5EYHA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+ at ph 7.0
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eyhA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eyhA02
4GBVA 3ROJA 3A29A 1NV1A 2DDKA 1NV5A 4IR8A 4O7IA 1FBFA 3BIGA 1NV4A 1FPGA 2CZIA 2BJIA 1SPIA 3B8BA 2FBPA 1JP4A 1LEVA 2P3VA 2WEFA 4HE2A 1XI6A 3QMFA 1IMCA 1FBPA 5IZ3A 2WBBA 4PTKA 1FRPA 5ET5A 5EQ7A 1NV2A 1NUZA 5IZ3B 5IZ1A 1NV0A 1FJ6A 1RDZA 5EYHA 4HE1A 4AS4A 1FPJA 5J16A 1FTAA 2OX3A 3LUZA 1IMAA 3RPLA 2VT5A 1INPA 1NI9A 4I40A 5EQ8A 5ESYA 1KA1A 2Q74A 4GBWA 1RDYA 3RPLB 1Q9DA 2FVZA 1FPDA 1YXIA 4FBPA 4GWSA 1FBEA 1FBGA 4N81A 5T3JA 2HHMA 1EYKA 1NUYA 3BIHA 4I3YA 3RYDA 4HE0A 5ET6A 1NUXA 3D1RA 5A5LA 2QVRA 1FPKA 1FPEA 1FPBA 1G0HA 4GWWA 5F24A 1FBCA 2R8TA 2QFLA 1LBWA 1K9YA 2FHYA 3KC1A 2WBDA 2FIXA 2GQ1A 3LV0A 4G61A 1FBHA 2Y5LA 3FBPA 2QVVA 1G0IA 1DCUA 1KA0A 1IMDA 2Y5KA 3T0JA 2CZHA 2FIEA 1KZ8A 4I3EA 5ET7A 2CZKA 3IFCA 2F3DA 4GWYA 1FPLA 1FPIA 5LDZA 3IFAA 4HXVA 1FSAA 2OWZA 1LBYA 4KXPA 1IMFA 1EYIA 1IMEA 1DK4A 4GWZA 1YYZA 5EQAA 1D9QA 1BK4A 2JJKA 2Q8MA 2QVUA 4GWUA 1VDWA 1K9ZA 1LBZA 4GWXA 1FJ9A 2PCRA 5EYGA 3KBZA 2P3NA 4QXDA 1AWBA 1NV7A 3KC0A 1NV3A 4AS5A 4GX6A 1YZ0A 1FPFA 4H45A 5ET8A 4GX3A 1FBDA 4H46A 1NUWA 1RDXA 1NV6A 1LBXA 1QGXA 5FBPA 1EYJA 4GX4A 1IMBA 1DBZA 5EQ9A 4MJOA 2F3BA 5DW8A 1CNQA 1LBVA 5I3SA
chains in the Genus database with same CATH superfamily
3B6WA 1OQGA 4OERA 3S2VA 5CBRA 3U93A 3EKIA 3R6UA 4OFJA 4MNCA 1SPIA 3KN8A 5I5PA 2DE2A 1QKAA 4OFOA 3KSXA 3QMFA 1FBPA 1UTHA 2KQZA 1MRPA 5IZ1A 3ZSFA 5EYHA 1N0TA 4RY1A 3U94A 3VXBA 5F1QA 3MVZA 1S50A 3SETA 5ESYA 4R9GA 5KCJB 3IX1A 3MP1A 3MZ1A 4R6HA 1M5FA 4N81A 2XD2A 2GH9A 4Q0CA 1Y3NA 3H06B 2XA5A 4BDNA 1IXCA 1MQHA 4ZZEA 3PUWE 3OO8A 3PUZE 2O6AA 2DWJA 4ZDMA 2D3IA 3OELA 2XXTA 1FBHA 4YKIA 2QVVA 4ZE8A 3IL1B 4AQ4A 3DELB 2XHDA 2VP1A 1SQYA 1LFHA 3ONMA 4F3SA 2X7QA 1TFDA 3ISPA 4EXKA 4EQBA 2QVUA 5CBSA 4IB2A 4YICA 2ESNA 1B3EA 3PGFA 3E13X 3KGCA 3FD3A 4QXDA 2H5YA 3OSQA 1AWBA 3MVYA 3H6UA 4MCOA 5CMMA 1LBXA 1JQFA 3VVDA 2RF1A 5AA3A 2XXKA 4JSDA 1A40A 3GZGA 3VFJA 5H8QA 1NV1A 2QMXA 3GXAA 1S7YA 3KBRA 3HHGA 4KHZE 4KQPA 2BJIA 3FJGA 3G3GA 4TLMB 4XXUA 1ZMGA 1VSOA 1FQBA 4PAIA 4YKKA 1IZ1A 3M8UA 4C1UA 5EQ7A 3TCFA 4ZZAA 5ISUA 2RCBA 3G7WA 3EN3A 3MP6A 2PYYA 1FPJA 2VD2A 2GHAA 3TTLA 2RINA 5EYFA 4TLLB 5L9SA 3EHTA 3WAFA 3K1PA 2KLFA 2HHMA 3G3FA 4O3AA 1B3LA 4ECFA 1FPKA 4F1VA 3E9XA 3FIRA 5AA2A 2B3FA 3H6TA 2YLNA 2I48A 1II5A 5TP9B 4G8HA 1MPCA 3Q29A 5KDTB 3E79A 1MM6A 3EQ1A 1IMDA 2L5VA 3W9VA 2A5SA 1SI1A 1MY0A 4KXPA 3T66A 4X1BA 1SVXB 5I59A 4KYEA 2Q8MA 2I0CA 1VFDA 3ILTB 1LBCA 3MVWA 2NWJA 2HQ0A 3G3IA 1YAEA 2Y7IA 3O97A 1M5BA 2O84X 1SW1A 3FGSA 2ZZVA 3CG1A 4KYSA 2F3BA 3O6GA 1JETA 5CMKA 3VXCA 5A5XA 2F7AA 4FEBA 3GBAA 4R2FA 1BKAA 4QFOA 5DVFA 2CZIA 1PEBA 4F2OA 3NOHA 2D5WA 2R9JA 1B7HA 4MX6A 1UTHB 4KPTA 1LSTA 3CIJA 1PB9A 4MMPA 2XXXA 4ND9A 2HEUA 4JBZA 2Q74A 5L9OA 4Q8RA 4FBPA 2UVIA 2V93A 1NL5A 4IO3A 2HXWA 4NEDA 3D1RA 3V5AA 4PQJA 4OVJA 4GWWA 2Z8FA 2PT2A 2F5XA 5CM6A 3CHGA 2GQ1A 4G77A 3T93B 1KA0A 2Y5KA 4YKPA 2ABHA 3O6HA 2ONRA 3K6WA 3HHFA 4IO2A 4ONYA 1OMPA 2OWZA 3KN3A 1QULA 3LSFB 5JK4A 4H67A 4N91A 4GWZA 2JJKA 1BK4A 4QHQA 1GR2A 1TFAA 3T9VA 5AA4B 3EPEA 1JW5A 4RNSA 2ANJA 1MY1A 1J1NA 4RK9A 4F29A 1LB8A 1OLAA 4H6DA 3MSTA 4RXLA 2PMSA 4HCWA 4JDFA 2ZYKA 4PFIA 1DMBA 2O51A 3IOWA 3PMVA 3O6IA 1MQDA 3FVOA 2REGA 4NX1A 4XFEA 5I56B 4BDMA 1OQHA 1Y9UA 1NNKA 3OXNA 1LEVA 1VE4A 1XVYA 2WEFA 1N04A 4KFQA 2I0BA 1IXHA 1XT8A 2I6EA 1NUZA 4PE3A 4JB7A 2DWIA 4PFTA 4HTGA 1B46A 3U1OA 4NF6A 1FTAA 4QFLA 1Q35A 2AL5A 4OEUA 4NAPA 4X48A 4PGPA 3MJNA 1O63A 1RYXA 2XXVA 3CG3A 4NTLA 3BKIB 2VGQA 2Y7WA 5AA2B 2NUVA 2XXRA 1DTZA 4NG7A 4EF1A 2DS9A 3PU5A 3HSTA 2DXYA 1MXWA 2F3DA 5LDZA 4G4PA 3TYHA 3LSWA 2ONKE 1B9JA 4ISUA 1Q1KA 5I59B 1MXUA 1DPPA 3T9UA 4H1XA 1EZ9A 1R9QA 3RQTA 1O64A 1FPFA 4BDQA 4F1UA 2DP8A 2WYPA 2UXAA 4DCXA 3D4GA 3TKDA 4QFNA 4R72A 3N5LA 4MNIA 4GBVA 4MLVA 3QUFA 2DDKA 5A5XB 1RKMA 4OANA 3IB2A 4FIMA 1A8FA 4PF8A 2F78A 1NH7A 5I84A 4OHNA 3TZAA 4U21A 1US4A 3TTNA 4YMAA 5FTIA 2OWSA 4P0IA 4Z0IA 2X26A 1Z7NE 4MLQA 2PT1A 2ZNSA 5DVIA 5J1DA 4F39A 1LAFE 5IZZA 3MYUA 3CSBA 4GVOA 3FXRA 2ALUA 4G61A 2WX9A 3FBPA 4PFUA 3KOSA 4PGNA 4ELQA 3MW0A 2M8CA 3MBPA 4OQOA 3PUYE 1UIVA 1TWYA 2VD3A 1EYIA 3FV2A 3MZ9A 4QSCA 2HFBA 3V83A 4GXSB 3SDFA 5IGAA 3MZBA 4DZ1A 1NV7A 2GFEA 3KC0A 1EZPA 1FBDA 2V4CA 5L8DA 4TQUQ 3K02A 2Q2CA 1H43A 1FQDA 1B3FA 4YAHX 4MIJA 1IIWA 3DLNA 4O7IA 2RKMA 2Y84A 1B7ZA 5FTHA 3CI8A 5LOMA 3BBRA 3N26A 4N13A 4GD5A 2YPNA 2QS3A 3MAMA 3C33A 1TT1A 3KJTA 1FJ6A 1N3XA 3ILUB 4OVSA 3LSLA 1YTVA 3CFXA 4DXUA 4I40A 3EF7A 4NF6B 5DT6A 3GYYA 1LBBA 4LQ5A 4Q5TA 2HZLA 3THIA 4I3YA 3RGYA 4U22A 2P1SA 3PD9A 5A5LA 4PETA 1MXXA 1FPEA 4PBHA 2Q8JA 4N07A 1BLFA 1LAGE 2Y5LA 2I58A 4JVIA 3JV9A 5H8HB 3K01A 4XIGQ 5I7IA 2O7UA 4I1DA 3IORA 4P8BA 1B32A 4XKPA 2FYIA 3CR9A 1QKBA 3SESA 3CRBA 1LBYA 2XXQA 1IMEA 3RY3A 3KFMA 4NWCA 4E0XA 3F11A 3FASA 1LCFA 3U8QA 2DWHA 1FJ9A 4XKQA 2Y7PA 3KBZA 2X7PA 1EZOA 2B4MA 4N6DA 4GQOA 4K3FA 4U4XA 4GX3A 1LCTA 1NV6A 3C31A 4R75A 4P56A 1ZTYA 3TELA 1B5IA 1NNPA 3TQWA 3SEYA 3ROJA 3A29A 3PD8A 4GL0A 4QBAA 4FE8A 1PC3A 4H0WA 1AOVA 1B4HA 3EHUA 4HE2A 3SKPA 4UA8A 4WEDA 3MP8A 1B5HA 2UYFA 4LA9A 4FAJA 3FJ7A 4OMBA 5HBCA 4EQ9A 4OWDA 4JWXA 5J16A 4R73A 3IOVA 5EQ8A 1HSLA 3E4RA 2O1LA 4WXJA 2GHBA 3QUJA 1FQEA 4P3LA 4TOZA 3IOTA 5T3JA 4NF4A 4DE8A 4OVQA 4OVTA 4HE0A 2HPGA 1P1NA 4U2RA 4KYDA 3LR1A 1FBCA 2R8TA 2F97A 2QFLA 1B0LA 4HS7A 4M4GA 3LV0A 1SD3A 2Z8DA 5CMCA 1DCUA 4NE4A 3K6UA 3L6HA 5ITOA 3RT6B 1P1WA 4ZS9A 2CZKA 2DSFA 1R9LA 2F6PA 5LTCA 2W7YA 4BLAA 3MPKA 3TTRA 4Q30B 2OJTA 3K2DA 1US5A 1NMUA 4HCYA 1Y4CA 4YB7A 1ZLQA 4OYVA 2H9BA 1URSA 1A8EA 1NUWA 3PPQA 2F7CA 1Y3QA 1DBZA 3O28A 4YZZA 5DTBA 3MVXA 1WODA 1IITA 3FUZA 2F34A 2DYXA 1MM7A 2DVCA 4F3BA 2WYKA 3N6UA 1H76A 4LATA 1SDXA 3ZS6A 3G3KA 4ESWA 1FRPA 2ZXTA 2UYEA 4IY5A 1MDQA 2HAUA 1SI0A 4DI4B 4GL8A 5JTYB 3LUZA 2R6GE 1INPA 1NI9A 2B4LA 1RDYA 2XXHA 4XF5A 2Z23A 4ZEBA 4GWSA 1MY3A 1I6AA 3BIHA 4U1OA 4X9TA 4MFIA 2QVRA 5DYHA 3S9EA 4PFRA 4U4SA 2XWOA 4OESA 2BJJX 5B7DA 2H98A 3UIFA 4H5FA 3IAZA 4QRZA 4YU0A 1N84A 2IEEA 2CZHA 3VVFA 5HPQA 3SZPA 4FJPA 1H45A 2I4CA 4Z7EA 1JEVA 1FTMA 3PMXA 4PFBA 1USYE 4U1ZA 3D4CA 4H8JA 1XHYA 1JW1A 4PAFA 1LGBC 4FECA 5EHSA 3T22A 1JEUA 4IGRA 1P1UA 3UORA 4GX6A 4NF8A 2IA4A 1A55A 2E1SA 4QFPA 5ITPA 4H46A 4MBPA 3O29A 1MXZA 4MJOA 1SW2A 3QK6A 2Z8EA 4QFKA 3C34A 2DXRA 3K00A 4O94A 3MPLA 4IR8A 3C9HA 4JVCA 3IB1A 1NV4A 4JVDA 3A3CA 4MF3A 5H8NA 4F22A 1B5JA 3KN7A 1XI6A 5IAIA 1MDP1 2O69A 1MXYA 3TUSA 4P1LA 2F36A 5H8FA 3E3KA 2PFZA 2ZYMA 3KJ7A 3IOUA 2F35A 2G93A 4GBWA 2PBWA 2QPQA 5H8QB 2KR0A 1YXIA 3BFUA 3OOAA 1FBGA 3H03A 2QSXA 4R2BA 4OENA 4MH5A 4NF4B 1B3GA 2O7IA 3UK4A 2XXPA 3C4MA 4F3GA 3FXQA 1KWHA 3O9PA 3ODBA 1CE2A 3KEIA 4LZ5A 5I2NA 3PUXE 4PFYA 1SW4A 2VHAA 2V84A 1DOTA 5I58A 2QL3A 1D9QA 3K6XA 1FW0A 3FXBA 1GGGA 2RC9A 1LBZA 1B58A 4F2QA 4JXIA 1MPDA 4G8NA 2P3NA 3KG2A 3W9WA 1FTJA 4FORA 4EQ7A 1NFTA 3PPOA 1T0KA 5AA2D 1P99A 2OCUA 5DW8A 3FJMA 2Q89A 5IM2A 2NOOA 3IR1A 5I3SA 3AXFA 1AMFA 1QUIA 3BIGA 3R26A 3OD7A 1FPGA 1ZU0A 1I6BA 4PC9A 5ICQA 3K4UA 1M5CA 2PFYA 5IZ3A 4NGUA 3O66A 3G3HA 4ZE9A 3ECRA 3VE1B 1N3WA 4DDDA 2QJEA 1URDA 1IMAA 3I3VA 2OPDA 4KI0E 1B1XA 5JEIA 2UVGA 1FQAA 5ET6A 2ZMBA 1OVBA 4DLDA 3TCGA 2RCAA 1JVXA 4GF8A 2DQVA 1EH3A 2XD3A 3TEPA 4LZ7A 4BDOA 2DOJA 5I2KA 2LAOA 4N6KA 2FIEA 3IFCA 4IO4A 1XVXA 1FPIA 5DEXA 3MWBA 3PPRA 2PVUA 4UABA 4XEQA 1UIUA 5EQAA 2CEXA 4O7MA 4PFWA 4GWXA 4KCCA 4DCYA 2HZKA 1RYOA 2MKZA 3W15C 2REJA 4NWDA 3TPAA 4H45A 3PPNA 3PPPA 4MHFA 4NF8B 2XXIA 3JZJA 3G3JA 4RJZA 3VVEA 3DP6A 4WKMA 4LP2B 2PX1A 1FBFA 3RPWA 2YJPA 4ELRA 5FHNA 2H4IA 3VV5A 3RTWB 5IKBA 4I62A 2A5TA 1JVYA 3VDFA 1POY1 2DVZA 5H8NB 1ZKBA 4BDRA 2UVJA 4LN5A 3K6VA 3IO6A 1R6ZA 2D21A 2P0SA 3FXUA 4RPOA 1RDZA 2H99A 5H8FB 4GIZA 2F8DA 1PB8A 1Y4TA 3LSXA 4LUBA 3S9NC 3RPLA 1H44A 3LC8A 4ESXA 1JW4A 3SEXA 4GLIA 1S9TA 1SYHA 4NF0A 3BFTA 3S4UA 4C1TA 1EYKA 4HW8A 2XWIA 4QF9A 3Q27A 4EUOA 1MQIA 2Q2AA 1QUJA 2VPNA 3HV1A 2DE4A 3OENA 4IGTA 2WBDA 3HN0A 1EU8A 1Y1MA 4QSDA 5CMBA 3SEUA 1O7TA 1LB9A 1HSJA 3K1NA 3KZGA 2O68A 5ET7A 2Z22A 4F31B 5H8SA 4ZEDA 5I58B 3SEWA 1PBQA 2ZZWA 1B51A 3B6QA 3P7IA 4GWUA 3OEMA 3OO9A 4ZEKA 3IK6B 3IO4A 3CVGA 1WDNA 3LUYA 3L6GA 1XC1A 4NQ8A 1NV3A 3VLUA 1FCKA 4ELOA 3HCQA 1IXGA 3T1BA 1A54A 1QGXA 4P11A 5K2XA 3TDJA 1CNQA 4P1EA 4LONB 3RN8A 1XS5A 2NXOA 1NV5A 3ZKKA 2RC7A 4FATA 4R9FA 1D9YA 3UA8A 5CC2A 4NHBA 3S9MC 1QW0A 1SYIA 2P3VA 1Z7ME 4GOTA 1FTOA 1IQ7A 4DIGA 1ATGA 2R71A 5ICTA 5ET5A 1NV2A 5IZ3B 2Q9TA 4OTEA 3U72A 4AS4A 3IJOB 4KR5A 4RPNA 4IO7A 1I69A 1VFEA 2OX3A 5FHOA 4NMYA 2OWTA 1POTA 4N4UA 4YB6A 1DTGA 3SEVA 3DP8A 2WKYA 4F18A 3GLBA 1UQWA 5AA4A 3H3GA 4IO6A 4X8RA 1YPNA 1AH5A 4N8YA 5EHMA 4OETA 1N7WA 2HAVA 1YCJA 1FTKA 1KZ8A 1NKXA 4X04A 5I2KB 3M3FA 1MG1A 3H7MA 1B2HA 5DEXB 2I4BA 4O3BA 4PDHA 3TQLA 2XX9A 3ZKLA 1YYZA 1VDWA 5I56A 1MY4A 2Q88A 2G29A 1LFIA 2PCRA 1BIYA 5TPAA 5EYGA 1OIBA 1LAHE 5F7VA 1ZJLA 1QJMA 1BTJA 3DP4A 4R6YA 1SBPA 5FBPA 1EYJA 3E78A 5EQ9A 4G68A 3B6TA 1N7XA 4XKNA 1NH8A 1F9BA 2VOZA 4BDLA 4R74A 1UTBA 5B70A 4N17A 3SERA 4ZEIA 3USDA 1JP4A 1B7UA 2A5TB 4ZEFA 4N8GA 2CMOA 3OSRA 1IUDA 2ZYNA 1B6HA 1MQJA 3QIMA 2FNCA 3RPLB 3JYRA 4POXA 4O3CA 2V3QA 4NN3A 1MXVA 2NVUB 2OBGA 4G2ZA 1MH3A 1A99A 4E0WA 1FQFA 4OFLA 1K9YA 4C0RA 5K2YA 4L17A 2CEYA 4UACA 5FHMA 4I3EA 2RC8A 5ELVA 1HSEA 3MUQA 4G68C 3V89B 1FSAA 4NF5A 3EHSA 4F19A 1D4NA 1B40A 1B52A 4IY6A 1AIVA 1DK4A 3C36A 1ZIUA 1NNFA 2ZYOA 1DSNA 3UP9A 4I8CA 1MPBA 4AS5A 1LLSA 3QSLA 2E0SA 3TFLA 3S9LC 4P0GA 1CB6A 1GVCA 1WVJA 4F1YA 4YB5A 1LBVA 5AA1A 3A09A 4H65A 5KZTA 3HO7A 2FBPA 3I5OA 1TXFA 2V3TA 2I3VA 3N94A 5CI5A 2WBBA 4PTKA 2P2AA 4KD5A 1NV0A 4EDPA 4HE1A 3PMWA 4OVRA 1OLCA 2OLBA 4FEDA 3K0VA 1R1NA 4MAGA 2VT5A 4U23A 2VPOA 1L5TA 1Q9DA 2FVZA 1B1HA 5TU0A 3RTFB 1FBEA 3VLVA 1Y3PA 3T96B 2QRYA 2QMWA 1MQGA 1NUXA 4R6KA 2F6GA 3K1MA 1G0HA 4PF6A 1D3KA 2XXWA 4RA1A 3PV0E 4IO5A 4KCDA 3KC1A 4OVPA 3CFZA 2B65A 4OXVA 2GRVA 4LZ8A 4GWYA 1FPLA 3HFUA 1IEJA 3FVKA 4WEPA 5HM4B 2H25A 3Q26A 1XOCA 4OZ9A 1K9ZA 2I49A 2ZNTA 3PUVE 2UVHA 5TPAB 2QS1A 5I57A 4JWOA 5M2VA 4RYAA 1AL3A 4AB5A 2XXYA 3HPIA 4PBQA 4G8MA 1Y20A 1H3DA 4G68B 3I6VA 3FVGA 3TMGA 1I6QA 2HCAA 3M3KA 4PP0A 4ZECA 2FA7A 2F7BA 4YKJA 1UTBB 2AYSA 3LBSA 1M5EA 4F3PA 4ELPA 4MNPA 3FVNA 2OPEA 1N76A 5CRYA 3KSJA 4H5GA 3H6WA 1A7LA 1D9VA 2OK2A 3RLFE 1OVTA 4EXLA 5H8HA 5L9MA 3B50A 5KCJA 4O8MA 5BUUA 2B3BA 1KA1A 3M3LA 3MQ9A 2ZZXA 2XX8A 1M5DA 2THIA 4QSEA 5AE4A 1LAXA 1FPBA 1B4ZA 3QXMA 2DWAA 2FHYA 5BWJA 2ZNUA 3UGWA 2FIXA 1FTLA 4I9DA 3TODA 2ONSA 3PTYA 3FV1A 3C35A 4N6PA 3MC2A 3H6VA 2O1MA 3TTMA 3OEKA 1PDAA 4NF5B 4PCDA 4JWYA 3CSGA 4PE5B 3QAXA 4XTCQ 1MY2A 3Q25A 1PBPA 3B7DA 1ELJA 1SW5A 3QYTA 4OA4A 1YZ0A 4POWA 1B05A 1RDXA 4GFRA 4N15A 2AL4A 4GX4A 3GBBA 1FQCA 3C32A 2QS2A 3T9HB 1GTKA 4PAKA 4AB6A 3FZVA 4LVQA 3TAJA 5DVJA 4M1VA 1P1OA 1QUKA 1IXIA 2I3WA 3V8XB 3TTKA 4YMBA 3B8BA 2XXUA 1P1QA 4X1DA 3R7XA 3U92A 1MS7A 1IMCA 1BP5A 1PB7A 4GXAA 1ANFA 3KOTA 4MEVA 3WAEA 2CZLA 4LQ2A 1LFGA 4JSOA 4P47A 3DM0A 1FPDA 2HXRA 3N6TA 3H4ZA 1B3HA 1DPEA 1NNTA 3TCHA 2Y7KA 1NUYA 3A3UA 4RK2A 3RYDA 3IJXB 5F24A 5TP9A 3RUMA 1LBWA 5KDTA 1GV8A 2OZZA 3OMBA 1G0IA 3RT8A 2XWVA 3T0JA 2XWKA 2XX7A 1ZBMA 4XKRA 1B0HA 3IFAA 4HXVA 1JNFA 4THIA 4EF2A 3CFLA 4PDDA 4GRKA 1IMFA 3OO6A 2QS4A 1USYH 3O2AA 2AIXA 2V3UA 4DXBA 4DI3D 1Y1ZA 3RNNA 3T9XB 1MH4A 3UN6A 3U65A 3IB0A 4P9KA 5I2NB 5ET8A 2Y7RA 5I57B 3OO7A 1URGA 1QVSA 4GWOA 3VLWA 1IMBA 4H8IA 3Q28A 2DE3A 1VR5A 5JTYA 4DXCA 3FATA 4OEVA 2V25A
chains in the Genus database with same CATH topology
4GBVA 4O94A 2DDKA 4IR8A 3EKIA 4JVCA 1NV4A 4JVDA 4N17A 4OANA 4MNCA 1SPIA 5I5PA 4PF8A 1JP4A 2DE2A 1XI6A 3QMFA 4P1LA 1FBPA 2KQZA 4N8GA 5IZ1A 5EYHA 2PFZA 5ESYA 4GBWA 2QPQA 3RPLB 2KR0A 1YXIA 1FBGA 4N81A 2V3QA 4NN3A 5J1DA 2XA5A 5IZZA 3MYUA 1K9YA 4G61A 2WX9A 1FBHA 3FBPA 2QVVA 4PGNA 2CEYA 4I3EA 1FSAA 4F19A 3ISPA 1EYIA 1DK4A 1D9QA 2QVUA 3FXBA 1LBZA 4YICA 5IGAA 2P3NA 4QXDA 1AWBA 1NV7A 3KC0A 3W9WA 4AS5A 1FBDA 2V4CA 4MCOA 1LBXA 5DW8A 5IM2A 1LBVA 5I3SA 2XXKA 4MIJA 1NV1A 4O7IA 3BIGA 1FPGA 2BJIA 4PC9A 2FBPA 4PAIA 2PFYA 5IZ3A 4NGUA 2WBBA 4PTKA 5EQ7A 1NV0A 1FJ6A 4OVSA 4HE1A 4OVRA 1FPJA 4MAGA 1IMAA 2VT5A 4I40A 2VPOA 1Q9DA 2FVZA 3GYYA 1FBEA 2HHMA 2HZLA 4I3YA 5ET6A 1NUXA 5A5LA 4PETA 1FPKA 4F1VA 1FPEA 1G0HA 4PF6A 4PBHA 3KC1A 2Y5LA 4JVIA 4OVPA 3E79A 5I7IA 1IMDA 2L5VA 4N6KA 2FIEA 4P8BA 3W9VA 3IFCA 4GWYA 1FPLA 1FPIA 3HFUA 1LBYA 4KXPA 4UABA 4XEQA 1IMEA 5EQAA 2Q8MA 2CEXA 4O7MA 1K9ZA 4GWXA 1FJ9A 3KBZA 2HZKA 2MKZA 2B4MA 4N6DA 4H45A 4GX3A 4MHFA 1NV6A 2ZZVA 2F3BA 4P56A 4PBQA 3ROJA 3A29A 4QBAA 1FBFA 2CZIA 2DVZA 3NOHA 4HE2A 4LN5A 4MNPA 4MX6A 1RDZA 3B50A 5J16A 4O8MA 3RPLA 4MMPA 5EQ8A 1KA1A 2Q74A 4FBPA 2ZZXA 4NF0A 4P3LA 5T3JA 1EYKA 4OVQA 2XWIA 4OVTA 4HE0A 3D1RA 2HPGA 1FPBA 4GWWA 1FBCA 2R8TA 2VPNA 2QFLA 2DE4A 2FHYA 2F5XA 5CM6A 2WBDA 2FIXA 3CHGA 2GQ1A 3LV0A 1DCUA 1KA0A 2Y5KA 3PTYA 5ET7A 2CZKA 2OWZA 2ZZWA 5JK4A 4PCDA 4N91A 4GWZA 5LTCA 2JJKA 1BK4A 4GWUA 4HCYA 4NQ8A 1NV3A 4OA4A 1YZ0A 3T1BA 1NUWA 1RDXA 4N15A 3MSTA 4HCWA 1QGXA 4GX4A 1DBZA 4YZZA 1CNQA 4PFIA 4P1EA 4PAKA 1NV5A 4NX1A 4XFEA 4M1VA 2WYKA 4NHBA 3B8BA 1LEVA 2P3VA 2WEFA 1IMCA 1FRPA 5ET5A 1NV2A 1NUZA 5IZ3B 4PE3A 2Q9TA 4DI4B 4AS4A 4MEVA 1FTAA 2OX3A 3LUZA 1INPA 1NI9A 4P47A 2B4LA 1RDYA 4XF5A 1FPDA 2HXRA 4NAPA 4GWSA 4PGPA 4N4UA 1NUYA 3BIHA 3RYDA 4F18A 4X9TA 2QVRA 5F24A 4PFRA 4X8RA 2XWOA 1LBWA 4N8YA 4NG7A 1G0IA 3T0JA 2XWKA 2CZHA 2XWVA 1KZ8A 3SZPA 2F3DA 4X04A 5LDZA 3IFAA 4HXVA 4PDDA 1IMFA 4PDHA 4PFBA 1YYZA 1VDWA 4DI3D 2PCRA 4PAFA 5EYGA 3U65A 4P9KA 4GX6A 1FPFA 4F1UA 5ET8A 4H46A 2WYPA 5FBPA 1EYJA 3E78A 1IMBA 5EQ9A 4MJOA 2DE3A 4MNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBV A;  3ROJ A;  3A29 A;  1NV1 A;  2DDK A;  1NV5 A;  4IR8 A;  4O7I A;  1FBF A;  3BIG A;  1NV4 A;  1FPG A;  2CZI A;  2BJI A;  1SPI A;  3B8B A;  2FBP A;  1JP4 A;  1LEV A;  2P3V A;  2WEF A;  4HE2 A;  1XI6 A;  3QMF A;  1IMC A;  1FBP A;  5IZ3 A;  2WBB A;  4PTK A;  1FRP A;  5ET5 A;  5EQ7 A;  1NV2 A;  1NUZ A;  5IZ3 B;  5IZ1 A;  1NV0 A;  1FJ6 A;  1RDZ A;  5EYH A;  4HE1 A;  4AS4 A;  1FPJ A;  5J16 A;  1FTA A;  2OX3 A;  3LUZ A;  1IMA A;  3RPL A;  2VT5 A;  1INP A;  1NI9 A;  4I40 A;  5EQ8 A;  5ESY A;  1KA1 A;  2Q74 A;  4GBW A;  1RDY A;  3RPL B;  1Q9D A;  2FVZ A;  1FPD A;  1YXI A;  4FBP A;  4GWS A;  1FBE A;  1FBG A;  4N81 A;  5T3J A;  2HHM A;  1EYK A;  1NUY A;  3BIH A;  4I3Y A;  3RYD A;  4HE0 A;  5ET6 A;  1NUX A;  3D1R A;  5A5L A;  2QVR A;  1FPK A;  1FPE A;  1FPB A;  1G0H A;  4GWW A;  5F24 A;  1FBC A;  2R8T A;  2QFL A;  1LBW A;  1K9Y A;  2FHY A;  3KC1 A;  2WBD A;  2FIX A;  2GQ1 A;  3LV0 A;  4G61 A;  1FBH A;  2Y5L A;  3FBP A;  2QVV A;  1G0I A;  1DCU A;  1KA0 A;  1IMD A;  2Y5K A;  3T0J A;  2CZH A;  2FIE A;  1KZ8 A;  4I3E A;  5ET7 A;  2CZK A;  3IFC A;  2F3D A;  4GWY A;  1FPL A;  1FPI A;  5LDZ A;  3IFA A;  4HXV A;  1FSA A;  2OWZ A;  1LBY A;  4KXP A;  1IMF A;  1EYI A;  1IME A;  1DK4 A;  4GWZ A;  1YYZ A;  5EQA A;  1D9Q A;  1BK4 A;  2JJK A;  2Q8M A;  2QVU A;  4GWU A;  1VDW A;  1K9Z A;  1LBZ A;  4GWX A;  1FJ9 A;  2PCR A;  5EYG A;  3KBZ A;  2P3N A;  4QXD A;  1AWB A;  1NV7 A;  3KC0 A;  1NV3 A;  4AS5 A;  4GX6 A;  1YZ0 A;  1FPF A;  4H45 A;  5ET8 A;  4GX3 A;  1FBD A;  4H46 A;  1NUW A;  1RDX A;  1NV6 A;  1LBX A;  1QGX A;  5FBP A;  1EYJ A;  4GX4 A;  1IMB A;  1DBZ A;  5EQ9 A;  4MJO A;  2F3B A;  5DW8 A;  1CNQ A;  1LBV A;  5I3S A; 
#chains in the Genus database with same CATH topology
 3B6W A;  1OQG A;  4OER A;  3S2V A;  5CBR A;  3U93 A;  3EKI A;  3R6U A;  4OFJ A;  4MNC A;  1SPI A;  3KN8 A;  5I5P A;  2DE2 A;  1QKA A;  4OFO A;  3KSX A;  3QMF A;  1FBP A;  1UTH A;  2KQZ A;  1MRP A;  5IZ1 A;  3ZSF A;  5EYH A;  1N0T A;  4RY1 A;  3U94 A;  3VXB A;  5F1Q A;  3MVZ A;  1S50 A;  3SET A;  5ESY A;  4R9G A;  5KCJ B;  3IX1 A;  3MP1 A;  3MZ1 A;  4R6H A;  1M5F A;  4N81 A;  2XD2 A;  2GH9 A;  4Q0C A;  1Y3N A;  3H06 B;  2XA5 A;  4BDN A;  1IXC A;  1MQH A;  4ZZE A;  3PUW E;  3OO8 A;  3PUZ E;  2O6A A;  2DWJ A;  4ZDM A;  2D3I A;  3OEL A;  2XXT A;  1FBH A;  4YKI A;  2QVV A;  4ZE8 A;  3IL1 B;  4AQ4 A;  3DEL B;  2XHD A;  2VP1 A;  1SQY A;  1LFH A;  3ONM A;  4F3S A;  2X7Q A;  1TFD A;  3ISP A;  4EXK A;  4EQB A;  2QVU A;  5CBS A;  4IB2 A;  4YIC A;  2ESN A;  1B3E A;  3PGF A;  3E13 X;  3KGC A;  3FD3 A;  4QXD A;  2H5Y A;  3OSQ A;  1AWB A;  3MVY A;  3H6U A;  4MCO A;  5CMM A;  1LBX A;  1JQF A;  3VVD A;  2RF1 A;  5AA3 A;  2XXK A;  4JSD A;  1A40 A;  3GZG A;  3VFJ A;  5H8Q A;  1NV1 A;  2QMX A;  3GXA A;  1S7Y A;  3KBR A;  3HHG A;  4KHZ E;  4KQP A;  2BJI A;  3FJG A;  3G3G A;  4TLM B;  4XXU A;  1ZMG A;  1VSO A;  1FQB A;  4PAI A;  4YKK A;  1IZ1 A;  3M8U A;  4C1U A;  5EQ7 A;  3TCF A;  4ZZA A;  5ISU A;  2RCB A;  3G7W A;  3EN3 A;  3MP6 A;  2PYY A;  1FPJ A;  2VD2 A;  2GHA A;  3TTL A;  2RIN A;  5EYF A;  4TLL B;  5L9S A;  3EHT A;  3WAF A;  3K1P A;  2KLF A;  2HHM A;  3G3F A;  4O3A A;  1B3L A;  4ECF A;  1FPK A;  4F1V A;  3E9X A;  3FIR A;  5AA2 A;  2B3F A;  3H6T A;  2YLN A;  2I48 A;  1II5 A;  5TP9 B;  4G8H A;  1MPC A;  3Q29 A;  5KDT B;  3E79 A;  1MM6 A;  3EQ1 A;  1IMD A;  2L5V A;  3W9V A;  2A5S A;  1SI1 A;  1MY0 A;  4KXP A;  3T66 A;  4X1B A;  1SVX B;  5I59 A;  4KYE A;  2Q8M A;  2I0C A;  1VFD A;  3ILT B;  1LBC A;  3MVW A;  2NWJ A;  2HQ0 A;  3G3I A;  1YAE A;  2Y7I A;  3O97 A;  1M5B A;  2O84 X;  1SW1 A;  3FGS A;  2ZZV A;  3CG1 A;  4KYS A;  2F3B A;  3O6G A;  1JET A;  5CMK A;  3VXC A;  5A5X A;  2F7A A;  4FEB A;  3GBA A;  4R2F A;  1BKA A;  4QFO A;  5DVF A;  2CZI A;  1PEB A;  4F2O A;  3NOH A;  2D5W A;  2R9J A;  1B7H A;  4MX6 A;  1UTH B;  4KPT A;  1LST A;  3CIJ A;  1PB9 A;  4MMP A;  2XXX A;  4ND9 A;  2HEU A;  4JBZ A;  2Q74 A;  5L9O A;  4Q8R A;  4FBP A;  2UVI A;  2V93 A;  1NL5 A;  4IO3 A;  2HXW A;  4NED A;  3D1R A;  3V5A A;  4PQJ A;  4OVJ A;  4GWW A;  2Z8F A;  2PT2 A;  2F5X A;  5CM6 A;  3CHG A;  2GQ1 A;  4G77 A;  3T93 B;  1KA0 A;  2Y5K A;  4YKP A;  2ABH A;  3O6H A;  2ONR A;  3K6W A;  3HHF A;  4IO2 A;  4ONY A;  1OMP A;  2OWZ A;  3KN3 A;  1QUL A;  3LSF B;  5JK4 A;  4H67 A;  4N91 A;  4GWZ A;  2JJK A;  1BK4 A;  4QHQ A;  1GR2 A;  1TFA A;  3T9V A;  5AA4 B;  3EPE A;  1JW5 A;  4RNS A;  2ANJ A;  1MY1 A;  1J1N A;  4RK9 A;  4F29 A;  1LB8 A;  1OLA A;  4H6D A;  3MST A;  4RXL A;  2PMS A;  4HCW A;  4JDF A;  2ZYK A;  4PFI A;  1DMB A;  2O51 A;  3IOW A;  3PMV A;  3O6I A;  1MQD A;  3FVO A;  2REG A;  4NX1 A;  4XFE A;  5I56 B;  4BDM A;  1OQH A;  1Y9U A;  1NNK A;  3OXN A;  1LEV A;  1VE4 A;  1XVY A;  2WEF A;  1N04 A;  4KFQ A;  2I0B A;  1IXH A;  1XT8 A;  2I6E A;  1NUZ A;  4PE3 A;  4JB7 A;  2DWI A;  4PFT A;  4HTG A;  1B46 A;  3U1O A;  4NF6 A;  1FTA A;  4QFL A;  1Q35 A;  2AL5 A;  4OEU A;  4NAP A;  4X48 A;  4PGP A;  3MJN A;  1O63 A;  1RYX A;  2XXV A;  3CG3 A;  4NTL A;  3BKI B;  2VGQ A;  2Y7W A;  5AA2 B;  2NUV A;  2XXR A;  1DTZ A;  4NG7 A;  4EF1 A;  2DS9 A;  3PU5 A;  3HST A;  2DXY A;  1MXW A;  2F3D A;  5LDZ A;  4G4P A;  3TYH A;  3LSW A;  2ONK E;  1B9J A;  4ISU A;  1Q1K A;  5I59 B;  1MXU A;  1DPP A;  3T9U A;  4H1X A;  1EZ9 A;  1R9Q A;  3RQT A;  1O64 A;  1FPF A;  4BDQ A;  4F1U A;  2DP8 A;  2WYP A;  2UXA A;  4DCX A;  3D4G A;  3TKD A;  4QFN A;  4R72 A;  3N5L A;  4MNI A;  4GBV A;  4MLV A;  3QUF A;  2DDK A;  5A5X B;  1RKM A;  4OAN A;  3IB2 A;  4FIM A;  1A8F A;  4PF8 A;  2F78 A;  1NH7 A;  5I84 A;  4OHN A;  3TZA A;  4U21 A;  1US4 A;  3TTN A;  4YMA A;  5FTI A;  2OWS A;  4P0I A;  4Z0I A;  2X26 A;  1Z7N E;  4MLQ A;  2PT1 A;  2ZNS A;  5DVI A;  5J1D A;  4F39 A;  1LAF E;  5IZZ A;  3MYU A;  3CSB A;  4GVO A;  3FXR A;  2ALU A;  4G61 A;  2WX9 A;  3FBP A;  4PFU A;  3KOS A;  4PGN A;  4ELQ A;  3MW0 A;  2M8C A;  3MBP A;  4OQO A;  3PUY E;  1UIV A;  1TWY A;  2VD3 A;  1EYI A;  3FV2 A;  3MZ9 A;  4QSC A;  2HFB A;  3V83 A;  4GXS B;  3SDF A;  5IGA A;  3MZB A;  4DZ1 A;  1NV7 A;  2GFE A;  3KC0 A;  1EZP A;  1FBD A;  2V4C A;  5L8D A;  4TQU Q;  3K02 A;  2Q2C A;  1H43 A;  1FQD A;  1B3F A;  4YAH X;  4MIJ A;  1IIW A;  3DLN A;  4O7I A;  2RKM A;  2Y84 A;  1B7Z A;  5FTH A;  3CI8 A;  5LOM A;  3BBR A;  3N26 A;  4N13 A;  4GD5 A;  2YPN A;  2QS3 A;  3MAM A;  3C33 A;  1TT1 A;  3KJT A;  1FJ6 A;  1N3X A;  3ILU B;  4OVS A;  3LSL A;  1YTV A;  3CFX A;  4DXU A;  4I40 A;  3EF7 A;  4NF6 B;  5DT6 A;  3GYY A;  1LBB A;  4LQ5 A;  4Q5T A;  2HZL A;  3THI A;  4I3Y A;  3RGY A;  4U22 A;  2P1S A;  3PD9 A;  5A5L A;  4PET A;  1MXX A;  1FPE A;  4PBH A;  2Q8J A;  4N07 A;  1BLF A;  1LAG E;  2Y5L A;  2I58 A;  4JVI A;  3JV9 A;  5H8H B;  3K01 A;  4XIG Q;  5I7I A;  2O7U A;  4I1D A;  3IOR A;  4P8B A;  1B32 A;  4XKP A;  2FYI A;  3CR9 A;  1QKB A;  3SES A;  3CRB A;  1LBY A;  2XXQ A;  1IME A;  3RY3 A;  3KFM A;  4NWC A;  4E0X A;  3F11 A;  3FAS A;  1LCF A;  3U8Q A;  2DWH A;  1FJ9 A;  4XKQ A;  2Y7P A;  3KBZ A;  2X7P A;  1EZO A;  2B4M A;  4N6D A;  4GQO A;  4K3F A;  4U4X A;  4GX3 A;  1LCT A;  1NV6 A;  3C31 A;  4R75 A;  4P56 A;  1ZTY A;  3TEL A;  1B5I A;  1NNP A;  3TQW A;  3SEY A;  3ROJ A;  3A29 A;  3PD8 A;  4GL0 A;  4QBA A;  4FE8 A;  1PC3 A;  4H0W A;  1AOV A;  1B4H A;  3EHU A;  4HE2 A;  3SKP A;  4UA8 A;  4WED A;  3MP8 A;  1B5H A;  2UYF A;  4LA9 A;  4FAJ A;  3FJ7 A;  4OMB A;  5HBC A;  4EQ9 A;  4OWD A;  4JWX A;  5J16 A;  4R73 A;  3IOV A;  5EQ8 A;  1HSL A;  3E4R A;  2O1L A;  4WXJ A;  2GHB A;  3QUJ A;  1FQE A;  4P3L A;  4TOZ A;  3IOT A;  5T3J A;  4NF4 A;  4DE8 A;  4OVQ A;  4OVT A;  4HE0 A;  2HPG A;  1P1N A;  4U2R A;  4KYD A;  3LR1 A;  1FBC A;  2R8T A;  2F97 A;  2QFL A;  1B0L A;  4HS7 A;  4M4G A;  3LV0 A;  1SD3 A;  2Z8D A;  5CMC A;  1DCU A;  4NE4 A;  3K6U A;  3L6H A;  5ITO A;  3RT6 B;  1P1W A;  4ZS9 A;  2CZK A;  2DSF A;  1R9L A;  2F6P A;  5LTC A;  2W7Y A;  4BLA A;  3MPK A;  3TTR A;  4Q30 B;  2OJT A;  3K2D A;  1US5 A;  1NMU A;  4HCY A;  1Y4C A;  4YB7 A;  1ZLQ A;  4OYV A;  2H9B A;  1URS A;  1A8E A;  1NUW A;  3PPQ A;  2F7C A;  1Y3Q A;  1DBZ A;  3O28 A;  4YZZ A;  5DTB A;  3MVX A;  1WOD A;  1IIT A;  3FUZ A;  2F34 A;  2DYX A;  1MM7 A;  2DVC A;  4F3B A;  2WYK A;  3N6U A;  1H76 A;  4LAT A;  1SDX A;  3ZS6 A;  3G3K A;  4ESW A;  1FRP A;  2ZXT A;  2UYE A;  4IY5 A;  1MDQ A;  2HAU A;  1SI0 A;  4DI4 B;  4GL8 A;  5JTY B;  3LUZ A;  2R6G E;  1INP A;  1NI9 A;  2B4L A;  1RDY A;  2XXH A;  4XF5 A;  2Z23 A;  4ZEB A;  4GWS A;  1MY3 A;  1I6A A;  3BIH A;  4U1O A;  4X9T A;  4MFI A;  2QVR A;  5DYH A;  3S9E A;  4PFR A;  4U4S A;  2XWO A;  4OES A;  2BJJ X;  5B7D A;  2H98 A;  3UIF A;  4H5F A;  3IAZ A;  4QRZ A;  4YU0 A;  1N84 A;  2IEE A;  2CZH A;  3VVF A;  5HPQ A;  3SZP A;  4FJP A;  1H45 A;  2I4C A;  4Z7E A;  1JEV A;  1FTM A;  3PMX A;  4PFB A;  1USY E;  4U1Z A;  3D4C A;  4H8J A;  1XHY A;  1JW1 A;  4PAF A;  1LGB C;  4FEC A;  5EHS A;  3T22 A;  1JEU A;  4IGR A;  1P1U A;  3UOR A;  4GX6 A;  4NF8 A;  2IA4 A;  1A55 A;  2E1S A;  4QFP A;  5ITP A;  4H46 A;  4MBP A;  3O29 A;  1MXZ A;  4MJO A;  1SW2 A;  3QK6 A;  2Z8E A;  4QFK A;  3C34 A;  2DXR A;  3K00 A;  4O94 A;  3MPL A;  4IR8 A;  3C9H A;  4JVC A;  3IB1 A;  1NV4 A;  4JVD A;  3A3C A;  4MF3 A;  5H8N A;  4F22 A;  1B5J A;  3KN7 A;  1XI6 A;  5IAI A;  1MDP 1;  2O69 A;  1MXY A;  3TUS A;  4P1L A;  2F36 A;  5H8F A;  3E3K A;  2PFZ A;  2ZYM A;  3KJ7 A;  3IOU A;  2F35 A;  2G93 A;  4GBW A;  2PBW A;  2QPQ A;  5H8Q B;  2KR0 A;  1YXI A;  3BFU A;  3OOA A;  1FBG A;  3H03 A;  2QSX A;  4R2B A;  4OEN A;  4MH5 A;  4NF4 B;  1B3G A;  2O7I A;  3UK4 A;  2XXP A;  3C4M A;  4F3G A;  3FXQ A;  1KWH A;  3O9P A;  3ODB A;  1CE2 A;  3KEI A;  4LZ5 A;  5I2N A;  3PUX E;  4PFY A;  1SW4 A;  2VHA A;  2V84 A;  1DOT A;  5I58 A;  2QL3 A;  1D9Q A;  3K6X A;  1FW0 A;  3FXB A;  1GGG A;  2RC9 A;  1LBZ A;  1B58 A;  4F2Q A;  4JXI A;  1MPD A;  4G8N A;  2P3N A;  3KG2 A;  3W9W A;  1FTJ A;  4FOR A;  4EQ7 A;  1NFT A;  3PPO A;  1T0K A;  5AA2 D;  1P99 A;  2OCU A;  5DW8 A;  3FJM A;  2Q89 A;  5IM2 A;  2NOO A;  3IR1 A;  5I3S A;  3AXF A;  1AMF A;  1QUI A;  3BIG A;  3R26 A;  3OD7 A;  1FPG A;  1ZU0 A;  1I6B A;  4PC9 A;  5ICQ A;  3K4U A;  1M5C A;  2PFY A;  5IZ3 A;  4NGU A;  3O66 A;  3G3H A;  4ZE9 A;  3ECR A;  3VE1 B;  1N3W A;  4DDD A;  2QJE A;  1URD A;  1IMA A;  3I3V A;  2OPD A;  4KI0 E;  1B1X A;  5JEI A;  2UVG A;  1FQA A;  5ET6 A;  2ZMB A;  1OVB A;  4DLD A;  3TCG A;  2RCA A;  1JVX A;  4GF8 A;  2DQV A;  1EH3 A;  2XD3 A;  3TEP A;  4LZ7 A;  4BDO A;  2DOJ A;  5I2K A;  2LAO A;  4N6K A;  2FIE A;  3IFC A;  4IO4 A;  1XVX A;  1FPI A;  5DEX A;  3MWB A;  3PPR A;  2PVU A;  4UAB A;  4XEQ A;  1UIU A;  5EQA A;  2CEX A;  4O7M A;  4PFW A;  4GWX A;  4KCC A;  4DCY A;  2HZK A;  1RYO A;  2MKZ A;  3W15 C;  2REJ A;  4NWD A;  3TPA A;  4H45 A;  3PPN A;  3PPP A;  4MHF A;  4NF8 B;  2XXI A;  3JZJ A;  3G3J A;  4RJZ A;  3VVE A;  3DP6 A;  4WKM A;  4LP2 B;  2PX1 A;  1FBF A;  3RPW A;  2YJP A;  4ELR A;  5FHN A;  2H4I A;  3VV5 A;  3RTW B;  5IKB A;  4I62 A;  2A5T A;  1JVY A;  3VDF A;  1POY 1;  2DVZ A;  5H8N B;  1ZKB A;  4BDR A;  2UVJ A;  4LN5 A;  3K6V A;  3IO6 A;  1R6Z A;  2D21 A;  2P0S A;  3FXU A;  4RPO A;  1RDZ A;  2H99 A;  5H8F B;  4GIZ A;  2F8D A;  1PB8 A;  1Y4T A;  3LSX A;  4LUB A;  3S9N C;  3RPL A;  1H44 A;  3LC8 A;  4ESX A;  1JW4 A;  3SEX A;  4GLI A;  1S9T A;  1SYH A;  4NF0 A;  3BFT A;  3S4U A;  4C1T A;  1EYK A;  4HW8 A;  2XWI A;  4QF9 A;  3Q27 A;  4EUO A;  1MQI A;  2Q2A A;  1QUJ A;  2VPN A;  3HV1 A;  2DE4 A;  3OEN A;  4IGT A;  2WBD A;  3HN0 A;  1EU8 A;  1Y1M A;  4QSD A;  5CMB A;  3SEU A;  1O7T A;  1LB9 A;  1HSJ A;  3K1N A;  3KZG A;  2O68 A;  5ET7 A;  2Z22 A;  4F31 B;  5H8S A;  4ZED A;  5I58 B;  3SEW A;  1PBQ A;  2ZZW A;  1B51 A;  3B6Q A;  3P7I A;  4GWU A;  3OEM A;  3OO9 A;  4ZEK A;  3IK6 B;  3IO4 A;  3CVG A;  1WDN A;  3LUY A;  3L6G A;  1XC1 A;  4NQ8 A;  1NV3 A;  3VLU A;  1FCK A;  4ELO A;  3HCQ A;  1IXG A;  3T1B A;  1A54 A;  1QGX A;  4P11 A;  5K2X A;  3TDJ A;  1CNQ A;  4P1E A;  4LON B;  3RN8 A;  1XS5 A;  2NXO A;  1NV5 A;  3ZKK A;  2RC7 A;  4FAT A;  4R9F A;  1D9Y A;  3UA8 A;  5CC2 A;  4NHB A;  3S9M C;  1QW0 A;  1SYI A;  2P3V A;  1Z7M E;  4GOT A;  1FTO A;  1IQ7 A;  4DIG A;  1ATG A;  2R71 A;  5ICT A;  5ET5 A;  1NV2 A;  5IZ3 B;  2Q9T A;  4OTE A;  3U72 A;  4AS4 A;  3IJO B;  4KR5 A;  4RPN A;  4IO7 A;  1I69 A;  1VFE A;  2OX3 A;  5FHO A;  4NMY A;  2OWT A;  1POT A;  4N4U A;  4YB6 A;  1DTG A;  3SEV A;  3DP8 A;  2WKY A;  4F18 A;  3GLB A;  1UQW A;  5AA4 A;  3H3G A;  4IO6 A;  4X8R A;  1YPN A;  1AH5 A;  4N8Y A;  5EHM A;  4OET A;  1N7W A;  2HAV A;  1YCJ A;  1FTK A;  1KZ8 A;  1NKX A;  4X04 A;  5I2K B;  3M3F A;  1MG1 A;  3H7M A;  1B2H A;  5DEX B;  2I4B A;  4O3B A;  4PDH A;  3TQL A;  2XX9 A;  3ZKL A;  1YYZ A;  1VDW A;  5I56 A;  1MY4 A;  2Q88 A;  2G29 A;  1LFI A;  2PCR A;  1BIY A;  5TPA A;  5EYG A;  1OIB A;  1LAH E;  5F7V A;  1ZJL A;  1QJM A;  1BTJ A;  3DP4 A;  4R6Y A;  1SBP A;  5FBP A;  1EYJ A;  3E78 A;  5EQ9 A;  4G68 A;  3B6T A;  1N7X A;  4XKN A;  1NH8 A;  1F9B A;  2VOZ A;  4BDL A;  4R74 A;  1UTB A;  5B70 A;  4N17 A;  3SER A;  4ZEI A;  3USD A;  1JP4 A;  1B7U A;  2A5T B;  4ZEF A;  4N8G A;  2CMO A;  3OSR A;  1IUD A;  2ZYN A;  1B6H A;  1MQJ A;  3QIM A;  2FNC A;  3RPL B;  3JYR A;  4POX A;  4O3C A;  2V3Q A;  4NN3 A;  1MXV A;  2NVU B;  2OBG A;  4G2Z A;  1MH3 A;  1A99 A;  4E0W A;  1FQF A;  4OFL A;  1K9Y A;  4C0R A;  5K2Y A;  4L17 A;  2CEY A;  4UAC A;  5FHM A;  4I3E A;  2RC8 A;  5ELV A;  1HSE A;  3MUQ A;  4G68 C;  3V89 B;  1FSA A;  4NF5 A;  3EHS A;  4F19 A;  1D4N A;  1B40 A;  1B52 A;  4IY6 A;  1AIV A;  1DK4 A;  3C36 A;  1ZIU A;  1NNF A;  2ZYO A;  1DSN A;  3UP9 A;  4I8C A;  1MPB A;  4AS5 A;  1LLS A;  3QSL A;  2E0S A;  3TFL A;  3S9L C;  4P0G A;  1CB6 A;  1GVC A;  1WVJ A;  4F1Y A;  4YB5 A;  1LBV A;  5AA1 A;  3A09 A;  4H65 A;  5KZT A;  3HO7 A;  2FBP A;  3I5O A;  1TXF A;  2V3T A;  2I3V A;  3N94 A;  5CI5 A;  2WBB A;  4PTK A;  2P2A A;  4KD5 A;  1NV0 A;  4EDP A;  4HE1 A;  3PMW A;  4OVR A;  1OLC A;  2OLB A;  4FED A;  3K0V A;  1R1N A;  4MAG A;  2VT5 A;  4U23 A;  2VPO A;  1L5T A;  1Q9D A;  2FVZ A;  1B1H A;  5TU0 A;  3RTF B;  1FBE A;  3VLV A;  1Y3P A;  3T96 B;  2QRY A;  2QMW A;  1MQG A;  1NUX A;  4R6K A;  2F6G A;  3K1M A;  1G0H A;  4PF6 A;  1D3K A;  2XXW A;  4RA1 A;  3PV0 E;  4IO5 A;  4KCD A;  3KC1 A;  4OVP A;  3CFZ A;  2B65 A;  4OXV A;  2GRV A;  4LZ8 A;  4GWY A;  1FPL A;  3HFU A;  1IEJ A;  3FVK A;  4WEP A;  5HM4 B;  2H25 A;  3Q26 A;  1XOC A;  4OZ9 A;  1K9Z A;  2I49 A;  2ZNT A;  3PUV E;  2UVH A;  5TPA B;  2QS1 A;  5I57 A;  4JWO A;  5M2V A;  4RYA A;  1AL3 A;  4AB5 A;  2XXY A;  3HPI A;  4PBQ A;  4G8M A;  1Y20 A;  1H3D A;  4G68 B;  3I6V A;  3FVG A;  3TMG A;  1I6Q A;  2HCA A;  3M3K A;  4PP0 A;  4ZEC A;  2FA7 A;  2F7B A;  4YKJ A;  1UTB B;  2AYS A;  3LBS A;  1M5E A;  4F3P A;  4ELP A;  4MNP A;  3FVN A;  2OPE A;  1N76 A;  5CRY A;  3KSJ A;  4H5G A;  3H6W A;  1A7L A;  1D9V A;  2OK2 A;  3RLF E;  1OVT A;  4EXL A;  5H8H A;  5L9M A;  3B50 A;  5KCJ A;  4O8M A;  5BUU A;  2B3B A;  1KA1 A;  3M3L A;  3MQ9 A;  2ZZX A;  2XX8 A;  1M5D A;  2THI A;  4QSE A;  5AE4 A;  1LAX A;  1FPB A;  1B4Z A;  3QXM A;  2DWA A;  2FHY A;  5BWJ A;  2ZNU A;  3UGW A;  2FIX A;  1FTL A;  4I9D A;  3TOD A;  2ONS A;  3PTY A;  3FV1 A;  3C35 A;  4N6P A;  3MC2 A;  3H6V A;  2O1M A;  3TTM A;  3OEK A;  1PDA A;  4NF5 B;  4PCD A;  4JWY A;  3CSG A;  4PE5 B;  3QAX A;  4XTC Q;  1MY2 A;  3Q25 A;  1PBP A;  3B7D A;  1ELJ A;  1SW5 A;  3QYT A;  4OA4 A;  1YZ0 A;  4POW A;  1B05 A;  1RDX A;  4GFR A;  4N15 A;  2AL4 A;  4GX4 A;  3GBB A;  1FQC A;  3C32 A;  2QS2 A;  3T9H B;  1GTK A;  4PAK A;  4AB6 A;  3FZV A;  4LVQ A;  3TAJ A;  5DVJ A;  4M1V A;  1P1O A;  1QUK A;  1IXI A;  2I3W A;  3V8X B;  3TTK A;  4YMB A;  3B8B A;  2XXU A;  1P1Q A;  4X1D A;  3R7X A;  3U92 A;  1MS7 A;  1IMC A;  1BP5 A;  1PB7 A;  4GXA A;  1ANF A;  3KOT A;  4MEV A;  3WAE A;  2CZL A;  4LQ2 A;  1LFG A;  4JSO A;  4P47 A;  3DM0 A;  1FPD A;  2HXR A;  3N6T A;  3H4Z A;  1B3H A;  1DPE A;  1NNT A;  3TCH A;  2Y7K A;  1NUY A;  3A3U A;  4RK2 A;  3RYD A;  3IJX B;  5F24 A;  5TP9 A;  3RUM A;  1LBW A;  5KDT A;  1GV8 A;  2OZZ A;  3OMB A;  1G0I A;  3RT8 A;  2XWV A;  3T0J A;  2XWK A;  2XX7 A;  1ZBM A;  4XKR A;  1B0H A;  3IFA A;  4HXV A;  1JNF A;  4THI A;  4EF2 A;  3CFL A;  4PDD A;  4GRK A;  1IMF A;  3OO6 A;  2QS4 A;  1USY H;  3O2A A;  2AIX A;  2V3U A;  4DXB A;  4DI3 D;  1Y1Z A;  3RNN A;  3T9X B;  1MH4 A;  3UN6 A;  3U65 A;  3IB0 A;  4P9K A;  5I2N B;  5ET8 A;  2Y7R A;  5I57 B;  3OO7 A;  1URG A;  1QVS A;  4GWO A;  3VLW A;  1IMB A;  4H8I A;  3Q28 A;  2DE3 A;  1VR5 A;  5JTY A;  4DXC A;  3FAT A;  4OEV A;  2V25 A; 
#chains in the Genus database with same CATH homology
 4GBV A;  4O94 A;  2DDK A;  4IR8 A;  3EKI A;  4JVC A;  1NV4 A;  4JVD A;  4N17 A;  4OAN A;  4MNC A;  1SPI A;  5I5P A;  4PF8 A;  1JP4 A;  2DE2 A;  1XI6 A;  3QMF A;  4P1L A;  1FBP A;  2KQZ A;  4N8G A;  5IZ1 A;  5EYH A;  2PFZ A;  5ESY A;  4GBW A;  2QPQ A;  3RPL B;  2KR0 A;  1YXI A;  1FBG A;  4N81 A;  2V3Q A;  4NN3 A;  5J1D A;  2XA5 A;  5IZZ A;  3MYU A;  1K9Y A;  4G61 A;  2WX9 A;  1FBH A;  3FBP A;  2QVV A;  4PGN A;  2CEY A;  4I3E A;  1FSA A;  4F19 A;  3ISP A;  1EYI A;  1DK4 A;  1D9Q A;  2QVU A;  3FXB A;  1LBZ A;  4YIC A;  5IGA A;  2P3N A;  4QXD A;  1AWB A;  1NV7 A;  3KC0 A;  3W9W A;  4AS5 A;  1FBD A;  2V4C A;  4MCO A;  1LBX A;  5DW8 A;  5IM2 A;  1LBV A;  5I3S A;  2XXK A;  4MIJ A;  1NV1 A;  4O7I A;  3BIG A;  1FPG A;  2BJI A;  4PC9 A;  2FBP A;  4PAI A;  2PFY A;  5IZ3 A;  4NGU A;  2WBB A;  4PTK A;  5EQ7 A;  1NV0 A;  1FJ6 A;  4OVS A;  4HE1 A;  4OVR A;  1FPJ A;  4MAG A;  1IMA A;  2VT5 A;  4I40 A;  2VPO A;  1Q9D A;  2FVZ A;  3GYY A;  1FBE A;  2HHM A;  2HZL A;  4I3Y A;  5ET6 A;  1NUX A;  5A5L A;  4PET A;  1FPK A;  4F1V A;  1FPE A;  1G0H A;  4PF6 A;  4PBH A;  3KC1 A;  2Y5L A;  4JVI A;  4OVP A;  3E79 A;  5I7I A;  1IMD A;  2L5V A;  4N6K A;  2FIE A;  4P8B A;  3W9V A;  3IFC A;  4GWY A;  1FPL A;  1FPI A;  3HFU A;  1LBY A;  4KXP A;  4UAB A;  4XEQ A;  1IME A;  5EQA A;  2Q8M A;  2CEX A;  4O7M A;  1K9Z A;  4GWX A;  1FJ9 A;  3KBZ A;  2HZK A;  2MKZ A;  2B4M A;  4N6D A;  4H45 A;  4GX3 A;  4MHF A;  1NV6 A;  2ZZV A;  2F3B A;  4P56 A;  4PBQ A;  3ROJ A;  3A29 A;  4QBA A;  1FBF A;  2CZI A;  2DVZ A;  3NOH A;  4HE2 A;  4LN5 A;  4MNP A;  4MX6 A;  1RDZ A;  3B50 A;  5J16 A;  4O8M A;  3RPL A;  4MMP A;  5EQ8 A;  1KA1 A;  2Q74 A;  4FBP A;  2ZZX A;  4NF0 A;  4P3L A;  5T3J A;  1EYK A;  4OVQ A;  2XWI A;  4OVT A;  4HE0 A;  3D1R A;  2HPG A;  1FPB A;  4GWW A;  1FBC A;  2R8T A;  2VPN A;  2QFL A;  2DE4 A;  2FHY A;  2F5X A;  5CM6 A;  2WBD A;  2FIX A;  3CHG A;  2GQ1 A;  3LV0 A;  1DCU A;  1KA0 A;  2Y5K A;  3PTY A;  5ET7 A;  2CZK A;  2OWZ A;  2ZZW A;  5JK4 A;  4PCD A;  4N91 A;  4GWZ A;  5LTC A;  2JJK A;  1BK4 A;  4GWU A;  4HCY A;  4NQ8 A;  1NV3 A;  4OA4 A;  1YZ0 A;  3T1B A;  1NUW A;  1RDX A;  4N15 A;  3MST A;  4HCW A;  1QGX A;  4GX4 A;  1DBZ A;  4YZZ A;  1CNQ A;  4PFI A;  4P1E A;  4PAK A;  1NV5 A;  4NX1 A;  4XFE A;  4M1V A;  2WYK A;  4NHB A;  3B8B A;  1LEV A;  2P3V A;  2WEF A;  1IMC A;  1FRP A;  5ET5 A;  1NV2 A;  1NUZ A;  5IZ3 B;  4PE3 A;  2Q9T A;  4DI4 B;  4AS4 A;  4MEV A;  1FTA A;  2OX3 A;  3LUZ A;  1INP A;  1NI9 A;  4P47 A;  2B4L A;  1RDY A;  4XF5 A;  1FPD A;  2HXR A;  4NAP A;  4GWS A;  4PGP A;  4N4U A;  1NUY A;  3BIH A;  3RYD A;  4F18 A;  4X9T A;  2QVR A;  5F24 A;  4PFR A;  4X8R A;  2XWO A;  1LBW A;  4N8Y A;  4NG7 A;  1G0I A;  3T0J A;  2XWK A;  2CZH A;  2XWV A;  1KZ8 A;  3SZP A;  2F3D A;  4X04 A;  5LDZ A;  3IFA A;  4HXV A;  4PDD A;  1IMF A;  4PDH A;  4PFB A;  1YYZ A;  1VDW A;  4DI3 D;  2PCR A;  4PAF A;  5EYG A;  3U65 A;  4P9K A;  4GX6 A;  1FPF A;  4F1U A;  5ET8 A;  4H46 A;  2WYP A;  5FBP A;  1EYJ A;  3E78 A;  1IMB A;  5EQ9 A;  4MJO A;  2DE3 A;  4MNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...