5EYHA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+ at ph 7.0
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eyhA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eyhA02
1EYIA 4HXVA 2Y5LA 5A5LA 1YXIA 1FSAA 4GX6A 5FBPA 2JJKA 4FBPA 3A29A 1IMBA 4PTKA 5ET6A 4GWWA 1K9YA 2GQ1A 2WBBA 2OWZA 4I3EA 1DBZA 1YYZA 4GX3A 1LBXA 2VT5A 4I40A 2P3NA 2Q74A 4GWYA 1NV2A 3IFAA 5EYGA 1FTAA 5ESYA 4QXDA 1LBZA 2CZKA 1FPGA 2QFLA 4HE2A 2HHMA 1JP4A 5ET5A 1NV7A 1FBCA 3T0JA 1XI6A 5EQ7A 1BK4A 1FPDA 2FVZA 2FIEA 2Q8MA 1EYKA 4H46A 4N81A 5EQAA 2DDKA 2F3BA 4I3YA 4KXPA 4GBVA 5ET8A 1RDYA 2F3DA 1IMFA 1FPJA 1KA1A 1FBEA 4O7IA 5IZ3B 1KZ8A 2QVUA 2FBPA 1FPKA 4G61A 1IMEA 3KC0A 2FHYA 2P3VA 1G0HA 1FBFA 5F24A 2CZIA 3KBZA 5DW8A 1INPA 5EYHA 3QMFA 3ROJA 1FPIA 2R8TA 4GWUA 3RYDA 1Q9DA 3KC1A 1YZ0A 3LV0A 1NUWA 3BIHA 3BIGA 1FBDA 2WBDA 1NUXA 1QGXA 5EQ9A 2PCRA 1IMCA 3IFCA 1FRPA 1FPLA 5EQ8A 1EYJA 3RPLA 1G0IA 4IR8A 1IMDA 2OX3A 3B8BA 5IZ1A 1DCUA 1NUYA 4AS4A 1CNQA 4AS5A 1NV5A 1LBVA 1RDZA 2FIXA 2WEFA 1NV4A 1SPIA 1KA0A 1NUZA 5T3JA 3RPLB 2QVVA 1NI9A 4HE0A 1LEVA 4GWSA 4H45A 1AWBA 3LUZA 1NV1A 1VDWA 1FPEA 1FJ9A 1FBPA 1IMAA 3D1RA 4MJOA 5I3SA 1DK4A 1K9ZA 3FBPA 1FPFA 1RDXA 2QVRA 4HE1A 4GWZA 1FBGA 5LDZA 1NV0A 1LBWA 1LBYA 2CZHA 4GBWA 5ET7A 5IZ3A 1FPBA 2BJIA 1FJ6A 2Y5KA 1D9QA 1FBHA 1NV6A 4GWXA 4GX4A 1NV3A 5J16A
chains in the Genus database with same CATH superfamily
4TLMB 2B65A 4JVDA 2Y5LA 3SZPA 2ESNA 3BKIB 5I84A 4Z7EA 2Q89A 4FATA 4IY5A 2H5YA 1RYOA 1JW4A 3TTLA 4N17A 4MIJA 2DE3A 4GWYA 4GXSB 2KLFA 4IY6A 4PFTA 3KBRA 2CZKA 4OVRA 3N6TA 2PFYA 1FQDA 1AIVA 1Z7ME 4GLIA 4YAHX 4KCDA 4G68C 1MQGA 3OSQA 1MH4A 3UGWA 1CB6A 1MH3A 1UTBA 1XVXA 2DDKA 3TAJA 3TKDA 2PBWA 1FPJA 1MPDA 1PEBA 4H8IA 4N8YA 1QVSA 5AA4B 1Y20A 2RF1A 2W7YA 1MY0A 4GQOA 2WX9A 4IO6A 1FPIA 2NXOA 4NHBA 3C33A 4IGRA 4N91A 3V89B 3B50A 1M5CA 1FPLA 3TZAA 1EYJA 4H67A 4RY1A 5CM6A 4K3FA 1M5BA 1GTKA 1MXWA 4ESXA 4N15A 1P99A 5DEXB 3T9UA 2HEUA 4RPNA 1OVTA 3R7XA 3B7DA 2UVGA 1T0KA 2HZLA 3ZKLA 4LA9A 3BFTA 1F9BA 2H98A 2XD3A 3VDFA 1Q1KA 4DDDA 5H8QA 5IGAA 1HSJA 3OSRA 5DTBA 4BDOA 3U92A 5EHMA 4IO4A 5ISUA 1FPFA 3GBAA 3MC2A 1H43A 3TEPA 3N5LA 1ZJLA 1SW5A 3RQTA 3S2VA 1B7UA 2V93A 4LP2B 1XS5A 2F78A 3TPAA 4PTKA 3G3FA 5ET6A 2WYKA 4KPTA 4GWWA 1K9YA 3MYUA 4DCYA 3FVNA 3C34A 2P1SA 2V3UA 2O6AA 4KQPA 4IB2A 1MPCA 3DM0A 4EQ7A 4IO2A 3CVGA 2GHBA 3Q27A 5ET5A 4PFYA 2FYIA 4IGTA 2P0SA 1YAEA 1JW5A 1URSA 1B52A 3MW0A 5ET8A 4Z0IA 4ZDMA 4JB7A 5JTYA 5AA4A 2WYPA 3IX1A 3IB0A 4IO5A 1DPEA 4ZE8A 4P9KA 1AOVA 4QSDA 4XKRA 4HCYA 3L6HA 3ILTB 3IORA 2CEXA 2R8TA 3RYDA 3LV0A 5CBRA 1GR2A 4IR8A 4X8RA 1B4ZA 1DCUA 5J1DA 4OMBA 5L9MA 4F1UA 1US5A 4OA4A 1QULA 4GWSA 3Q28A 1SI0A 1VDWA 5CC2A 1XVYA 2FNCA 3RGYA 5I3SA 2NUVA 1B3HA 3RPWA 3E79A 3CFXA 2O1MA 4PFRA 1FPBA 1B51A 1FBHA 5JTYB 5I5PA 4Q5TA 1PB7A 1YXIA 3TUSA 3G3KA 1N04A 4LUBA 3HPIA 3C32A 4N4UA 2XXKA 4KHZE 2DSFA 2DE4A 4YKIA 1JVXA 4KFQA 3IL1B 4I8CA 4QHQA 3S9EA 2QPQA 4MBPA 4NG7A 1FTAA 1LFIA 4U23A 1XC1A 5B70A 2ZYNA 1R6ZA 1Y1MA 3T0JA 1PC3A 2QS3A 4PC9A 5I7IA 1TFDA 1H76A 5I57A 4DIGA 1O64A 1ZMGA 4F3SA 4I3YA 1MQHA 4LQ2A 2L5VA 2P3VA 1IXIA 4P0IA 2XWVA 4FECA 1H44A 2F7AA 2OCUA 1Q9DA 4Q30B 4GWOA 3RNNA 5H8QB 4HTGA 4UA8A 3IFCA 3MAMA 4N13A 2UYEA 3ISPA 2ZZVA 4TOZA 5DEXA 1MRPA 3OEKA 4EF2A 2QMWA 3AXFA 3K6UA 2UVHA 1R1NA 5K2YA 3GLBA 3OELA 3T96B 1AWBA 4PFUA 1B3FA 3SETA 3K2DA 3HN0A 4ZZAA 2B3BA 1QJMA 1IEJA 5KCJA 5IM2A 2DXYA 4YU0A 4R75A 3KZGA 1TT1A 1QW0A 1UTBB 4KD5A 3A29A 2Q2CA 4N07A 4DLDA 2X7QA 3F11A 5IKBA 3LSXA 1DBZA 3I6VA 4U21A 1SYHA 4X48A 5K2XA 2DWAA 5EYGA 2HQ0A 2H9BA 4NF4A 3E9XA 5F7VA 1FCKA 3U65A 2F7BA 2XX9A 5H8NA 3VVFA 2Q8MA 4H46A 1JEVA 4OFOA 3EF7A 2GFEA 4NF5A 3D4GA 1UQWA 2O1LA 1DSNA 2YPNA 3R26A 5DW8A 2XX8A 1B5HA 5I58B 4PE3A 4OVJA 1YPNA 2XWKA 1NUWA 2Y7RA 3MVYA 4ZEKA 2D21A 4O3BA 5TPAB 4X9TA 5FHNA 2I3WA 3IK6B 1MXXA 1CNQA 4OQOA 4BDMA 4U22A 2BJJX 2B4MA 3VV5A 1QUJA 1B2HA 1LEVA 4KYEA 5LOMA 5CRYA 1BKAA 4LZ7A 3PPPA 2HAUA 3BBRA 1K9ZA 4P1LA 1S7YA 3EHSA 2H99A 4F1YA 1ZKBA 4AB6A 2YLNA 4F1VA 1Y3NA 1P1UA 1IZ1A 2DWIA 1NV6A 4M4GA 3CSGA 3FV1A 4O7MA 1B4HA 5ICTA 5FBPA 1LAXA 4X1BA 1MDQA 4I3EA 1LBXA 2F34A 3DELB 2XXQA 4E0XA 4F29A 4OVTA 1EZOA 3K6XA 4Q0CA 3H06B 2F36A 2PYYA 4JVCA 4O3AA 4YMAA 4ZZEA 4ZEIA 1XI6A 4RK9A 3K4UA 4OYVA 2F3BA 1IITA 5I56B 3KSXA 4O3CA 2XXWA 2AYSA 3BFUA 3QAXA 2IEEA 2OWTA 4P11A 4JDFA 1AMFA 4AB5A 3MVXA 3QMFA 3Q29A 3O6GA 5JEIA 3KN3A 4R9FA 1P1OA 3VLVA 1LAFE 4QF9A 4FE8A 4MNPA 3UORA 3ODBA 5EYFA 1MXYA 2OX3A 1B0HA 2O51A 1NUYA 4BDNA 3QSLA 5I2KB 2F35A 3FXBA 4PBHA 1SPIA 1LSTA 1PBPA 5HPQA 3MBPA 1MXVA 4C1UA 4QFOA 1JVYA 4H45A 3RT8A 2ZZXA 3W9VA 5ICQA 2O69A 3D1RA 4MJOA 5L8DA 1JETA 1M5FA 2Z8DA 4N8GA 3FXUA 1TFAA 2G93A 4YB6A 1D9QA 2REJA 4ZS9A 1LGBC 3O2AA 4HXVA 4F19A 1POY1 3FXRA 1B40A 4ELPA 1EZ9A 4QFLA 4LQ5A 3HSTA 4FJPA 2I3VA 3FJ7A 3UA8A 1DTGA 2OWZA 4JSDA 4I9DA 3VLWA 4POWA 1NV2A 2Y7KA 1TWYA 2XXIA 1FQCA 1UIVA 3JV9A 1NNPA 2VGQA 4ZEFA 1UIUA 3KOSA 1NV7A 3H7MA 4PDHA 3VLUA 3G3IA 2M8CA 3N94A 1SVXB 2OPEA 3ILUB 5AA1A 3OO6A 2E1SA 4C0RA 5KDTA 1LFHA 5AA3A 1A55A 4GBVA 4OXVA 1N7XA 1IIWA 2HZKA 1B32A 3ECRA 2AL4A 1Y3QA 4JWYA 3BIGA 1FBDA 3M3KA 3T22A 1PDAA 3TDJA 1HSLA 2Q88A 3PPOA 3OO8A 3K6WA 2I49A 3EN3A 3UP9A 3PPNA 1KA0A 3PMXA 3OEMA 3C35A 4KYSA 3FVGA 2LAOA 3KN8A 4BDQA 3KGCA 3VXBA 3TCHA 4P1EA 3QXMA 4OEUA 4GBWA 2DYXA 4OERA 5IZ3A 2XHDA 3H6VA 4GX4A 1R9QA 3KOTA 4M1VA 1A40A 4GX6A 3LUYA 1WDNA 3U94A 1MQDA 1NH8A 4GOTA 2I4CA 2OWSA 2Q9TA 1KWHA 1P1NA 3TFLA 1SI1A 1P1QA 1FTOA 2H25A 4R6KA 3T93B 1B5JA 3H3GA 5ESYA 3GXAA 4PE5B 1NL5A 3IOWA 1XHYA 3JYRA 2RC9A 1A8FA 4QSCA 3S9NC 4XFEA 4KCCA 1SW1A 2VHAA 4NQ8A 2XXYA 2QVUA 1MXUA 3FJGA 1OIBA 5EYHA 3KEIA 3MQ9A 3KC1A 4KR5A 3BIHA 2WBDA 3SEXA 5EHSA 5H8HB 2RC8A 3FGSA 3B8BA 2GHAA 2QRYA 2FIXA 1O63A 3PMWA 4JWXA 3OO9A 1NUZA 5BUUA 2QVVA 3EPEA 4F3PA 3SKPA 1FQFA 1NKXA 2DVCA 3O28A 4GRKA 1FPEA 1LB8A 3V8XB 3SEWA 4G68A 2VOZA 3OO7A 1VSOA 5LDZA 3LSLA 1FJ6A 5DYHA 3TODA 5TP9B 4ELQA 3FASA 3O29A 4ZEBA 2ZXTA 1EH3A 4XF5A 3FV2A 3V5AA 3PD9A 4R73A 4ND9A 5DVFA 3IR1A 2ONSA 1SW2A 3CHGA 1OQGA 5IZZA 1FPGA 4P47A 3IB2A 5I59B 3S4UA 3CSBA 4MX6A 5ITOA 3QUJA 2I6EA 1FPDA 2NOOA 4N81A 4EQBA 2UVJA 1RDYA 2F7CA 1PBQA 1IMFA 1WVJA 1GGGA 2R9JA 4ELOA 1LCFA 2QMXA 3TTNA 4GWUA 3TCGA 4DI3D 1ATGA 1NMUA 1I6AA 3RPLA 1FW0A 3Q26A 2XA5A 2XX7A 1M5EA 5F1QA 1UTHB 3H6WA 1D9VA 4DXUA 5B7DA 4PAFA 4EXKA 1FTLA 2DVZA 2Q8JA 5A5XB 2PT1A 4RPOA 2ZZWA 5I2NB 1DK4A 4G2ZA 3GYYA 2HPGA 1RKMA 3RTWB 1Y9UA 3FVKA 1EYIA 1I69A 1FSAA 3ONMA 2JJKA 4N6KA 4NF6A 2F97A 4JXIA 1IMBA 2OZZA 1QKAA 4I62A 1JW1A 4LATA 1OVBA 5TU0A 4F18A 3G3HA 3FD3A 4G8HA 1MY2A 4NWDA 4NF8A 1JNFA 4Q8RA 1ANFA 1MPBA 3CIJA 2MKZA 3HFUA 1SBPA 3S9LC 3IOTA 4DXCA 1FBCA 4R2FA 2XXHA 3SDFA 5EQAA 1URDA 2VP1A 2XWIA 4PAKA 4EF1A 5AA2A 3KG2A 2XXXA 2D5WA 3DLNA 1L5TA 1FPKA 4H8JA 3O6HA 3C4MA 3VVDA 3VVEA 1IMEA 2QS1A 4F3GA 1YCJA 3O9PA 2HAVA 4QFKA 5CMMA 1VR5A 3MUQA 4MAGA 1QGXA 2H4IA 3U72A 1VFEA 2XD2A 3PUVE 4R2BA 4JSOA 5IZ1A 2B4LA 3A3CA 2CEYA 4G4PA 1N0TA 2UXAA 2B3FA 1NV5A 1RDZA 2WEFA 3NOHA 2UYFA 3A3UA 1B0LA 4WEDA 4QBAA 2GH9A 2F6GA 3FZVA 4ISUA 3U8QA 2RINA 3I5OA 3Q25A 1NNFA 3CRBA 3U93A 4YB7A 1BTJA 1BIYA 1RYXA 4OTEA 1WODA 1AH5A 1B05A 5J16A 1O7TA 4YKJA 4QFNA 4RK2A 3E78A 2QL3A 2QS2A 3TTMA 1SQYA 3P7IA 1MY3A 2RC7A 1FQEA 3M3FA 1MDP1 4PQJA 2NWJA 3VFJA 1OQHA 4FEBA 3TYHA 3THIA 1N84A 3OMBA 1J1NA 2VT5A 2Q2AA 4UACA 3SEUA 4R74A 2ONRA 2KR0A 3CR9A 3ZKKA 4YZZA 2DS9A 1FTKA 4WXJA 4NEDA 4UABA 3MP1A 4F2OA 2A5TA 1N3WA 2ZMBA 4RYAA 5EQ7A 3IB1A 4X1DA 4MFIA 1A99A 4IO7A 4PCDA 3DP4A 3ZS6A 3B6WA 3TQLA 4YKPA 3FVOA 5AA2B 4ECFA 2REGA 2HXRA 4WKMA 3O6IA 1B3GA 1USYE 1PB8A 2RCAA 5H8FA 3FATA 4LN5A 1EZPA 3D4CA 3T9HB 2VD2A 1IXGA 2Y7PA 3B6TA 2E0SA 2XXUA 2O68A 4GVOA 1LCTA 4OENA 1LFGA 3TTRA 4MLQA 4U1ZA 3N6UA 3PUWE 5H8FB 3QYTA 2GRVA 4U2RA 1LB9A 5CI5A 3LSWA 3K1MA 2QVRA 1BLFA 2V25A 5CMBA 5ET7A 1OLCA 4JWOA 5H8SA 5BWJA 1LAGE 4H65A 4JBZA 4P56A 4G77A 3ZSFA 2A5TB 4NX1A 5A5XA 2GQ1A 2I0CA 4ELRA 2KQZA 3VE1B 3FUZA 4PFWA 4O8MA 3KJTA 1B9JA 4PP0A 5IAIA 1SD3A 3PTYA 3QUFA 2RKMA 5FHOA 1XOCA 3CG3A 3PPRA 3FIRA 3MVZA 4NE4A 4RNSA 1QUKA 1KA1A 3T1BA 2Y84A 5CMCA 3RLFE 3KC0A 1B6HA 4NWCA 2FHYA 3RN8A 3ROJA 3KFMA 1N3XA 3A09A 4PETA 2PT2A 3RUMA 2Z22A 2V4CA 2V3TA 5I59A 2PMSA 2ZNTA 1Y3PA 1MS7A 2ALUA 3EKIA 2X7PA 4R6HA 3H6TA 1M5DA 2O7IA 4X04A 4HW8A 3DP8A 2I58A 4MEVA 2DP8A 3RT6B 2UVIA 2NVUB 2YJPA 2AL5A 3FBPA 4YKKA 4BDRA 5L9OA 4WEPA 5DVIA 4DI4B 5T3JA 5AA2D 3MWBA 4G68B 4MCOA 2VPNA 4H1XA 3E4RA 4DE8A 4PBQA 3HHFA 3QIMA 3FXQA 2WBBA 5M2VA 4F2QA 4NMYA 3K1PA 1B1HA 1YTVA 3S9MC 1URGA 1VE4A 3IFAA 2V84A 3OXNA 1LBZA 4NF8B 3WAEA 2HHMA 1MG1A 2Z8EA 3KN7A 3M3LA 4PFBA 4XXUA 2XXVA 3G7WA 1IUDA 4PAIA 4OHNA 4PDDA 3T9VA 4NF6B 4OWDA 1EYKA 1LLSA 1NFTA 4HCWA 3CFLA 4OFLA 1HSEA 1N76A 3IOUA 1FQAA 1FBEA 4FORA 1QUIA 1EU8A 4G61A 1IXHA 1B3LA 1Y4CA 5F24A 1DMBA 1QKBA 1US4A 2DWHA 2OLBA 2PVUA 4NF0A 2RCBA 1ZTYA 5I2NA 4MNCA 4OVPA 2HCAA 4P0GA 3MPLA 2I4BA 3K1NA 1G0IA 2OBGA 4PFIA 1UTHA 3C31A 5FTIA 3CI8A 4GFRA 3R6UA 3RPLB 3W15C 3EHUA 4GXAA 3LUZA 4GL8A 4DCXA 5AE4A 2XXRA 4MH5A 1MY1A 4DZ1A 3IJXB 2CMOA 3MP8A 4GWZA 1LBBA 1LBWA 2CZLA 2Y5KA 1NNKA 3U1OA 3PUXE 1B3EA 3I3VA 1OMPA 3PMVA 4TLLB 4XEQA 3RTFB 1ELJA 1YYZA 4GX3A 3K0VA 4THIA 5CBSA 2ABHA 5CMKA 2QFLA 1VFDA 1JP4A 4FAJA 4H0WA 1ZLQA 4XKPA 3TQWA 1MQIA 2FVZA 2FA7A 2XWOA 1B7HA 3HO7A 2F3DA 1FTJA 5TP9A 1GVCA 3HHGA 1MM6A 2OJTA 4OFJA 3KJ7A 2OK2A 2G29A 2ZNUA 2D3IA 4I1DA 4R6YA 1TXFA 2R71A 3KSJA 3H6UA 2F5XA 1ZBMA 3PUZE 1A8EA 4H6DA 1YZ0A 1I6BA 4U1OA 2AIXA 1IMCA 5EQ8A 1IMDA 5KZTA 3IO6A 4XTCQ 3IAZA 3IOVA 4F31B 2DE2A 4AS4A 4G8MA 1LBVA 2Y7IA 1XT8A 1D4NA 1MXZA 3GBBA 1CE2A 4P3LA 5H8HA 4HE0A 4IO3A 4EXLA 3HCQA 3OOAA 4GL0A 4G8NA 5JK4A 4MLVA 4QFPA 1B5IA 1RDXA 1FBGA 1NV0A 4OANA 4YB5A 2CZHA 2F8DA 1I6QA 2R6GE 5A5LA 1R9LA 3HV1A 1B58A 1BP5A 4MHFA 3LR1A 4RJZA 3MVWA 1B46A 4FBPA 3C9HA 3E13X 1Y1ZA 4OVSA 1AL3A 4OESA 2I0BA 3SEVA 4O94A 3PPQA 5I2KA 1SW4A 3RY3A 3JZJA 4QXDA 1FTMA 3H4ZA 4U4XA 4DXBA 1ZU0A 3K6VA 3FJMA 4LONB 4AQ4A 4NTLA 4EDPA 5DVJA 4JVIA 4BLAA 2QS4A 1NNTA 3MZ1A 5IZ3B 1G0HA 1B1XA 2CZIA 1INPA 1USYH 4MMPA 3O97A 3VXCA 5EQ9A 3DP6A 4EUOA 2PCRA 3MZ9A 4OVQA 4ESWA 4RA1A 3K00A 1Z7NE 2ZYOA 5ELVA 4AS5A 3T9XB 3WAFA 1NV4A 1MQJA 1ZIUA 2VPOA 2VD3A 4GF8A 3T66A 4F3BA 4ZEDA 1A54A 3MSTA 2V3QA 3TELA 1IMAA 1NH7A 4R72A 2P2AA 1DPPA 1SYIA 3K01A 2HXWA 1H45A 5HM4B 3MZBA 3LBSA 1II5A 1JQFA 3USDA 4E0WA 3SERA 3CG1A 5KDTB 1GV8A 2QJEA 2PFZA 4RXLA 3MPKA 2DOJA 3TTKA 3O66A 3N26A 2DQVA 2P3NA 1N7WA 4ONYA 3TMGA 4ZE9A 4XIGQ 3EHTA 4OZ9A 4OEVA 5ITPA 1Q35A 4PGNA 3UN6A 1JEUA 4HE2A 5L9SA 2Y7WA 2ZYMA 2Z23A 3MP6A 3CFZA 1BK4A 1IXCA 2ZNSA 1B7ZA 3EQ1A 3G3JA 3H03A 2OPDA 1Y4TA 3G3GA 5FTHA 3V83A 4O7IA 1FBFA 4TQUQ 4BDLA 2IA4A 4LZ5A 1DOTA 4YICA 4NN3A 1PB9A 5H8NB 1S9TA 2X26A 3L6GA 1FRPA 3K02A 2XXPA 4NF4B 5LTCA 3IO4A 4MNIA 4C1TA 1H3DA 3PUYE 4POXA 4R9GA 4XKQA 5HBCA 1NV1A 4EQ9A 3QK6A 1SDXA 1FJ9A 1FBPA 3SESA 1MM7A 1MY4A 3M8UA 2I48A 4FIMA 4HE1A 4N6DA 2ZYKA 3UK4A 1LBYA 3IJOB 5DT6A 5KCJB 4GWXA 1NV3A 5I56A 4F39A 4QSEA 2ANJA 4PF6A 1LAHE 1S50A 4GIZA 3SEYA 3UIFA 3E3KA 4PF8A 4H5FA 4I40A 1D9YA 2Q74A 1A7LA 2PX1A 4KYDA 3LC8A 4LVQA 4P8BA 2O7UA 3OENA 3OD7A 3LSFB 4LZ8A 5FHMA 4XKNA 1D3KA 3MJNA 2FIEA 4U4SA 2QSXA 2O84X 4KXPA 3W9WA 3C36A 4F22A 4H5GA 1KZ8A 4N6PA 2FBPA 2ONKE 4YMBA 3KBZA 4FEDA 5I57B 2HFBA 4QRZA 1P1WA 2Z8FA 1NUXA 3PD8A 1OLAA 4KI0E 4PGPA 2A5SA 3B6QA 4NGUA 2WKYA 4MF3A 4GD5A 4L17A 1POTA 3PGFA 1NI9A 2DXRA 5TPAA 3GZGA 4NAPA 2THIA 1FQBA 3TCFA 1DTZA 1LBCA 5I58A 4ZECA 2XXTA 4HS7A 3PU5A 1IQ7A 2BJIA 2DWJA 4OETA 3PV0E 2F6PA 4NF5B
chains in the Genus database with same CATH topology
1EYIA 4HXVA 2Y5LA 5A5LA 4JVDA 4O7MA 1YXIA 1FSAA 4GX6A 3SZPA 4F19A 4PF6A 5FBPA 3E78A 4XF5A 2JJKA 4N6KA 4MHFA 4XEQA 4MCOA 2VPNA 4FBPA 2PFZA 3A29A 1IMBA 4N4UA 4PTKA 4P56A 2XXKA 4OVSA 5ET6A 2WYKA 4PBQA 2DE4A 4GWWA 4NX1A 4PF8A 4F18A 1K9YA 2GQ1A 2WBBA 4N17A 2OWZA 2Q9TA 4I3EA 3MYUA 2KQZA 4MIJA 4O94A 1DBZA 1YYZA 4GX3A 2DE3A 1LBXA 2VT5A 4I40A 2P3NA 2Q74A 2QPQA 4GWYA 2KR0A 4O8MA 1NV2A 4YZZA 3IFAA 3CHGA 4NG7A 4P8BA 5EYGA 1FTAA 2MKZA 5ESYA 3HFUA 4OVTA 5IZZA 4QXDA 4PGNA 1LBZA 2CZKA 4OVRA 1FPGA 2PFYA 4JVCA 4P47A 3PTYA 2QFLA 4HE2A 2HHMA 1JP4A 5ET5A 4UABA 4PFBA 1NV7A 4PDHA 4PAIA 4MX6A 1FBCA 3T0JA 1XI6A 5I7IA 4PC9A 5EQ7A 3U65A 1BK4A 4PDDA 1FPDA 2FVZA 2FIEA 2Q8MA 1EYKA 4H46A 4N81A 4HCWA 2XWOA 5EQAA 2DDKA 2F3BA 2XWIA 4PAKA 4I3YA 4KXPA 4GBVA 5ET8A 4JVIA 1RDYA 2F3DA 4XFEA 3W9WA 4PCDA 1IMFA 1FPJA 1KA1A 1FBEA 4N8YA 2WYPA 4O7IA 4NQ8A 3T1BA 5IZ3B 1KZ8A 2QVUA 2FBPA 1FPKA 4G61A 1IMEA 3KC0A 2L5VA 4P9KA 2FHYA 2P3VA 1G0HA 1FBFA 5F24A 2CZIA 4HCYA 3KBZA 2HZKA 5DW8A 1INPA 2XWVA 5EYHA 3QMFA 2HXRA 4NF0A 2WX9A 4MMPA 4YICA 3ROJA 5I5PA 2F5XA 2CEXA 4NN3A 1FPIA 2R8TA 4MNCA 4GWUA 3RYDA 1Q9DA 3KC1A 1YZ0A 2XWKA 4PE3A 3LV0A 1NUWA 4NHBA 4DI3D 3BIHA 3BIGA 1FBDA 2WBDA 4MAGA 4OVPA 1NUXA 4PETA 4N91A 1QGXA 4M1VA 5EQ9A 2V4CA 2PCRA 3B50A 1IMCA 3IFCA 4LN5A 1FRPA 4MNPA 1FPLA 4OVQA 4X9TA 5EQ8A 1EYJA 3RPLA 1G0IA 4IR8A 2XA5A 1IMDA 3EKIA 3ISPA 4PGPA 4X8RA 5CM6A 2OX3A 3B8BA 5IZ1A 2B4LA 1DCUA 1NUYA 4AS4A 2CEYA 2DE2A 2ZZVA 1CNQA 4AS5A 4N15A 4PFIA 4X04A 5J1DA 5LTCA 1NV5A 1LBVA 1RDZA 2FIXA 2WEFA 3FXBA 3NOHA 1NV4A 1SPIA 2VPOA 4MNIA 4PAFA 4PBHA 4F1UA 2B4MA 1KA0A 1NUZA 5T3JA 4P3LA 2HZLA 3RPLB 2QVVA 4MEVA 1NI9A 4HE0A 1LEVA 4OA4A 4QBAA 4GWSA 2DVZA 4H45A 4NAPA 1AWBA 3LUZA 1NV1A 5IGAA 1VDWA 2ZZXA 3W9VA 1FPEA 1FJ9A 3MSTA 2ZZWA 1FBPA 2V3QA 1IMAA 3D1RA 4MJOA 5I3SA 1DK4A 3GYYA 4P1EA 2HPGA 1K9ZA 4P1LA 5JK4A 3FBPA 1FPFA 1RDXA 2QVRA 3E79A 4HE1A 4GWZA 1FBGA 5LDZA 1NV0A 4N6DA 4NGUA 4OANA 1LBWA 1LBYA 2CZHA 4GBWA 5ET7A 4N8GA 5IM2A 4F1VA 4PFRA 4DI4B 5IZ3A 1FPBA 2BJIA 1FJ6A 2Y5KA 1D9QA 1FBHA 1NV6A 4GWXA 4GX4A 1NV3A 5J16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYI A;  4HXV A;  2Y5L A;  5A5L A;  1YXI A;  1FSA A;  4GX6 A;  5FBP A;  2JJK A;  4FBP A;  3A29 A;  1IMB A;  4PTK A;  5ET6 A;  4GWW A;  1K9Y A;  2GQ1 A;  2WBB A;  2OWZ A;  4I3E A;  1DBZ A;  1YYZ A;  4GX3 A;  1LBX A;  2VT5 A;  4I40 A;  2P3N A;  2Q74 A;  4GWY A;  1NV2 A;  3IFA A;  5EYG A;  1FTA A;  5ESY A;  4QXD A;  1LBZ A;  2CZK A;  1FPG A;  2QFL A;  4HE2 A;  2HHM A;  1JP4 A;  5ET5 A;  1NV7 A;  1FBC A;  3T0J A;  1XI6 A;  5EQ7 A;  1BK4 A;  1FPD A;  2FVZ A;  2FIE A;  2Q8M A;  1EYK A;  4H46 A;  4N81 A;  5EQA A;  2DDK A;  2F3B A;  4I3Y A;  4KXP A;  4GBV A;  5ET8 A;  1RDY A;  2F3D A;  1IMF A;  1FPJ A;  1KA1 A;  1FBE A;  4O7I A;  5IZ3 B;  1KZ8 A;  2QVU A;  2FBP A;  1FPK A;  4G61 A;  1IME A;  3KC0 A;  2FHY A;  2P3V A;  1G0H A;  1FBF A;  5F24 A;  2CZI A;  3KBZ A;  5DW8 A;  1INP A;  5EYH A;  3QMF A;  3ROJ A;  1FPI A;  2R8T A;  4GWU A;  3RYD A;  1Q9D A;  3KC1 A;  1YZ0 A;  3LV0 A;  1NUW A;  3BIH A;  3BIG A;  1FBD A;  2WBD A;  1NUX A;  1QGX A;  5EQ9 A;  2PCR A;  1IMC A;  3IFC A;  1FRP A;  1FPL A;  5EQ8 A;  1EYJ A;  3RPL A;  1G0I A;  4IR8 A;  1IMD A;  2OX3 A;  3B8B A;  5IZ1 A;  1DCU A;  1NUY A;  4AS4 A;  1CNQ A;  4AS5 A;  1NV5 A;  1LBV A;  1RDZ A;  2FIX A;  2WEF A;  1NV4 A;  1SPI A;  1KA0 A;  1NUZ A;  5T3J A;  3RPL B;  2QVV A;  1NI9 A;  4HE0 A;  1LEV A;  4GWS A;  4H45 A;  1AWB A;  3LUZ A;  1NV1 A;  1VDW A;  1FPE A;  1FJ9 A;  1FBP A;  1IMA A;  3D1R A;  4MJO A;  5I3S A;  1DK4 A;  1K9Z A;  3FBP A;  1FPF A;  1RDX A;  2QVR A;  4HE1 A;  4GWZ A;  1FBG A;  5LDZ A;  1NV0 A;  1LBW A;  1LBY A;  2CZH A;  4GBW A;  5ET7 A;  5IZ3 A;  1FPB A;  2BJI A;  1FJ6 A;  2Y5K A;  1D9Q A;  1FBH A;  1NV6 A;  4GWX A;  4GX4 A;  1NV3 A;  5J16 A; 
#chains in the Genus database with same CATH topology
 4TLM B;  2B65 A;  4JVD A;  2Y5L A;  3SZP A;  2ESN A;  3BKI B;  5I84 A;  4Z7E A;  2Q89 A;  4FAT A;  4IY5 A;  2H5Y A;  1RYO A;  1JW4 A;  3TTL A;  4N17 A;  4MIJ A;  2DE3 A;  4GWY A;  4GXS B;  2KLF A;  4IY6 A;  4PFT A;  3KBR A;  2CZK A;  4OVR A;  3N6T A;  2PFY A;  1FQD A;  1AIV A;  1Z7M E;  4GLI A;  4YAH X;  4KCD A;  4G68 C;  1MQG A;  3OSQ A;  1MH4 A;  3UGW A;  1CB6 A;  1MH3 A;  1UTB A;  1XVX A;  2DDK A;  3TAJ A;  3TKD A;  2PBW A;  1FPJ A;  1MPD A;  1PEB A;  4H8I A;  4N8Y A;  1QVS A;  5AA4 B;  1Y20 A;  2RF1 A;  2W7Y A;  1MY0 A;  4GQO A;  2WX9 A;  4IO6 A;  1FPI A;  2NXO A;  4NHB A;  3C33 A;  4IGR A;  4N91 A;  3V89 B;  3B50 A;  1M5C A;  1FPL A;  3TZA A;  1EYJ A;  4H67 A;  4RY1 A;  5CM6 A;  4K3F A;  1M5B A;  1GTK A;  1MXW A;  4ESX A;  4N15 A;  1P99 A;  5DEX B;  3T9U A;  2HEU A;  4RPN A;  1OVT A;  3R7X A;  3B7D A;  2UVG A;  1T0K A;  2HZL A;  3ZKL A;  4LA9 A;  3BFT A;  1F9B A;  2H98 A;  2XD3 A;  3VDF A;  1Q1K A;  4DDD A;  5H8Q A;  5IGA A;  1HSJ A;  3OSR A;  5DTB A;  4BDO A;  3U92 A;  5EHM A;  4IO4 A;  5ISU A;  1FPF A;  3GBA A;  3MC2 A;  1H43 A;  3TEP A;  3N5L A;  1ZJL A;  1SW5 A;  3RQT A;  3S2V A;  1B7U A;  2V93 A;  4LP2 B;  1XS5 A;  2F78 A;  3TPA A;  4PTK A;  3G3F A;  5ET6 A;  2WYK A;  4KPT A;  4GWW A;  1K9Y A;  3MYU A;  4DCY A;  3FVN A;  3C34 A;  2P1S A;  2V3U A;  2O6A A;  4KQP A;  4IB2 A;  1MPC A;  3DM0 A;  4EQ7 A;  4IO2 A;  3CVG A;  2GHB A;  3Q27 A;  5ET5 A;  4PFY A;  2FYI A;  4IGT A;  2P0S A;  1YAE A;  1JW5 A;  1URS A;  1B52 A;  3MW0 A;  5ET8 A;  4Z0I A;  4ZDM A;  4JB7 A;  5JTY A;  5AA4 A;  2WYP A;  3IX1 A;  3IB0 A;  4IO5 A;  1DPE A;  4ZE8 A;  4P9K A;  1AOV A;  4QSD A;  4XKR A;  4HCY A;  3L6H A;  3ILT B;  3IOR A;  2CEX A;  2R8T A;  3RYD A;  3LV0 A;  5CBR A;  1GR2 A;  4IR8 A;  4X8R A;  1B4Z A;  1DCU A;  5J1D A;  4OMB A;  5L9M A;  4F1U A;  1US5 A;  4OA4 A;  1QUL A;  4GWS A;  3Q28 A;  1SI0 A;  1VDW A;  5CC2 A;  1XVY A;  2FNC A;  3RGY A;  5I3S A;  2NUV A;  1B3H A;  3RPW A;  3E79 A;  3CFX A;  2O1M A;  4PFR A;  1FPB A;  1B51 A;  1FBH A;  5JTY B;  5I5P A;  4Q5T A;  1PB7 A;  1YXI A;  3TUS A;  3G3K A;  1N04 A;  4LUB A;  3HPI A;  3C32 A;  4N4U A;  2XXK A;  4KHZ E;  2DSF A;  2DE4 A;  4YKI A;  1JVX A;  4KFQ A;  3IL1 B;  4I8C A;  4QHQ A;  3S9E A;  2QPQ A;  4MBP A;  4NG7 A;  1FTA A;  1LFI A;  4U23 A;  1XC1 A;  5B70 A;  2ZYN A;  1R6Z A;  1Y1M A;  3T0J A;  1PC3 A;  2QS3 A;  4PC9 A;  5I7I A;  1TFD A;  1H76 A;  5I57 A;  4DIG A;  1O64 A;  1ZMG A;  4F3S A;  4I3Y A;  1MQH A;  4LQ2 A;  2L5V A;  2P3V A;  1IXI A;  4P0I A;  2XWV A;  4FEC A;  1H44 A;  2F7A A;  2OCU A;  1Q9D A;  4Q30 B;  4GWO A;  3RNN A;  5H8Q B;  4HTG A;  4UA8 A;  3IFC A;  3MAM A;  4N13 A;  2UYE A;  3ISP A;  2ZZV A;  4TOZ A;  5DEX A;  1MRP A;  3OEK A;  4EF2 A;  2QMW A;  3AXF A;  3K6U A;  2UVH A;  1R1N A;  5K2Y A;  3GLB A;  3OEL A;  3T96 B;  1AWB A;  4PFU A;  1B3F A;  3SET A;  3K2D A;  3HN0 A;  4ZZA A;  2B3B A;  1QJM A;  1IEJ A;  5KCJ A;  5IM2 A;  2DXY A;  4YU0 A;  4R75 A;  3KZG A;  1TT1 A;  1QW0 A;  1UTB B;  4KD5 A;  3A29 A;  2Q2C A;  4N07 A;  4DLD A;  2X7Q A;  3F11 A;  5IKB A;  3LSX A;  1DBZ A;  3I6V A;  4U21 A;  1SYH A;  4X48 A;  5K2X A;  2DWA A;  5EYG A;  2HQ0 A;  2H9B A;  4NF4 A;  3E9X A;  5F7V A;  1FCK A;  3U65 A;  2F7B A;  2XX9 A;  5H8N A;  3VVF A;  2Q8M A;  4H46 A;  1JEV A;  4OFO A;  3EF7 A;  2GFE A;  4NF5 A;  3D4G A;  1UQW A;  2O1L A;  1DSN A;  2YPN A;  3R26 A;  5DW8 A;  2XX8 A;  1B5H A;  5I58 B;  4PE3 A;  4OVJ A;  1YPN A;  2XWK A;  1NUW A;  2Y7R A;  3MVY A;  4ZEK A;  2D21 A;  4O3B A;  5TPA B;  4X9T A;  5FHN A;  2I3W A;  3IK6 B;  1MXX A;  1CNQ A;  4OQO A;  4BDM A;  4U22 A;  2BJJ X;  2B4M A;  3VV5 A;  1QUJ A;  1B2H A;  1LEV A;  4KYE A;  5LOM A;  5CRY A;  1BKA A;  4LZ7 A;  3PPP A;  2HAU A;  3BBR A;  1K9Z A;  4P1L A;  1S7Y A;  3EHS A;  2H99 A;  4F1Y A;  1ZKB A;  4AB6 A;  2YLN A;  4F1V A;  1Y3N A;  1P1U A;  1IZ1 A;  2DWI A;  1NV6 A;  4M4G A;  3CSG A;  3FV1 A;  4O7M A;  1B4H A;  5ICT A;  5FBP A;  1LAX A;  4X1B A;  1MDQ A;  4I3E A;  1LBX A;  2F34 A;  3DEL B;  2XXQ A;  4E0X A;  4F29 A;  4OVT A;  1EZO A;  3K6X A;  4Q0C A;  3H06 B;  2F36 A;  2PYY A;  4JVC A;  4O3A A;  4YMA A;  4ZZE A;  4ZEI A;  1XI6 A;  4RK9 A;  3K4U A;  4OYV A;  2F3B A;  1IIT A;  5I56 B;  3KSX A;  4O3C A;  2XXW A;  2AYS A;  3BFU A;  3QAX A;  2IEE A;  2OWT A;  4P11 A;  4JDF A;  1AMF A;  4AB5 A;  3MVX A;  3QMF A;  3Q29 A;  3O6G A;  5JEI A;  3KN3 A;  4R9F A;  1P1O A;  3VLV A;  1LAF E;  4QF9 A;  4FE8 A;  4MNP A;  3UOR A;  3ODB A;  5EYF A;  1MXY A;  2OX3 A;  1B0H A;  2O51 A;  1NUY A;  4BDN A;  3QSL A;  5I2K B;  2F35 A;  3FXB A;  4PBH A;  1SPI A;  1LST A;  1PBP A;  5HPQ A;  3MBP A;  1MXV A;  4C1U A;  4QFO A;  1JVY A;  4H45 A;  3RT8 A;  2ZZX A;  3W9V A;  5ICQ A;  2O69 A;  3D1R A;  4MJO A;  5L8D A;  1JET A;  1M5F A;  2Z8D A;  4N8G A;  3FXU A;  1TFA A;  2G93 A;  4YB6 A;  1D9Q A;  2REJ A;  4ZS9 A;  1LGB C;  3O2A A;  4HXV A;  4F19 A;  1POY 1;  3FXR A;  1B40 A;  4ELP A;  1EZ9 A;  4QFL A;  4LQ5 A;  3HST A;  4FJP A;  2I3V A;  3FJ7 A;  3UA8 A;  1DTG A;  2OWZ A;  4JSD A;  4I9D A;  3VLW A;  4POW A;  1NV2 A;  2Y7K A;  1TWY A;  2XXI A;  1FQC A;  1UIV A;  3JV9 A;  1NNP A;  2VGQ A;  4ZEF A;  1UIU A;  3KOS A;  1NV7 A;  3H7M A;  4PDH A;  3VLU A;  3G3I A;  2M8C A;  3N94 A;  1SVX B;  2OPE A;  3ILU B;  5AA1 A;  3OO6 A;  2E1S A;  4C0R A;  5KDT A;  1LFH A;  5AA3 A;  1A55 A;  4GBV A;  4OXV A;  1N7X A;  1IIW A;  2HZK A;  1B32 A;  3ECR A;  2AL4 A;  1Y3Q A;  4JWY A;  3BIG A;  1FBD A;  3M3K A;  3T22 A;  1PDA A;  3TDJ A;  1HSL A;  2Q88 A;  3PPO A;  3OO8 A;  3K6W A;  2I49 A;  3EN3 A;  3UP9 A;  3PPN A;  1KA0 A;  3PMX A;  3OEM A;  3C35 A;  4KYS A;  3FVG A;  2LAO A;  3KN8 A;  4BDQ A;  3KGC A;  3VXB A;  3TCH A;  4P1E A;  3QXM A;  4OEU A;  4GBW A;  2DYX A;  4OER A;  5IZ3 A;  2XHD A;  3H6V A;  4GX4 A;  1R9Q A;  3KOT A;  4M1V A;  1A40 A;  4GX6 A;  3LUY A;  1WDN A;  3U94 A;  1MQD A;  1NH8 A;  4GOT A;  2I4C A;  2OWS A;  2Q9T A;  1KWH A;  1P1N A;  3TFL A;  1SI1 A;  1P1Q A;  1FTO A;  2H25 A;  4R6K A;  3T93 B;  1B5J A;  3H3G A;  5ESY A;  3GXA A;  4PE5 B;  1NL5 A;  3IOW A;  1XHY A;  3JYR A;  2RC9 A;  1A8F A;  4QSC A;  3S9N C;  4XFE A;  4KCC A;  1SW1 A;  2VHA A;  4NQ8 A;  2XXY A;  2QVU A;  1MXU A;  3FJG A;  1OIB A;  5EYH A;  3KEI A;  3MQ9 A;  3KC1 A;  4KR5 A;  3BIH A;  2WBD A;  3SEX A;  5EHS A;  5H8H B;  2RC8 A;  3FGS A;  3B8B A;  2GHA A;  2QRY A;  2FIX A;  1O63 A;  3PMW A;  4JWX A;  3OO9 A;  1NUZ A;  5BUU A;  2QVV A;  3EPE A;  4F3P A;  3SKP A;  1FQF A;  1NKX A;  2DVC A;  3O28 A;  4GRK A;  1FPE A;  1LB8 A;  3V8X B;  3SEW A;  4G68 A;  2VOZ A;  3OO7 A;  1VSO A;  5LDZ A;  3LSL A;  1FJ6 A;  5DYH A;  3TOD A;  5TP9 B;  4ELQ A;  3FAS A;  3O29 A;  4ZEB A;  2ZXT A;  1EH3 A;  4XF5 A;  3FV2 A;  3V5A A;  3PD9 A;  4R73 A;  4ND9 A;  5DVF A;  3IR1 A;  2ONS A;  1SW2 A;  3CHG A;  1OQG A;  5IZZ A;  1FPG A;  4P47 A;  3IB2 A;  5I59 B;  3S4U A;  3CSB A;  4MX6 A;  5ITO A;  3QUJ A;  2I6E A;  1FPD A;  2NOO A;  4N81 A;  4EQB A;  2UVJ A;  1RDY A;  2F7C A;  1PBQ A;  1IMF A;  1WVJ A;  1GGG A;  2R9J A;  4ELO A;  1LCF A;  2QMX A;  3TTN A;  4GWU A;  3TCG A;  4DI3 D;  1ATG A;  1NMU A;  1I6A A;  3RPL A;  1FW0 A;  3Q26 A;  2XA5 A;  2XX7 A;  1M5E A;  5F1Q A;  1UTH B;  3H6W A;  1D9V A;  4DXU A;  5B7D A;  4PAF A;  4EXK A;  1FTL A;  2DVZ A;  2Q8J A;  5A5X B;  2PT1 A;  4RPO A;  2ZZW A;  5I2N B;  1DK4 A;  4G2Z A;  3GYY A;  2HPG A;  1RKM A;  3RTW B;  1Y9U A;  3FVK A;  1EYI A;  1I69 A;  1FSA A;  3ONM A;  2JJK A;  4N6K A;  4NF6 A;  2F97 A;  4JXI A;  1IMB A;  2OZZ A;  1QKA A;  4I62 A;  1JW1 A;  4LAT A;  1OVB A;  5TU0 A;  4F18 A;  3G3H A;  3FD3 A;  4G8H A;  1MY2 A;  4NWD A;  4NF8 A;  1JNF A;  4Q8R A;  1ANF A;  1MPB A;  3CIJ A;  2MKZ A;  3HFU A;  1SBP A;  3S9L C;  3IOT A;  4DXC A;  1FBC A;  4R2F A;  2XXH A;  3SDF A;  5EQA A;  1URD A;  2VP1 A;  2XWI A;  4PAK A;  4EF1 A;  5AA2 A;  3KG2 A;  2XXX A;  2D5W A;  3DLN A;  1L5T A;  1FPK A;  4H8J A;  3O6H A;  3C4M A;  3VVD A;  3VVE A;  1IME A;  2QS1 A;  4F3G A;  1YCJ A;  3O9P A;  2HAV A;  4QFK A;  5CMM A;  1VR5 A;  3MUQ A;  4MAG A;  1QGX A;  2H4I A;  3U72 A;  1VFE A;  2XD2 A;  3PUV E;  4R2B A;  4JSO A;  5IZ1 A;  2B4L A;  3A3C A;  2CEY A;  4G4P A;  1N0T A;  2UXA A;  2B3F A;  1NV5 A;  1RDZ A;  2WEF A;  3NOH A;  2UYF A;  3A3U A;  1B0L A;  4WED A;  4QBA A;  2GH9 A;  2F6G A;  3FZV A;  4ISU A;  3U8Q A;  2RIN A;  3I5O A;  3Q25 A;  1NNF A;  3CRB A;  3U93 A;  4YB7 A;  1BTJ A;  1BIY A;  1RYX A;  4OTE A;  1WOD A;  1AH5 A;  1B05 A;  5J16 A;  1O7T A;  4YKJ A;  4QFN A;  4RK2 A;  3E78 A;  2QL3 A;  2QS2 A;  3TTM A;  1SQY A;  3P7I A;  1MY3 A;  2RC7 A;  1FQE A;  3M3F A;  1MDP 1;  4PQJ A;  2NWJ A;  3VFJ A;  1OQH A;  4FEB A;  3TYH A;  3THI A;  1N84 A;  3OMB A;  1J1N A;  2VT5 A;  2Q2A A;  4UAC A;  3SEU A;  4R74 A;  2ONR A;  2KR0 A;  3CR9 A;  3ZKK A;  4YZZ A;  2DS9 A;  1FTK A;  4WXJ A;  4NED A;  4UAB A;  3MP1 A;  4F2O A;  2A5T A;  1N3W A;  2ZMB A;  4RYA A;  5EQ7 A;  3IB1 A;  4X1D A;  4MFI A;  1A99 A;  4IO7 A;  4PCD A;  3DP4 A;  3ZS6 A;  3B6W A;  3TQL A;  4YKP A;  3FVO A;  5AA2 B;  4ECF A;  2REG A;  2HXR A;  4WKM A;  3O6I A;  1B3G A;  1USY E;  1PB8 A;  2RCA A;  5H8F A;  3FAT A;  4LN5 A;  1EZP A;  3D4C A;  3T9H B;  2VD2 A;  1IXG A;  2Y7P A;  3B6T A;  2E0S A;  2XXU A;  2O68 A;  4GVO A;  1LCT A;  4OEN A;  1LFG A;  3TTR A;  4MLQ A;  4U1Z A;  3N6U A;  3PUW E;  5H8F B;  3QYT A;  2GRV A;  4U2R A;  1LB9 A;  5CI5 A;  3LSW A;  3K1M A;  2QVR A;  1BLF A;  2V25 A;  5CMB A;  5ET7 A;  1OLC A;  4JWO A;  5H8S A;  5BWJ A;  1LAG E;  4H65 A;  4JBZ A;  4P56 A;  4G77 A;  3ZSF A;  2A5T B;  4NX1 A;  5A5X A;  2GQ1 A;  2I0C A;  4ELR A;  2KQZ A;  3VE1 B;  3FUZ A;  4PFW A;  4O8M A;  3KJT A;  1B9J A;  4PP0 A;  5IAI A;  1SD3 A;  3PTY A;  3QUF A;  2RKM A;  5FHO A;  1XOC A;  3CG3 A;  3PPR A;  3FIR A;  3MVZ A;  4NE4 A;  4RNS A;  1QUK A;  1KA1 A;  3T1B A;  2Y84 A;  5CMC A;  3RLF E;  3KC0 A;  1B6H A;  4NWC A;  2FHY A;  3RN8 A;  3ROJ A;  3KFM A;  1N3X A;  3A09 A;  4PET A;  2PT2 A;  3RUM A;  2Z22 A;  2V4C A;  2V3T A;  5I59 A;  2PMS A;  2ZNT A;  1Y3P A;  1MS7 A;  2ALU A;  3EKI A;  2X7P A;  4R6H A;  3H6T A;  1M5D A;  2O7I A;  4X04 A;  4HW8 A;  3DP8 A;  2I58 A;  4MEV A;  2DP8 A;  3RT6 B;  2UVI A;  2NVU B;  2YJP A;  2AL5 A;  3FBP A;  4YKK A;  4BDR A;  5L9O A;  4WEP A;  5DVI A;  4DI4 B;  5T3J A;  5AA2 D;  3MWB A;  4G68 B;  4MCO A;  2VPN A;  4H1X A;  3E4R A;  4DE8 A;  4PBQ A;  3HHF A;  3QIM A;  3FXQ A;  2WBB A;  5M2V A;  4F2Q A;  4NMY A;  3K1P A;  1B1H A;  1YTV A;  3S9M C;  1URG A;  1VE4 A;  3IFA A;  2V84 A;  3OXN A;  1LBZ A;  4NF8 B;  3WAE A;  2HHM A;  1MG1 A;  2Z8E A;  3KN7 A;  3M3L A;  4PFB A;  4XXU A;  2XXV A;  3G7W A;  1IUD A;  4PAI A;  4OHN A;  4PDD A;  3T9V A;  4NF6 B;  4OWD A;  1EYK A;  1LLS A;  1NFT A;  4HCW A;  3CFL A;  4OFL A;  1HSE A;  1N76 A;  3IOU A;  1FQA A;  1FBE A;  4FOR A;  1QUI A;  1EU8 A;  4G61 A;  1IXH A;  1B3L A;  1Y4C A;  5F24 A;  1DMB A;  1QKB A;  1US4 A;  2DWH A;  2OLB A;  2PVU A;  4NF0 A;  2RCB A;  1ZTY A;  5I2N A;  4MNC A;  4OVP A;  2HCA A;  4P0G A;  3MPL A;  2I4B A;  3K1N A;  1G0I A;  2OBG A;  4PFI A;  1UTH A;  3C31 A;  5FTI A;  3CI8 A;  4GFR A;  3R6U A;  3RPL B;  3W15 C;  3EHU A;  4GXA A;  3LUZ A;  4GL8 A;  4DCX A;  5AE4 A;  2XXR A;  4MH5 A;  1MY1 A;  4DZ1 A;  3IJX B;  2CMO A;  3MP8 A;  4GWZ A;  1LBB A;  1LBW A;  2CZL A;  2Y5K A;  1NNK A;  3U1O A;  3PUX E;  1B3E A;  3I3V A;  1OMP A;  3PMV A;  4TLL B;  4XEQ A;  3RTF B;  1ELJ A;  1YYZ A;  4GX3 A;  3K0V A;  4THI A;  5CBS A;  2ABH A;  5CMK A;  2QFL A;  1VFD A;  1JP4 A;  4FAJ A;  4H0W A;  1ZLQ A;  4XKP A;  3TQW A;  1MQI A;  2FVZ A;  2FA7 A;  2XWO A;  1B7H A;  3HO7 A;  2F3D A;  1FTJ A;  5TP9 A;  1GVC A;  3HHG A;  1MM6 A;  2OJT A;  4OFJ A;  3KJ7 A;  2OK2 A;  2G29 A;  2ZNU A;  2D3I A;  4I1D A;  4R6Y A;  1TXF A;  2R71 A;  3KSJ A;  3H6U A;  2F5X A;  1ZBM A;  3PUZ E;  1A8E A;  4H6D A;  1YZ0 A;  1I6B A;  4U1O A;  2AIX A;  1IMC A;  5EQ8 A;  1IMD A;  5KZT A;  3IO6 A;  4XTC Q;  3IAZ A;  3IOV A;  4F31 B;  2DE2 A;  4AS4 A;  4G8M A;  1LBV A;  2Y7I A;  1XT8 A;  1D4N A;  1MXZ A;  3GBB A;  1CE2 A;  4P3L A;  5H8H A;  4HE0 A;  4IO3 A;  4EXL A;  3HCQ A;  3OOA A;  4GL0 A;  4G8N A;  5JK4 A;  4MLV A;  4QFP A;  1B5I A;  1RDX A;  1FBG A;  1NV0 A;  4OAN A;  4YB5 A;  2CZH A;  2F8D A;  1I6Q A;  2R6G E;  5A5L A;  1R9L A;  3HV1 A;  1B58 A;  1BP5 A;  4MHF A;  3LR1 A;  4RJZ A;  3MVW A;  1B46 A;  4FBP A;  3C9H A;  3E13 X;  1Y1Z A;  4OVS A;  1AL3 A;  4OES A;  2I0B A;  3SEV A;  4O94 A;  3PPQ A;  5I2K A;  1SW4 A;  3RY3 A;  3JZJ A;  4QXD A;  1FTM A;  3H4Z A;  4U4X A;  4DXB A;  1ZU0 A;  3K6V A;  3FJM A;  4LON B;  4AQ4 A;  4NTL A;  4EDP A;  5DVJ A;  4JVI A;  4BLA A;  2QS4 A;  1NNT A;  3MZ1 A;  5IZ3 B;  1G0H A;  1B1X A;  2CZI A;  1INP A;  1USY H;  4MMP A;  3O97 A;  3VXC A;  5EQ9 A;  3DP6 A;  4EUO A;  2PCR A;  3MZ9 A;  4OVQ A;  4ESW A;  4RA1 A;  3K00 A;  1Z7N E;  2ZYO A;  5ELV A;  4AS5 A;  3T9X B;  3WAF A;  1NV4 A;  1MQJ A;  1ZIU A;  2VPO A;  2VD3 A;  4GF8 A;  3T66 A;  4F3B A;  4ZED A;  1A54 A;  3MST A;  2V3Q A;  3TEL A;  1IMA A;  1NH7 A;  4R72 A;  2P2A A;  1DPP A;  1SYI A;  3K01 A;  2HXW A;  1H45 A;  5HM4 B;  3MZB A;  3LBS A;  1II5 A;  1JQF A;  3USD A;  4E0W A;  3SER A;  3CG1 A;  5KDT B;  1GV8 A;  2QJE A;  2PFZ A;  4RXL A;  3MPK A;  2DOJ A;  3TTK A;  3O66 A;  3N26 A;  2DQV A;  2P3N A;  1N7W A;  4ONY A;  3TMG A;  4ZE9 A;  4XIG Q;  3EHT A;  4OZ9 A;  4OEV A;  5ITP A;  1Q35 A;  4PGN A;  3UN6 A;  1JEU A;  4HE2 A;  5L9S A;  2Y7W A;  2ZYM A;  2Z23 A;  3MP6 A;  3CFZ A;  1BK4 A;  1IXC A;  2ZNS A;  1B7Z A;  3EQ1 A;  3G3J A;  3H03 A;  2OPD A;  1Y4T A;  3G3G A;  5FTH A;  3V83 A;  4O7I A;  1FBF A;  4TQU Q;  4BDL A;  2IA4 A;  4LZ5 A;  1DOT A;  4YIC A;  4NN3 A;  1PB9 A;  5H8N B;  1S9T A;  2X26 A;  3L6G A;  1FRP A;  3K02 A;  2XXP A;  4NF4 B;  5LTC A;  3IO4 A;  4MNI A;  4C1T A;  1H3D A;  3PUY E;  4POX A;  4R9G A;  4XKQ A;  5HBC A;  1NV1 A;  4EQ9 A;  3QK6 A;  1SDX A;  1FJ9 A;  1FBP A;  3SES A;  1MM7 A;  1MY4 A;  3M8U A;  2I48 A;  4FIM A;  4HE1 A;  4N6D A;  2ZYK A;  3UK4 A;  1LBY A;  3IJO B;  5DT6 A;  5KCJ B;  4GWX A;  1NV3 A;  5I56 A;  4F39 A;  4QSE A;  2ANJ A;  4PF6 A;  1LAH E;  1S50 A;  4GIZ A;  3SEY A;  3UIF A;  3E3K A;  4PF8 A;  4H5F A;  4I40 A;  1D9Y A;  2Q74 A;  1A7L A;  2PX1 A;  4KYD A;  3LC8 A;  4LVQ A;  4P8B A;  2O7U A;  3OEN A;  3OD7 A;  3LSF B;  4LZ8 A;  5FHM A;  4XKN A;  1D3K A;  3MJN A;  2FIE A;  4U4S A;  2QSX A;  2O84 X;  4KXP A;  3W9W A;  3C36 A;  4F22 A;  4H5G A;  1KZ8 A;  4N6P A;  2FBP A;  2ONK E;  4YMB A;  3KBZ A;  4FED A;  5I57 B;  2HFB A;  4QRZ A;  1P1W A;  2Z8F A;  1NUX A;  3PD8 A;  1OLA A;  4KI0 E;  4PGP A;  2A5S A;  3B6Q A;  4NGU A;  2WKY A;  4MF3 A;  4GD5 A;  4L17 A;  1POT A;  3PGF A;  1NI9 A;  2DXR A;  5TPA A;  3GZG A;  4NAP A;  2THI A;  1FQB A;  3TCF A;  1DTZ A;  1LBC A;  5I58 A;  4ZEC A;  2XXT A;  4HS7 A;  3PU5 A;  1IQ7 A;  2BJI A;  2DWJ A;  4OET A;  3PV0 E;  2F6P A;  4NF5 B; 
#chains in the Genus database with same CATH homology
 1EYI A;  4HXV A;  2Y5L A;  5A5L A;  4JVD A;  4O7M A;  1YXI A;  1FSA A;  4GX6 A;  3SZP A;  4F19 A;  4PF6 A;  5FBP A;  3E78 A;  4XF5 A;  2JJK A;  4N6K A;  4MHF A;  4XEQ A;  4MCO A;  2VPN A;  4FBP A;  2PFZ A;  3A29 A;  1IMB A;  4N4U A;  4PTK A;  4P56 A;  2XXK A;  4OVS A;  5ET6 A;  2WYK A;  4PBQ A;  2DE4 A;  4GWW A;  4NX1 A;  4PF8 A;  4F18 A;  1K9Y A;  2GQ1 A;  2WBB A;  4N17 A;  2OWZ A;  2Q9T A;  4I3E A;  3MYU A;  2KQZ A;  4MIJ A;  4O94 A;  1DBZ A;  1YYZ A;  4GX3 A;  2DE3 A;  1LBX A;  2VT5 A;  4I40 A;  2P3N A;  2Q74 A;  2QPQ A;  4GWY A;  2KR0 A;  4O8M A;  1NV2 A;  4YZZ A;  3IFA A;  3CHG A;  4NG7 A;  4P8B A;  5EYG A;  1FTA A;  2MKZ A;  5ESY A;  3HFU A;  4OVT A;  5IZZ A;  4QXD A;  4PGN A;  1LBZ A;  2CZK A;  4OVR A;  1FPG A;  2PFY A;  4JVC A;  4P47 A;  3PTY A;  2QFL A;  4HE2 A;  2HHM A;  1JP4 A;  5ET5 A;  4UAB A;  4PFB A;  1NV7 A;  4PDH A;  4PAI A;  4MX6 A;  1FBC A;  3T0J A;  1XI6 A;  5I7I A;  4PC9 A;  5EQ7 A;  3U65 A;  1BK4 A;  4PDD A;  1FPD A;  2FVZ A;  2FIE A;  2Q8M A;  1EYK A;  4H46 A;  4N81 A;  4HCW A;  2XWO A;  5EQA A;  2DDK A;  2F3B A;  2XWI A;  4PAK A;  4I3Y A;  4KXP A;  4GBV A;  5ET8 A;  4JVI A;  1RDY A;  2F3D A;  4XFE A;  3W9W A;  4PCD A;  1IMF A;  1FPJ A;  1KA1 A;  1FBE A;  4N8Y A;  2WYP A;  4O7I A;  4NQ8 A;  3T1B A;  5IZ3 B;  1KZ8 A;  2QVU A;  2FBP A;  1FPK A;  4G61 A;  1IME A;  3KC0 A;  2L5V A;  4P9K A;  2FHY A;  2P3V A;  1G0H A;  1FBF A;  5F24 A;  2CZI A;  4HCY A;  3KBZ A;  2HZK A;  5DW8 A;  1INP A;  2XWV A;  5EYH A;  3QMF A;  2HXR A;  4NF0 A;  2WX9 A;  4MMP A;  4YIC A;  3ROJ A;  5I5P A;  2F5X A;  2CEX A;  4NN3 A;  1FPI A;  2R8T A;  4MNC A;  4GWU A;  3RYD A;  1Q9D A;  3KC1 A;  1YZ0 A;  2XWK A;  4PE3 A;  3LV0 A;  1NUW A;  4NHB A;  4DI3 D;  3BIH A;  3BIG A;  1FBD A;  2WBD A;  4MAG A;  4OVP A;  1NUX A;  4PET A;  4N91 A;  1QGX A;  4M1V A;  5EQ9 A;  2V4C A;  2PCR A;  3B50 A;  1IMC A;  3IFC A;  4LN5 A;  1FRP A;  4MNP A;  1FPL A;  4OVQ A;  4X9T A;  5EQ8 A;  1EYJ A;  3RPL A;  1G0I A;  4IR8 A;  2XA5 A;  1IMD A;  3EKI A;  3ISP A;  4PGP A;  4X8R A;  5CM6 A;  2OX3 A;  3B8B A;  5IZ1 A;  2B4L A;  1DCU A;  1NUY A;  4AS4 A;  2CEY A;  2DE2 A;  2ZZV A;  1CNQ A;  4AS5 A;  4N15 A;  4PFI A;  4X04 A;  5J1D A;  5LTC A;  1NV5 A;  1LBV A;  1RDZ A;  2FIX A;  2WEF A;  3FXB A;  3NOH A;  1NV4 A;  1SPI A;  2VPO A;  4MNI A;  4PAF A;  4PBH A;  4F1U A;  2B4M A;  1KA0 A;  1NUZ A;  5T3J A;  4P3L A;  2HZL A;  3RPL B;  2QVV A;  4MEV A;  1NI9 A;  4HE0 A;  1LEV A;  4OA4 A;  4QBA A;  4GWS A;  2DVZ A;  4H45 A;  4NAP A;  1AWB A;  3LUZ A;  1NV1 A;  5IGA A;  1VDW A;  2ZZX A;  3W9V A;  1FPE A;  1FJ9 A;  3MST A;  2ZZW A;  1FBP A;  2V3Q A;  1IMA A;  3D1R A;  4MJO A;  5I3S A;  1DK4 A;  3GYY A;  4P1E A;  2HPG A;  1K9Z A;  4P1L A;  5JK4 A;  3FBP A;  1FPF A;  1RDX A;  2QVR A;  3E79 A;  4HE1 A;  4GWZ A;  1FBG A;  5LDZ A;  1NV0 A;  4N6D A;  4NGU A;  4OAN A;  1LBW A;  1LBY A;  2CZH A;  4GBW A;  5ET7 A;  4N8G A;  5IM2 A;  4F1V A;  4PFR A;  4DI4 B;  5IZ3 A;  1FPB A;  2BJI A;  1FJ6 A;  2Y5K A;  1D9Q A;  1FBH A;  1NV6 A;  4GWX A;  4GX4 A;  1NV3 A;  5J16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...