4M4GA 2W7YA 5I59A 2ZZXA 1IZ1A 3C35A 3NOHA 4BLAA 1QUKA 4IO3A 1PC3A 1M5BA 2HZLA 3EHSA 2ANJA 1US4A 5IGAA 1EZOA 3SEXA 4U21A 1TFDA 3VVDA 2VPOA 4OVJA 3CSBA 5TP9A 3GBBA 3DP6A 4YB7A 1EZ9A 4ZE9A 1MQHA 1LGBC 4X9TA 4GXAA 1KA0A 3A3CA 2H5YA 1F9BA 3O6IA 3PMVA 4MX6A 3SKPA 4EXKA 2DXRA 4GRKA 3LC8A 3PD9A 2XX8A 1N04A 2O84X 4EQ7A 1MXUA 3RUMA 3HCQA 2I6EA 4H8JA 5I57B 1SPIA 5H8QB 2I3WA 2D3IA 3M3FA 4XIGQ 4DXBA 1LAFE 1LSTA 2V4CA 4MH5A 1LFHA 4N6KA 3A3UA 1TFAA 4FJPA 4RYAA 5H8NA 4XEQA 3TQLA 1H44A 4RK2A 4GOTA 3RT8A 2B4MA 2PYYA 1B3GA 2ONSA 4PAKA 1N76A 1N84A 2E1SA 4MAGA 3FVNA 3O97A 2PVUA 1GVCA 1US5A 1B7UA 1NV1A 4ZZEA 1AMFA 1JQFA 3MPKA 2DVZA 5KZTA 4QFLA 3QMFA 1VE4A 1G0IA 4YB5A 2GH9A 1LFIA 1MQGA 2NOOA 2B4LA 2G93A 5CMKA 5L9OA 1FJ6A 5EQ8A 3VLUA 3M3LA 1DMBA 5LTCA 2R9JA 4PBQA 4ZEDA 3S4UA 1XS5A 1DCUA 4RPNA 1FW0A 3FVGA 3OEKA 3TUSA 4PFBA 1FPDA 1MH4A 4AS4A 1FPJA 4O7IA 4JXIA 1B5HA 5L9MA 4IGTA 3IOWA 2WEFA 3MC2A 2VT5A 2QVRA 4NF8A 2CZLA 3Q27A 3TPAA 5IZ3A 1M5EA 2FVZA 1P1NA 1IXCA 4NF5A 4QSCA 1LBCA 3H6WA 1UTBB 3MVZA 1LBWA 3E9XA 1ATGA 4ECFA 3KGCA 5B70A 1JETA 2REJA 3LUYA 3BFUA 3IO4A 5FTIA 5I56A 4GX4A 2XXRA 1R9QA 3IL1B 4PFIA 4N4UA 4NWDA 2KR0A 2XXKA 4NE4A 4R2FA 4EF2A 4QRZA 2D21A 1URDA 1K9ZA 1FPKA 2YJPA 5ET5A 1D9YA 1Y4TA 1IMDA 3U8QA 5H8FB 3QUJA 3B50A 2DWJA 2VPNA 3FZVA 2HAUA 4X1DA 2VD2A 1R6ZA 4PAFA 4G77A 5ITOA 3CFLA 4F1YA 4U23A 4N8YA 2XXQA 4X8RA 1UIVA 5IZZA 3CI8A 1JEUA 4F22A 3QIMA 1AL3A 4OVTA 1MXXA 4MMPA 4NX1A 2HAVA 3FASA 3ONMA 3PD8A 4R75A 3THIA 4YAHX 1TXFA 3HV1A 2QPQA 2THIA 2QS1A 2DS9A 3MUQA 2XXPA 4G68C 1B3HA 1TWYA 2R8TA 1DTZA 4LONB 4LUBA 3PUWE 5TP9B 3TTMA 4LA9A 2AL4A 5FHOA 3GXAA 4OFJA 3VLWA 3I3VA 2FIXA 3D1RA 1FBDA 3EPEA 2HXRA 1I6QA 2HZKA 1OQHA 3R6UA 1NNFA 1R9LA 4UACA 4WKMA 1FQEA 2H98A 3GLBA 3IOTA 4NF6A 3U92A 4YKKA 1M5FA 1SYHA 3LSLA 4HE1A 1HSEA 1LAXA 1MXZA 1PB9A 1N7WA 3Q25A 4O8MA 2QS4A 3KSXA 1UTHB 4LATA 1OLAA 4F29A 1P1QA 3PMWA 4OWDA 1XT8A 4XXUA 4H5FA 5F24A 1OIBA 2H25A 1Y1MA 3FXBA 2O68A 4IO7A 5AA2A 5H8NB 1A99A 1FTKA 3RN8A 1NV5A 3HPIA 3MSTA 4QFNA 1MG1A 4I3EA 1BLFA 3MVYA 3RTWB 3MYUA 3FV2A 4FE8A 1B7ZA 2P3NA 4MBPA 4P56A 1NV2A 1LFGA 1IUDA 4U4XA 1LB8A 3O6GA 4OXVA 5HBCA 2DVCA 4F31B 1WODA 4YMAA 2I58A 3TCGA 1AOVA 2VHAA 2OZZA 4R73A 3TCHA 3K6XA 4ZEKA 5CC2A 5IAIA 5J1DA 1DSNA 1MDQA 1DK4A 2PT1A 3FXQA 2QS3A 4ZEIA 4XKNA 2OWTA 5CMBA 2ZZWA 2XX9A 2X7PA 2HFBA 5EQ7A 2P3VA 1MM6A 4PDHA 3HFUA 2ONRA 2I0CA 2P0SA 2Q88A 1FQBA 4FORA 2CEXA 1DPEA 3IB2A 5I3SA 2REGA 3CFZA 3ODBA 4H8IA 1IITA 5IZ3B 4EDPA 4KFQA 2ZNTA 3K1PA 1Y9UA 4NF5B 3FJGA 4EXLA 1B3FA 4NGUA 5CM6A 3K00A 1B4ZA 5KCJB 4PDDA 3G3GA 4O7MA 3G3HA 5AA4A 3T66A 3FUZA 2F34A 3RQTA 4R6HA 1LBXA 3RGYA 3VXBA 2OLBA 1UIUA 3C4MA 3T9HB 5A5XA 4EQ9A 4AS5A 1XVYA 2YLNA 1RKMA 4C1TA 1QUIA 1SD3A 3KG2A 5H8HA 4Q0CA 5BUUA 1MQJA 2Y7RA 1O63A 5FBPA 3V83A 3VVFA 3L6GA 4LZ7A 4MLQA 1M5DA 1FPGA 2DQVA 2B3FA 3DM0A 3IB1A 4QFKA 1NV0A 4P9KA 1QJMA 5LDZA 3UP9A 2I48A 1HSLA 3KSJA 1XC1A 1NV3A 2HEUA 4GWWA 3OO9A 2JJKA 1LBVA 2ZYNA 5EYGA 2F35A 5ET8A 4F1VA 3HHGA 3LBSA 4DLDA 3IOVA 1QKAA 1NUYA 3KEIA 4OERA 3VLVA 5I2NA 2F7AA 3TEPA 4U1ZA 3V89B 3HN0A 3E4RA 1MQIA 3W9VA 4IO2A 1MS7A 4OENA 4I8CA 2Q2AA 3PPQA 3LUZA 1RDYA 1GR2A 1B51A 3KJTA 1MDP1 4RPOA 2MKZA 4Q8RA 1H45A 4NF6B 4U22A 4KI0E 3H06B 2FYIA 4H1XA 4JDFA 2GQ1A 3V8XB 4F3PA 3D4CA 4DE8A 4EQBA 1B0LA 2RINA 5CMMA 4GXSB 3DP4A 2PCRA 4IGRA 1ZMGA 4XFEA 2XXHA 4LZ8A 3RLFE 1JVYA 5AA2B 5FHNA 1AIVA 3MP8A 1YZ0A 3ZKLA 2RKMA 1D9QA 3E79A 4TOZA 4OESA 4R6YA 3O9PA 5DW8A 2XD3A 3P7IA 2XXIA 3OO8A 3FJ7A 3FBPA 3ILTB 1YAEA 1UQWA 1SW1A 3EHUA 4P47A 4BDNA 4GWOA 4HXVA 1FCKA 1PBPA 3IFAA 2NWJA 3S9MC 3UA8A 1NKXA 3GBAA 4G2ZA 4MFIA 2XXUA 2ZZVA 2DE3A 4O3CA 4L17A 1USYE 4KYSA 4DXUA 1KA1A 3RT6B 4PBHA 1NL5A 2V3QA 4K3FA 4YKJA 5ICQA 1NUXA 3LR1A 1LCTA 2RC9A 2UVGA 1RYOA 3SEYA 5I58A 4QFPA 4JWOA 3VVEA 5HM4B 4NWCA 2CZHA 3EN3A 4DCXA 1MY1A 4OFLA 1N3WA 4THIA 3OD7A 4PFTA 2HPGA 1HSJA 3PPOA 4LN5A 2H99A 4C0RA 1B7HA 1QGXA 4Z7EA 1B46A 4PETA 4AB5A 4NF4A 2XWIA 2GRVA 1LAGE 3G3KA 3TFLA 1B1HA 2UVJA 4OVRA 5TU0A 5A5XB 1YPNA 3T0JA 1URGA 4U1OA 4X48A 1Z7NE 4QSDA 1R1NA 4PGNA 4MNIA 5H8HB 4F39A 4F1UA 1MPDA 2OWSA 1JEVA 1JNFA 3KN8A 4IO6A 3U72A 1SW4A 3IO6A 4Z0IA 2UYFA 1I69A 3AXFA 3O28A 1VFDA 2DWHA 3B6WA 3OOAA 2O7UA 3K6WA 4QBAA 2V25A 2ZMBA 3QK6A 4ZEBA 4JVDA 5AA1A 5DEXA 4YICA 4XKQA 5TPAA 3N6UA 3FGSA 1LCFA 1XVXA 5DT6A 3U94A 4BDOA 2Z8EA 4LZ5A 1B40A 1B4HA 2ESNA 1BKAA 3RPLA 3T93B 4FIMA 3KBZA 3S9EA 3W9WA 4IO5A 2DE4A 3PPNA 3CHGA 2I3VA 4XTCQ 2DE2A 4R9FA 3QUFA 1II5A 1ZKBA 3EKIA 1SYIA 1MY2A 2F5XA 3EHTA 2LAOA 1RDXA 3KC0A 3U93A 1ZJLA 2Q8JA 1MY4A 1FSAA 4I40A 3SESA 4PAIA 1MPBA 3U65A 2DXYA 1O7TA 5I59B 1SBPA 4E0XA 5CRYA 4PCDA 4JBZA 5EYFA 4OTEA 4JSOA 4GL0A 4AB6A 3O6HA 4KYDA 5ELVA 3RNNA 3TELA 4OZ9A 5JTYA 1DPPA 5DVJA 2Z23A 3LV0A 1XHYA 4P8BA 3T9VA 1ZU0A 1B5JA 4ZECA 1K9YA 1NFTA 3D4GA 5KDTA 1MXWA 2ONKE 3PTYA 2XWVA 1Q9DA 1Q35A 4OVSA 1ANFA 5ICTA 2FBPA 1FBGA 1EYIA 4UA8A 5CMCA 1FTLA 3F11A 5EHMA 3O66A 1PB8A 1I6BA 3MQ9A 4JSDA 5LOMA 4PTKA 1QULA 4OYVA 4ESWA 2H4IA 2F36A 4M1VA 4FEBA 1RDZA 3ROJA 5I2KA 4WXJA 2HQ0A 3C9HA 2AL5A 3HHFA 4FAJA 2DWAA 3CIJA 2OWZA 1DOTA 4ELPA 3PUXE 2Y84A 2Z22A 3L6HA 4R6KA 3MW0A 5I58B 4MJOA 4JVCA 2F7BA 2RF1A 3IX1A 1IIWA 2QVVA 5T3JA 3H3GA 1FBFA 3KBRA 4PE3A 2OJTA 4F3SA 5IZ1A 3W15C 3HO7A 3ILUB 3KFMA 4GWXA 4MCOA 1LLSA 3B6TA 3BIHA 1CNQA 3UIFA 1SVXB 3UORA 1XI6A 4N6PA 4NF4B 4ZEFA 1FBHA 4GIZA 4U4SA 1VR5A 1B52A 3Q26A 4GFRA 5AA3A 4GVOA 3PUVE 3TKDA 1QUJA 1ZTYA 4O3BA 5B7DA 4H46A 1OLCA 1DTGA 2GHAA 5H8QA 1MH3A 1EYKA 3ZSFA 1O64A 4OFOA 5CBRA 3TZAA 3E13X 4MHFA 4G61A 4NF8B 1A8FA 5CI5A 4R72A 1BK4A 3KOTA 3M8UA 4KYEA 1NUZA 3T22A 4GWYA 3G3JA 2AIXA 1OVBA 2HXWA 2BJIA 2OPDA 4YMBA 4KXPA 4ND9A 3MP1A 4PF6A 3H4ZA 2DSFA 1D3KA 5I56B 2ABHA 4NTLA 3CSGA 4N07A 1NNKA 2F6GA 3GZGA 1BTJA 4ZS9A 2UYEA 3RPLB 3N26A 1IXIA 3QYTA 4WEPA 4MLVA 4OHNA 4ELQA 3WAEA 4GWZA 2NVUB 4NF0A 1Z7ME 3T1BA 4PFUA 2QMWA 4IO4A 1Y20A 2HCAA 2PFZA 2ZYMA 3C34A 3VFJA 4PF8A 1FQAA 4OA4A 3ZS6A 2KLFA 3IAZA 3SDFA 4NMYA 2A5TA 2M8CA 2Q89A 1MPCA 3OMBA 1YTVA 5DVIA 1KWHA 3TTLA 3C36A 4G8NA 1P1OA 5EQAA 3TCFA 3PMXA 1YCJA 5I84A 1VSOA 5CBSA 4HW8A 1XOCA 3BBRA 4N15A 4F3BA 2QS2A 3T9XB 1VDWA 3JV9A 1PDAA 2VGQA 2H9BA 4LP2B 4IB2A 3MAMA 4POXA 3R26A 4GL8A 3OXNA 4ZZAA 1GV8A 3UN6A 1IMFA 2F3BA 4JWXA 3CG3A 3V5AA 5I7IA 1NNPA 1NH8A 1B05A 4GBWA 2AYSA 4G68A 3PUYE 3MP6A 2UVIA 4PC9A 3N94A 2QFLA 5FHMA 1DBZA 4GQOA 2B65A 4MNCA 4X1BA 4H45A 3IORA 1BP5A 3BIGA 4P1EA 1MY0A 4N13A 2QMXA 1FJ9A 4DZ1A 3OELA 5H8FA 4I62A 3IJXB 4GD5A 3R7XA 4GF8A 4KPTA 2DOJA 1PEBA 2UXAA 5ET7A 1ZIUA 3H7MA 4OQOA 2ZXTA 1SW2A 4ONYA 1JW4A 1L5TA 3SEUA 3KN7A 1LBZA 3LSWA 2ZNSA 2GFEA 3PPPA 3FIRA 4HS7A 4TLMB 3I6VA 3TTRA 1WDNA 4MEVA 1B6HA 2WKYA 2Q8MA 4Q5TA 4ELOA 4JVIA 5ESYA 1A7LA 4IY5A 4DDDA 4LQ5A 1IMCA 1FBPA 4RXLA 1BIYA 3M3KA 1POTA 2RCBA 2DYXA 3S9NC 1Y1ZA 2VD3A 2F78A 3QAXA 4LVQA 2QL3A 3DP8A 3DELB 3HSTA 1USYH
chains in the Genus database with same CATH topology
4P3LA 3FXBA 2CEYA 1NV7A 1NV5A 3RYDA 3MSTA 4NN3A 4I3EA 3RPLA 3MYUA 2P3NA 3KBZA 3W9WA 2DE4A 4P56A 1NV2A 4XF5A 3CHGA 2DE2A 1FPFA 3EKIA 4YZZA 1IMEA 2F5XA 4GWSA 1RDXA 4PGPA 3KC0A 2FIEA 3ISPA 5J1DA 1FTAA 1DK4A 4MIJA 1FSAA 4I40A 4PAIA 4GX3A 3U65A 4QXDA 4HE0A 2ZZWA 4I3YA 1FBEA 4PCDA 5I5PA 5EQ7A 2Q74A 4O94A 2P3VA 2XWOA 2DDKA 4PDHA 4NQ8A 3HFUA 4IR8A 4P1LA 3LV0A 2CEXA 2CZIA 4GBVA 2WYKA 4N6DA 5IM2A 1NUWA 2WYPA 5I3SA 1G0HA 3KC1A 4P8BA 5IZ3B 1LEVA 4HE2A 1K9YA 1YXIA 1INPA 1FPLA 4F19A 2F3DA 4NGUA 5CM6A 3PTYA 2XWVA 1Q9DA 4OVSA 2ZZXA 1NI9A 2FBPA 1FBGA 1EYIA 3NOHA 4PDDA 4O7MA 2FHYA 2Y5KA 1LBYA 2HZLA 4PTKA 1LBXA 4N17A 5IGAA 4M1VA 1RDZA 2VPOA 4GX6A 3ROJA 4AS5A 5EQ9A 4DI4B 2OWZA 4X9TA 1KA0A 4N81A 5FBPA 4MX6A 4MJOA 2Y5LA 4JVCA 1FPGA 1NV0A 4P9KA 2QVVA 5T3JA 1FBFA 5LDZA 2Q9TA 1SPIA 4PE3A 5IZ1A 4GWXA 4MCOA 3GYYA 2V4CA 1NV3A 4GWWA 3BIHA 1CNQA 1FRPA 4N6KA 2JJKA 1LBVA 1XI6A 1EYJA 4OVQA 1FBHA 5EYGA 4XEQA 5ET8A 2L5VA 1NV6A 4F1VA 2B4MA 4PAKA 1NUYA 4MAGA 4N91A 4NHBA 1NV1A 3W9VA 4H46A 2DVZA 1EYKA 3QMFA 2WBBA 1G0IA 2WBDA 2B4LA 3LUZA 4MHFA 4G61A 1RDYA 1IMAA 2QVUA 1FJ6A 5EQ8A 4UABA 2MKZA 4OANA 1BK4A 1NUZA 5LTCA 4PBQA 1NV4A 1DCUA 4GWYA 2GQ1A 2BJIA 1KZ8A 5EYHA 4PFBA 2PCRA 4KXPA 1FPDA 3A29A 4XFEA 4F18A 4PF6A 4AS4A 1FPJA 4O7IA 4GWUA 2WEFA 2VT5A 2QVRA 1YZ0A 2XA5A 3SZPA 1D9QA 5IZ3A 3E79A 1AWBA 2FVZA 4HCWA 3RPLB 5DW8A 4GWZA 4NF0A 1LBWA 3T1BA 3FBPA 5A5LA 2PFZA 4P47A 5JK4A 4PF8A 4HXVA 4OA4A 3IFAA 4GX4A 1JP4A 4PFIA 4N4UA 2ZZVA 2DE3A 2KR0A 2XXKA 3B8BA 1KA1A 2WX9A 1K9ZA 4PBHA 5EQAA 1FPKA 2V3QA 4FBPA 1IMBA 5ET5A 1NUXA 1IMDA 4N15A 1YYZA 1VDWA 3B50A 2CZHA 2VPNA 1IMFA 2F3BA 4PAFA 2PFYA 5I7IA 4X04A 2HPGA 4GBWA 4N8YA 5J16A 4PC9A 4X8RA 4LN5A 5IZZA 2QFLA 4HCYA 4DI3D 5ET6A 1DBZA 1QGXA 2CZKA 4MNCA 4PETA 2XWIA 4MMPA 4OVTA 4H45A 4NX1A 4N8GA 1FPEA 3BIGA 4P1EA 2QPQA 1FJ9A 3E78A 2R8TA 4OVRA 1FBCA 2XWKA 4NAPA 3T0JA 5ET7A 3IFCA 1FPIA 2FIXA 3D1RA 4PGNA 1LBZA 4MNIA 4PFRA 4F1UA 1FBDA 2HXRA 2HZKA 4NG7A 4MEVA 2KQZA 4MNPA 2Q8MA 4JVIA 5ESYA 4QBAA 4HE1A 1IMCA 1FBPA 1FPBA 4OVPA 4O8MA 4JVDA 2HHMA 4YICA 2OX3A 5F24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5K A;  1LBY A;  1IMD A;  1YYZ A;  3LUZ A;  1NV7 A;  1VDW A;  4G61 A;  1RDY A;  1IMA A;  4PTK A;  1LBX A;  1NV5 A;  2QVU A;  2CZH A;  3RYD A;  1FJ6 A;  5EQ8 A;  1BK4 A;  1NUZ A;  1IMF A;  4I3E A;  2F3B A;  1RDZ A;  3RPL A;  4GX6 A;  3ROJ A;  4AS5 A;  1NV4 A;  5EQ9 A;  1DCU A;  4GWY A;  2P3N A;  2GQ1 A;  3KBZ A;  4GBW A;  2BJI A;  1KZ8 A;  1NV2 A;  5J16 A;  2OWZ A;  5EYH A;  1FPF A;  2QFL A;  2PCR A;  4KXP A;  1KA0 A;  1FPD A;  4N81 A;  3A29 A;  5ET6 A;  1DBZ A;  1QGX A;  2CZK A;  4AS4 A;  1FPJ A;  4O7I A;  5FBP A;  4GWU A;  4H45 A;  2WEF A;  1FPE A;  1IME A;  2QVR A;  2VT5 A;  3BIG A;  4GWS A;  4MJO A;  1FJ9 A;  1RDX A;  2Y5L A;  1YZ0 A;  3KC0 A;  1FPG A;  2FIE A;  1FTA A;  1DK4 A;  2R8T A;  1FBC A;  1FSA A;  1D9Q A;  4I40 A;  1NV0 A;  2QVV A;  5IZ3 A;  4GX3 A;  1FBF A;  5T3J A;  1AWB A;  3T0J A;  2FVZ A;  5LDZ A;  4QXD A;  3RPL B;  4HE0 A;  5ET7 A;  3IFC A;  4I3Y A;  5DW8 A;  1SPI A;  1FBE A;  2WBD A;  4GWZ A;  5IZ1 A;  5EQ7 A;  2Q74 A;  1FPI A;  1LBW A;  2P3V A;  2DDK A;  4GWX A;  3FBP A;  2FIX A;  5A5L A;  1NV3 A;  3D1R A;  1LBZ A;  4GWW A;  3BIH A;  1CNQ A;  1FRP A;  1FBD A;  2JJK A;  1LBV A;  1XI6 A;  1EYJ A;  1FBH A;  5EYG A;  4IR8 A;  5ET8 A;  4HXV A;  1NV6 A;  3LV0 A;  2CZI A;  4GBV A;  3IFA A;  4GX4 A;  1NUW A;  5I3S A;  1G0H A;  2Q8M A;  1NUY A;  3KC1 A;  1JP4 A;  5ESY A;  5IZ3 B;  1LEV A;  4HE1 A;  4HE2 A;  1IMC A;  1FBP A;  1FPB A;  1K9Y A;  1YXI A;  1INP A;  1FPL A;  2F3D A;  3B8B A;  1Q9D A;  1KA1 A;  1NV1 A;  2HHM A;  1NI9 A;  1K9Z A;  2FBP A;  4H46 A;  1FBG A;  1EYI A;  5EQA A;  1FPK A;  1EYK A;  3QMF A;  2OX3 A;  2WBB A;  1G0I A;  5F24 A;  4FBP A;  1IMB A;  5ET5 A;  2FHY A;  1NUX A; 
#chains in the Genus database with same CATH topology
 4KR5 A;  4YB6 A;  3TOD A;  1B3L A;  1NV7 A;  4JWY A;  3IR1 A;  4LQ2 A;  3RYD A;  4DCY A;  1B58 A;  2V93 A;  2F97 A;  5M2V A;  4BDL A;  3PU5 A;  2PBW A;  3RTF B;  2BJJ X;  4XF5 A;  1FPF A;  3K4U A;  2Z8F A;  1UTH A;  2QSX A;  2Y7W A;  2DWI A;  3QSL A;  4YKP A;  4GWS A;  2XXX A;  2IA4 A;  3O29 A;  4RA1 A;  4ELR A;  1FTA A;  4BDR A;  4HTG A;  2QJE A;  3H6U A;  4MIJ A;  4P0I A;  4GX3 A;  3I5O A;  2ZYO A;  4HE0 A;  4I3Y A;  1FTJ A;  2RCA A;  3S9L C;  2FNC A;  2XX7 A;  1S50 A;  2DDK A;  5AA2 D;  2E0S A;  5AA4 B;  1MY3 A;  3LSF B;  3USD A;  2RC7 A;  3CRB A;  2Z8D A;  4F2O A;  3E3K A;  2V3T A;  4DXC A;  5L8D A;  1MM7 A;  5DYH A;  4FED A;  3U1O A;  2CZI A;  4GBV A;  5AE4 A;  1S7Y A;  5IM2 A;  2WYP A;  4AQ4 A;  1EH3 A;  4OMB A;  3KJ7 A;  1J1N A;  4P0G A;  1LEV A;  3MWB A;  3K6U A;  1Y3N A;  3OSQ A;  4F19 A;  2F3D A;  1EU8 A;  3FVO A;  1NI9 A;  4YKI A;  1JW1 A;  2O51 A;  3CG1 A;  3LSX A;  1Q1K A;  3DLN A;  2FHY A;  2Y5K A;  1LBY A;  3K6V A;  1SW5 A;  1FTM A;  3TTN A;  1N0T A;  3FXU A;  1QKB A;  4N17 A;  2NXO A;  2XXY A;  3SEW A;  5DVF A;  2A5T B;  2I49 A;  4OEV A;  4GX6 A;  1B3E A;  5EQ9 A;  2XXT A;  1FQD A;  2PMS A;  3Q29 A;  4DI4 B;  4QFO A;  1PBQ A;  4N81 A;  1B2H A;  5FTH A;  4G8H A;  1ELJ A;  1AH5 A;  5KCJ A;  1B0H A;  1VFE A;  2Y5L A;  3G7W A;  1B5I A;  1A8E A;  5I2N B;  2O1L A;  2O6A A;  5H8S A;  4NED A;  3RPW A;  2Q9T A;  4R2B A;  4H0W A;  4XKR A;  4EF1 A;  3VDF A;  2XHD A;  4G68 B;  3GYY A;  3FV1 A;  2O1M A;  3SET A;  5F1Q A;  2B3B A;  3RY3 A;  1FRP A;  2YPN A;  1EYJ A;  4OVQ A;  3G3F A;  2L5V A;  1JVX A;  1NV6 A;  4JB7 A;  2G29 A;  4ESX A;  4R9G A;  5ITP A;  4N91 A;  3CFX A;  4NHB A;  5DTB A;  1GGG A;  1IEJ A;  3MVX A;  3OO7 A;  1S9T A;  1IXH A;  2WBB A;  4U2R A;  4FAT A;  2VOZ A;  4BDQ A;  2WBD A;  1EZP A;  4YU0 A;  1B1X A;  4ISU A;  4G8M A;  1JW5 A;  3OEM A;  1SDX A;  1IMA A;  3IB0 A;  1QW0 A;  5F7V A;  2QVU A;  2RC8 A;  3MPL A;  1MXV A;  4UAB A;  2OK2 A;  4O3A A;  4OAN A;  2ALU A;  1Y3P A;  2Y7K A;  3TAJ A;  1NV4 A;  1CE2 A;  4R74 A;  3T9U A;  3TQW A;  5EHS A;  3K02 A;  4PFY A;  3C33 A;  4RNS A;  1KZ8 A;  3VE1 B;  5EYH A;  1WVJ A;  3TYH A;  4C1U A;  4H65 A;  1N3X A;  3A29 A;  3FAT A;  4F18 A;  5HPQ A;  1M5C A;  2UVH A;  2CMO A;  4GWU A;  2OBG A;  1CB6 A;  3FXR A;  4ZE8 A;  3B6Q A;  1MRP A;  4H67 A;  1URS A;  2XA5 A;  3UGW A;  3H6V A;  3SZP A;  1D4N A;  3TTK A;  1RYX A;  4P11 A;  4GLI A;  1IQ7 A;  1AWB A;  4HCW A;  3K1M A;  2V84 A;  3PUZ E;  2OPE A;  5ISU A;  4H6D A;  4OEU A;  5A5L A;  4E0W A;  1A55 A;  2I4B A;  5IKB A;  4I1D A;  4WED A;  1H3D A;  2Q2C A;  5JK4 A;  1ZBM A;  3K0V A;  3MZ1 A;  3JYR A;  2Y7P A;  1JP4 A;  2VP1 A;  1ZLQ A;  3B8B A;  2A5S A;  4ZDM A;  2IEE A;  2WX9 A;  3N5L A;  4F3G A;  2PT2 A;  4RK9 A;  2I4C A;  2X7Q A;  3TMG A;  1SI1 A;  4FBP A;  1IMB A;  1YYZ A;  1A40 A;  1H43 A;  2XXV A;  1POY 1;  2DP8 A;  2P1S A;  3KZG A;  1QVS A;  1T0K A;  1D9V A;  2PFY A;  3KN3 A;  3SER A;  3OO6 A;  5I57 A;  3K2D A;  4X04 A;  5K2X A;  3MBP A;  5J16 A;  1FQF A;  1LB9 A;  3IK6 B;  4EUO A;  4HCY A;  4DI3 D;  5ET6 A;  1NH7 A;  2CZK A;  1NMU A;  1LBB A;  1Y4C A;  4RY1 A;  3Q28 A;  4N8G A;  4PP0 A;  1FPE A;  1P99 A;  3BKI B;  3N6T A;  1Y3Q A;  3G3I A;  1OMP A;  3E78 A;  1B9J A;  1N7X A;  5L9S A;  1FBC A;  2XWK A;  1SQY A;  1MQD A;  4NAP A;  3FJM A;  2V3U A;  3IFC A;  1LAH E;  5DEX B;  1FQC A;  3PPR A;  1FPI A;  2FA7 A;  5TPA B;  3S2V A;  1NNT A;  2X26 A;  2O69 A;  4PFR A;  1OQG A;  3MVW A;  3MZB A;  3KOS A;  1PB7 A;  1P1W A;  3TDJ A;  4NG7 A;  4BDM A;  1IXG A;  2KQZ A;  3H03 A;  3IOU A;  4MNP A;  3CVG A;  4PFW A;  1FPB A;  4OVP A;  4TLL B;  4KHZ E;  3CR9 A;  1OVT A;  3SEV A;  2HHM A;  2PX1 A;  4POW A;  2F6P A;  3A09 A;  1P1U A;  2OX3 A;  2F7C A;  4QHQ A;  3ECR A;  2ZYK A;  3FD3 A;  3C32 A;  4P3L A;  3VXC A;  2CEY A;  4PE5 B;  2NUV A;  3K01 A;  2QRY A;  2P2A A;  1GTK A;  4NN3 A;  5JEI A;  2Y7I A;  3B7D A;  3PGF A;  3UK4 A;  1UTB A;  1MXY A;  3EQ1 A;  3EF7 A;  3K1N A;  5JTY B;  4DIG A;  3T96 B;  4F2Q A;  4TQU Q;  2D5W A;  3JZJ A;  2OCU A;  4FEC A;  2XXW A;  4YZZ A;  5K2Y A;  2F8D A;  1IME A;  2ZNU A;  1B32 A;  4PGP A;  3VV5 A;  1FTO A;  2FIE A;  3ISP A;  3IJO B;  5KDT B;  4KCD A;  3MZ9 A;  2R71 A;  4QXD A;  1TT1 A;  2GHB A;  4XKP A;  3BFT A;  1FBE A;  4RJZ A;  4QSE A;  5I5P A;  4O94 A;  2Q74 A;  2O7I A;  3FVK A;  1SI0 A;  2XWO A;  4MF3 A;  3OSR A;  4I9D A;  1H76 A;  3ZKK A;  2XD2 A;  3WAF A;  3QXM A;  3MJN A;  4Q30 B;  2I0B A;  4NQ8 A;  4KCC A;  4KD5 A;  4G4P A;  4IY6 A;  2R6G E;  4IR8 A;  4PQJ A;  3H6T A;  4KQP A;  4P1L A;  2WYK A;  4H5G A;  4OET A;  4N6D A;  1NUW A;  3O2A A;  1A54 A;  1G0H A;  5I2K B;  3KC1 A;  4QF9 A;  1I6A A;  4HE2 A;  1YXI A;  1INP A;  1FPL A;  3C31 A;  3OEN A;  5BWJ A;  3PV0 E;  4M4G A;  2W7Y A;  5I59 A;  2ZZX A;  1IZ1 A;  3C35 A;  3NOH A;  4BLA A;  1QUK A;  4IO3 A;  1PC3 A;  1M5B A;  2HZL A;  3EHS A;  2ANJ A;  1US4 A;  5IGA A;  1EZO A;  3SEX A;  4U21 A;  1TFD A;  3VVD A;  2VPO A;  4OVJ A;  3CSB A;  5TP9 A;  3GBB A;  3DP6 A;  4YB7 A;  1EZ9 A;  4ZE9 A;  1MQH A;  1LGB C;  4X9T A;  4GXA A;  1KA0 A;  3A3C A;  2H5Y A;  1F9B A;  3O6I A;  3PMV A;  4MX6 A;  3SKP A;  4EXK A;  2DXR A;  4GRK A;  3LC8 A;  3PD9 A;  2XX8 A;  1N04 A;  2O84 X;  4EQ7 A;  1MXU A;  3RUM A;  3HCQ A;  2I6E A;  4H8J A;  5I57 B;  1SPI A;  5H8Q B;  2I3W A;  2D3I A;  3M3F A;  4XIG Q;  4DXB A;  1LAF E;  1LST A;  2V4C A;  4MH5 A;  1LFH A;  4N6K A;  3A3U A;  1TFA A;  4FJP A;  4RYA A;  5H8N A;  4XEQ A;  3TQL A;  1H44 A;  4RK2 A;  4GOT A;  3RT8 A;  2B4M A;  2PYY A;  1B3G A;  2ONS A;  4PAK A;  1N76 A;  1N84 A;  2E1S A;  4MAG A;  3FVN A;  3O97 A;  2PVU A;  1GVC A;  1US5 A;  1B7U A;  1NV1 A;  4ZZE A;  1AMF A;  1JQF A;  3MPK A;  2DVZ A;  5KZT A;  4QFL A;  3QMF A;  1VE4 A;  1G0I A;  4YB5 A;  2GH9 A;  1LFI A;  1MQG A;  2NOO A;  2B4L A;  2G93 A;  5CMK A;  5L9O A;  1FJ6 A;  5EQ8 A;  3VLU A;  3M3L A;  1DMB A;  5LTC A;  2R9J A;  4PBQ A;  4ZED A;  3S4U A;  1XS5 A;  1DCU A;  4RPN A;  1FW0 A;  3FVG A;  3OEK A;  3TUS A;  4PFB A;  1FPD A;  1MH4 A;  4AS4 A;  1FPJ A;  4O7I A;  4JXI A;  1B5H A;  5L9M A;  4IGT A;  3IOW A;  2WEF A;  3MC2 A;  2VT5 A;  2QVR A;  4NF8 A;  2CZL A;  3Q27 A;  3TPA A;  5IZ3 A;  1M5E A;  2FVZ A;  1P1N A;  1IXC A;  4NF5 A;  4QSC A;  1LBC A;  3H6W A;  1UTB B;  3MVZ A;  1LBW A;  3E9X A;  1ATG A;  4ECF A;  3KGC A;  5B70 A;  1JET A;  2REJ A;  3LUY A;  3BFU A;  3IO4 A;  5FTI A;  5I56 A;  4GX4 A;  2XXR A;  1R9Q A;  3IL1 B;  4PFI A;  4N4U A;  4NWD A;  2KR0 A;  2XXK A;  4NE4 A;  4R2F A;  4EF2 A;  4QRZ A;  2D21 A;  1URD A;  1K9Z A;  1FPK A;  2YJP A;  5ET5 A;  1D9Y A;  1Y4T A;  1IMD A;  3U8Q A;  5H8F B;  3QUJ A;  3B50 A;  2DWJ A;  2VPN A;  3FZV A;  2HAU A;  4X1D A;  2VD2 A;  1R6Z A;  4PAF A;  4G77 A;  5ITO A;  3CFL A;  4F1Y A;  4U23 A;  4N8Y A;  2XXQ A;  4X8R A;  1UIV A;  5IZZ A;  3CI8 A;  1JEU A;  4F22 A;  3QIM A;  1AL3 A;  4OVT A;  1MXX A;  4MMP A;  4NX1 A;  2HAV A;  3FAS A;  3ONM A;  3PD8 A;  4R75 A;  3THI A;  4YAH X;  1TXF A;  3HV1 A;  2QPQ A;  2THI A;  2QS1 A;  2DS9 A;  3MUQ A;  2XXP A;  4G68 C;  1B3H A;  1TWY A;  2R8T A;  1DTZ A;  4LON B;  4LUB A;  3PUW E;  5TP9 B;  3TTM A;  4LA9 A;  2AL4 A;  5FHO A;  3GXA A;  4OFJ A;  3VLW A;  3I3V A;  2FIX A;  3D1R A;  1FBD A;  3EPE A;  2HXR A;  1I6Q A;  2HZK A;  1OQH A;  3R6U A;  1NNF A;  1R9L A;  4UAC A;  4WKM A;  1FQE A;  2H98 A;  3GLB A;  3IOT A;  4NF6 A;  3U92 A;  4YKK A;  1M5F A;  1SYH A;  3LSL A;  4HE1 A;  1HSE A;  1LAX A;  1MXZ A;  1PB9 A;  1N7W A;  3Q25 A;  4O8M A;  2QS4 A;  3KSX A;  1UTH B;  4LAT A;  1OLA A;  4F29 A;  1P1Q A;  3PMW A;  4OWD A;  1XT8 A;  4XXU A;  4H5F A;  5F24 A;  1OIB A;  2H25 A;  1Y1M A;  3FXB A;  2O68 A;  4IO7 A;  5AA2 A;  5H8N B;  1A99 A;  1FTK A;  3RN8 A;  1NV5 A;  3HPI A;  3MST A;  4QFN A;  1MG1 A;  4I3E A;  1BLF A;  3MVY A;  3RTW B;  3MYU A;  3FV2 A;  4FE8 A;  1B7Z A;  2P3N A;  4MBP A;  4P56 A;  1NV2 A;  1LFG A;  1IUD A;  4U4X A;  1LB8 A;  3O6G A;  4OXV A;  5HBC A;  2DVC A;  4F31 B;  1WOD A;  4YMA A;  2I58 A;  3TCG A;  1AOV A;  2VHA A;  2OZZ A;  4R73 A;  3TCH A;  3K6X A;  4ZEK A;  5CC2 A;  5IAI A;  5J1D A;  1DSN A;  1MDQ A;  1DK4 A;  2PT1 A;  3FXQ A;  2QS3 A;  4ZEI A;  4XKN A;  2OWT A;  5CMB A;  2ZZW A;  2XX9 A;  2X7P A;  2HFB A;  5EQ7 A;  2P3V A;  1MM6 A;  4PDH A;  3HFU A;  2ONR A;  2I0C A;  2P0S A;  2Q88 A;  1FQB A;  4FOR A;  2CEX A;  1DPE A;  3IB2 A;  5I3S A;  2REG A;  3CFZ A;  3ODB A;  4H8I A;  1IIT A;  5IZ3 B;  4EDP A;  4KFQ A;  2ZNT A;  3K1P A;  1Y9U A;  4NF5 B;  3FJG A;  4EXL A;  1B3F A;  4NGU A;  5CM6 A;  3K00 A;  1B4Z A;  5KCJ B;  4PDD A;  3G3G A;  4O7M A;  3G3H A;  5AA4 A;  3T66 A;  3FUZ A;  2F34 A;  3RQT A;  4R6H A;  1LBX A;  3RGY A;  3VXB A;  2OLB A;  1UIU A;  3C4M A;  3T9H B;  5A5X A;  4EQ9 A;  4AS5 A;  1XVY A;  2YLN A;  1RKM A;  4C1T A;  1QUI A;  1SD3 A;  3KG2 A;  5H8H A;  4Q0C A;  5BUU A;  1MQJ A;  2Y7R A;  1O63 A;  5FBP A;  3V83 A;  3VVF A;  3L6G A;  4LZ7 A;  4MLQ A;  1M5D A;  1FPG A;  2DQV A;  2B3F A;  3DM0 A;  3IB1 A;  4QFK A;  1NV0 A;  4P9K A;  1QJM A;  5LDZ A;  3UP9 A;  2I48 A;  1HSL A;  3KSJ A;  1XC1 A;  1NV3 A;  2HEU A;  4GWW A;  3OO9 A;  2JJK A;  1LBV A;  2ZYN A;  5EYG A;  2F35 A;  5ET8 A;  4F1V A;  3HHG A;  3LBS A;  4DLD A;  3IOV A;  1QKA A;  1NUY A;  3KEI A;  4OER A;  3VLV A;  5I2N A;  2F7A A;  3TEP A;  4U1Z A;  3V89 B;  3HN0 A;  3E4R A;  1MQI A;  3W9V A;  4IO2 A;  1MS7 A;  4OEN A;  4I8C A;  2Q2A A;  3PPQ A;  3LUZ A;  1RDY A;  1GR2 A;  1B51 A;  3KJT A;  1MDP 1;  4RPO A;  2MKZ A;  4Q8R A;  1H45 A;  4NF6 B;  4U22 A;  4KI0 E;  3H06 B;  2FYI A;  4H1X A;  4JDF A;  2GQ1 A;  3V8X B;  4F3P A;  3D4C A;  4DE8 A;  4EQB A;  1B0L A;  2RIN A;  5CMM A;  4GXS B;  3DP4 A;  2PCR A;  4IGR A;  1ZMG A;  4XFE A;  2XXH A;  4LZ8 A;  3RLF E;  1JVY A;  5AA2 B;  5FHN A;  1AIV A;  3MP8 A;  1YZ0 A;  3ZKL A;  2RKM A;  1D9Q A;  3E79 A;  4TOZ A;  4OES A;  4R6Y A;  3O9P A;  5DW8 A;  2XD3 A;  3P7I A;  2XXI A;  3OO8 A;  3FJ7 A;  3FBP A;  3ILT B;  1YAE A;  1UQW A;  1SW1 A;  3EHU A;  4P47 A;  4BDN A;  4GWO A;  4HXV A;  1FCK A;  1PBP A;  3IFA A;  2NWJ A;  3S9M C;  3UA8 A;  1NKX A;  3GBA A;  4G2Z A;  4MFI A;  2XXU A;  2ZZV A;  2DE3 A;  4O3C A;  4L17 A;  1USY E;  4KYS A;  4DXU A;  1KA1 A;  3RT6 B;  4PBH A;  1NL5 A;  2V3Q A;  4K3F A;  4YKJ A;  5ICQ A;  1NUX A;  3LR1 A;  1LCT A;  2RC9 A;  2UVG A;  1RYO A;  3SEY A;  5I58 A;  4QFP A;  4JWO A;  3VVE A;  5HM4 B;  4NWC A;  2CZH A;  3EN3 A;  4DCX A;  1MY1 A;  4OFL A;  1N3W A;  4THI A;  3OD7 A;  4PFT A;  2HPG A;  1HSJ A;  3PPO A;  4LN5 A;  2H99 A;  4C0R A;  1B7H A;  1QGX A;  4Z7E A;  1B46 A;  4PET A;  4AB5 A;  4NF4 A;  2XWI A;  2GRV A;  1LAG E;  3G3K A;  3TFL A;  1B1H A;  2UVJ A;  4OVR A;  5TU0 A;  5A5X B;  1YPN A;  3T0J A;  1URG A;  4U1O A;  4X48 A;  1Z7N E;  4QSD A;  1R1N A;  4PGN A;  4MNI A;  5H8H B;  4F39 A;  4F1U A;  1MPD A;  2OWS A;  1JEV A;  1JNF A;  3KN8 A;  4IO6 A;  3U72 A;  1SW4 A;  3IO6 A;  4Z0I A;  2UYF A;  1I69 A;  3AXF A;  3O28 A;  1VFD A;  2DWH A;  3B6W A;  3OOA A;  2O7U A;  3K6W A;  4QBA A;  2V25 A;  2ZMB A;  3QK6 A;  4ZEB A;  4JVD A;  5AA1 A;  5DEX A;  4YIC A;  4XKQ A;  5TPA A;  3N6U A;  3FGS A;  1LCF A;  1XVX A;  5DT6 A;  3U94 A;  4BDO A;  2Z8E A;  4LZ5 A;  1B40 A;  1B4H A;  2ESN A;  1BKA A;  3RPL A;  3T93 B;  4FIM A;  3KBZ A;  3S9E A;  3W9W A;  4IO5 A;  2DE4 A;  3PPN A;  3CHG A;  2I3V A;  4XTC Q;  2DE2 A;  4R9F A;  3QUF A;  1II5 A;  1ZKB A;  3EKI A;  1SYI A;  1MY2 A;  2F5X A;  3EHT A;  2LAO A;  1RDX A;  3KC0 A;  3U93 A;  1ZJL A;  2Q8J A;  1MY4 A;  1FSA A;  4I40 A;  3SES A;  4PAI A;  1MPB A;  3U65 A;  2DXY A;  1O7T A;  5I59 B;  1SBP A;  4E0X A;  5CRY A;  4PCD A;  4JBZ A;  5EYF A;  4OTE A;  4JSO A;  4GL0 A;  4AB6 A;  3O6H A;  4KYD A;  5ELV A;  3RNN A;  3TEL A;  4OZ9 A;  5JTY A;  1DPP A;  5DVJ A;  2Z23 A;  3LV0 A;  1XHY A;  4P8B A;  3T9V A;  1ZU0 A;  1B5J A;  4ZEC A;  1K9Y A;  1NFT A;  3D4G A;  5KDT A;  1MXW A;  2ONK E;  3PTY A;  2XWV A;  1Q9D A;  1Q35 A;  4OVS A;  1ANF A;  5ICT A;  2FBP A;  1FBG A;  1EYI A;  4UA8 A;  5CMC A;  1FTL A;  3F11 A;  5EHM A;  3O66 A;  1PB8 A;  1I6B A;  3MQ9 A;  4JSD A;  5LOM A;  4PTK A;  1QUL A;  4OYV A;  4ESW A;  2H4I A;  2F36 A;  4M1V A;  4FEB A;  1RDZ A;  3ROJ A;  5I2K A;  4WXJ A;  2HQ0 A;  3C9H A;  2AL5 A;  3HHF A;  4FAJ A;  2DWA A;  3CIJ A;  2OWZ A;  1DOT A;  4ELP A;  3PUX E;  2Y84 A;  2Z22 A;  3L6H A;  4R6K A;  3MW0 A;  5I58 B;  4MJO A;  4JVC A;  2F7B A;  2RF1 A;  3IX1 A;  1IIW A;  2QVV A;  5T3J A;  3H3G A;  1FBF A;  3KBR A;  4PE3 A;  2OJT A;  4F3S A;  5IZ1 A;  3W15 C;  3HO7 A;  3ILU B;  3KFM A;  4GWX A;  4MCO A;  1LLS A;  3B6T A;  3BIH A;  1CNQ A;  3UIF A;  1SVX B;  3UOR A;  1XI6 A;  4N6P A;  4NF4 B;  4ZEF A;  1FBH A;  4GIZ A;  4U4S A;  1VR5 A;  1B52 A;  3Q26 A;  4GFR A;  5AA3 A;  4GVO A;  3PUV E;  3TKD A;  1QUJ A;  1ZTY A;  4O3B A;  5B7D A;  4H46 A;  1OLC A;  1DTG A;  2GHA A;  5H8Q A;  1MH3 A;  1EYK A;  3ZSF A;  1O64 A;  4OFO A;  5CBR A;  3TZA A;  3E13 X;  4MHF A;  4G61 A;  4NF8 B;  1A8F A;  5CI5 A;  4R72 A;  1BK4 A;  3KOT A;  3M8U A;  4KYE A;  1NUZ A;  3T22 A;  4GWY A;  3G3J A;  2AIX A;  1OVB A;  2HXW A;  2BJI A;  2OPD A;  4YMB A;  4KXP A;  4ND9 A;  3MP1 A;  4PF6 A;  3H4Z A;  2DSF A;  1D3K A;  5I56 B;  2ABH A;  4NTL A;  3CSG A;  4N07 A;  1NNK A;  2F6G A;  3GZG A;  1BTJ A;  4ZS9 A;  2UYE A;  3RPL B;  3N26 A;  1IXI A;  3QYT A;  4WEP A;  4MLV A;  4OHN A;  4ELQ A;  3WAE A;  4GWZ A;  2NVU B;  4NF0 A;  1Z7M E;  3T1B A;  4PFU A;  2QMW A;  4IO4 A;  1Y20 A;  2HCA A;  2PFZ A;  2ZYM A;  3C34 A;  3VFJ A;  4PF8 A;  1FQA A;  4OA4 A;  3ZS6 A;  2KLF A;  3IAZ A;  3SDF A;  4NMY A;  2A5T A;  2M8C A;  2Q89 A;  1MPC A;  3OMB A;  1YTV A;  5DVI A;  1KWH A;  3TTL A;  3C36 A;  4G8N A;  1P1O A;  5EQA A;  3TCF A;  3PMX A;  1YCJ A;  5I84 A;  1VSO A;  5CBS A;  4HW8 A;  1XOC A;  3BBR A;  4N15 A;  4F3B A;  2QS2 A;  3T9X B;  1VDW A;  3JV9 A;  1PDA A;  2VGQ A;  2H9B A;  4LP2 B;  4IB2 A;  3MAM A;  4POX A;  3R26 A;  4GL8 A;  3OXN A;  4ZZA A;  1GV8 A;  3UN6 A;  1IMF A;  2F3B A;  4JWX A;  3CG3 A;  3V5A A;  5I7I A;  1NNP A;  1NH8 A;  1B05 A;  4GBW A;  2AYS A;  4G68 A;  3PUY E;  3MP6 A;  2UVI A;  4PC9 A;  3N94 A;  2QFL A;  5FHM A;  1DBZ A;  4GQO A;  2B65 A;  4MNC A;  4X1B A;  4H45 A;  3IOR A;  1BP5 A;  3BIG A;  4P1E A;  1MY0 A;  4N13 A;  2QMX A;  1FJ9 A;  4DZ1 A;  3OEL A;  5H8F A;  4I62 A;  3IJX B;  4GD5 A;  3R7X A;  4GF8 A;  4KPT A;  2DOJ A;  1PEB A;  2UXA A;  5ET7 A;  1ZIU A;  3H7M A;  4OQO A;  2ZXT A;  1SW2 A;  4ONY A;  1JW4 A;  1L5T A;  3SEU A;  3KN7 A;  1LBZ A;  3LSW A;  2ZNS A;  2GFE A;  3PPP A;  3FIR A;  4HS7 A;  4TLM B;  3I6V A;  3TTR A;  1WDN A;  4MEV A;  1B6H A;  2WKY A;  2Q8M A;  4Q5T A;  4ELO A;  4JVI A;  5ESY A;  1A7L A;  4IY5 A;  4DDD A;  4LQ5 A;  1IMC A;  1FBP A;  4RXL A;  1BIY A;  3M3K A;  1POT A;  2RCB A;  2DYX A;  3S9N C;  1Y1Z A;  2VD3 A;  2F78 A;  3QAX A;  4LVQ A;  2QL3 A;  3DP8 A;  3DEL B;  3HST A;  1USY H; 
#chains in the Genus database with same CATH homology
 4P3L A;  3FXB A;  2CEY A;  1NV7 A;  1NV5 A;  3RYD A;  3MST A;  4NN3 A;  4I3E A;  3RPL A;  3MYU A;  2P3N A;  3KBZ A;  3W9W A;  2DE4 A;  4P56 A;  1NV2 A;  4XF5 A;  3CHG A;  2DE2 A;  1FPF A;  3EKI A;  4YZZ A;  1IME A;  2F5X A;  4GWS A;  1RDX A;  4PGP A;  3KC0 A;  2FIE A;  3ISP A;  5J1D A;  1FTA A;  1DK4 A;  4MIJ A;  1FSA A;  4I40 A;  4PAI A;  4GX3 A;  3U65 A;  4QXD A;  4HE0 A;  2ZZW A;  4I3Y A;  1FBE A;  4PCD A;  5I5P A;  5EQ7 A;  2Q74 A;  4O94 A;  2P3V A;  2XWO A;  2DDK A;  4PDH A;  4NQ8 A;  3HFU A;  4IR8 A;  4P1L A;  3LV0 A;  2CEX A;  2CZI A;  4GBV A;  2WYK A;  4N6D A;  5IM2 A;  1NUW A;  2WYP A;  5I3S A;  1G0H A;  3KC1 A;  4P8B A;  5IZ3 B;  1LEV A;  4HE2 A;  1K9Y A;  1YXI A;  1INP A;  1FPL A;  4F19 A;  2F3D A;  4NGU A;  5CM6 A;  3PTY A;  2XWV A;  1Q9D A;  4OVS A;  2ZZX A;  1NI9 A;  2FBP A;  1FBG A;  1EYI A;  3NOH A;  4PDD A;  4O7M A;  2FHY A;  2Y5K A;  1LBY A;  2HZL A;  4PTK A;  1LBX A;  4N17 A;  5IGA A;  4M1V A;  1RDZ A;  2VPO A;  4GX6 A;  3ROJ A;  4AS5 A;  5EQ9 A;  4DI4 B;  2OWZ A;  4X9T A;  1KA0 A;  4N81 A;  5FBP A;  4MX6 A;  4MJO A;  2Y5L A;  4JVC A;  1FPG A;  1NV0 A;  4P9K A;  2QVV A;  5T3J A;  1FBF A;  5LDZ A;  2Q9T A;  1SPI A;  4PE3 A;  5IZ1 A;  4GWX A;  4MCO A;  3GYY A;  2V4C A;  1NV3 A;  4GWW A;  3BIH A;  1CNQ A;  1FRP A;  4N6K A;  2JJK A;  1LBV A;  1XI6 A;  1EYJ A;  4OVQ A;  1FBH A;  5EYG A;  4XEQ A;  5ET8 A;  2L5V A;  1NV6 A;  4F1V A;  2B4M A;  4PAK A;  1NUY A;  4MAG A;  4N91 A;  4NHB A;  1NV1 A;  3W9V A;  4H46 A;  2DVZ A;  1EYK A;  3QMF A;  2WBB A;  1G0I A;  2WBD A;  2B4L A;  3LUZ A;  4MHF A;  4G61 A;  1RDY A;  1IMA A;  2QVU A;  1FJ6 A;  5EQ8 A;  4UAB A;  2MKZ A;  4OAN A;  1BK4 A;  1NUZ A;  5LTC A;  4PBQ A;  1NV4 A;  1DCU A;  4GWY A;  2GQ1 A;  2BJI A;  1KZ8 A;  5EYH A;  4PFB A;  2PCR A;  4KXP A;  1FPD A;  3A29 A;  4XFE A;  4F18 A;  4PF6 A;  4AS4 A;  1FPJ A;  4O7I A;  4GWU A;  2WEF A;  2VT5 A;  2QVR A;  1YZ0 A;  2XA5 A;  3SZP A;  1D9Q A;  5IZ3 A;  3E79 A;  1AWB A;  2FVZ A;  4HCW A;  3RPL B;  5DW8 A;  4GWZ A;  4NF0 A;  1LBW A;  3T1B A;  3FBP A;  5A5L A;  2PFZ A;  4P47 A;  5JK4 A;  4PF8 A;  4HXV A;  4OA4 A;  3IFA A;  4GX4 A;  1JP4 A;  4PFI A;  4N4U A;  2ZZV A;  2DE3 A;  2KR0 A;  2XXK A;  3B8B A;  1KA1 A;  2WX9 A;  1K9Z A;  4PBH A;  5EQA A;  1FPK A;  2V3Q A;  4FBP A;  1IMB A;  5ET5 A;  1NUX A;  1IMD A;  4N15 A;  1YYZ A;  1VDW A;  3B50 A;  2CZH A;  2VPN A;  1IMF A;  2F3B A;  4PAF A;  2PFY A;  5I7I A;  4X04 A;  2HPG A;  4GBW A;  4N8Y A;  5J16 A;  4PC9 A;  4X8R A;  4LN5 A;  5IZZ A;  2QFL A;  4HCY A;  4DI3 D;  5ET6 A;  1DBZ A;  1QGX A;  2CZK A;  4MNC A;  4PET A;  2XWI A;  4MMP A;  4OVT A;  4H45 A;  4NX1 A;  4N8G A;  1FPE A;  3BIG A;  4P1E A;  2QPQ A;  1FJ9 A;  3E78 A;  2R8T A;  4OVR A;  1FBC A;  2XWK A;  4NAP A;  3T0J A;  5ET7 A;  3IFC A;  1FPI A;  2FIX A;  3D1R A;  4PGN A;  1LBZ A;  4MNI A;  4PFR A;  4F1U A;  1FBD A;  2HXR A;  2HZK A;  4NG7 A;  4MEV A;  2KQZ A;  4MNP A;  2Q8M A;  4JVI A;  5ESY A;  4QBA A;  4HE1 A;  1IMC A;  1FBP A;  1FPB A;  4OVP A;  4O8M A;  4JVD A;  2HHM A;  4YIC A;  2OX3 A;  5F24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...