5EYHA

Crystal structure of impase/nadp phosphatase complexed with nadp and ca2+ at ph 7.0
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
262
structure length
262
Chain Sequence
TDKTLQQIDKLICSWLKQIDNVIPQLIMEMTTETKRHRFDLVTNVDKQIQQQFQQFLATYFPEHQLLAEEKSNAMITNEINHLWIMDPIDGTANLVKQQEDYCIILAYFYEGKPMLSYVYDYPHKKLYKAIRGEGAFCNGFKMEEPPSLKLEDAIISFNAQVMNLDTVQDLFDASFSYRLVGACGLDSMRVAKGQFGAHINTNPKPWDIAAQFLFAELLNLKMTTLDGKAIDHLKGAPFIISNKACHETVLKILNANGGYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural elucidation of the NADP(H) phosphatase activity of staphylococcal dual-specific IMPase/NADP(H) phosphatase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Inositol monophosphatase
total genus 77
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2015-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eyhA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eyhA02
1DK4A 1EYKA 1FPLA 1YZ0A 1VDWA 4I40A 2QVRA 1XI6A 4GWSA 1IMEA 3KC1A 3T0JA 2FHYA 1NV2A 5ET7A 5EQ8A 4AS4A 5LDZA 3RPLA 2FBPA 3ROJA 1KA1A 1AWBA 4HE1A 4G61A 5I3SA 3FBPA 1YYZA 2CZKA 1DBZA 4GX3A 2Y5KA 5EQAA 1NUZA 1NUYA 5DW8A 1NV5A 2GQ1A 1RDYA 1DCUA 4GX6A 2FIEA 4HE2A 2P3VA 1IMFA 2PCRA 1NV7A 1FRPA 5EYGA 1IMDA 1FSAA 4HE0A 3B8BA 4I3YA 2VT5A 4GBWA 1NI9A 1BK4A 4GWYA 1FPIA 1KZ8A 2QFLA 1NUWA 1FTAA 5F24A 1FBCA 1NV1A 4GWUA 1LBXA 4IR8A 1EYJA 1CNQA 1LBVA 1YXIA 4O7IA 5EYHA 1RDZA 4GX4A 1LBYA 3RYDA 1FBGA 3IFAA 2CZHA 2OX3A 3BIGA 4H45A 2BJIA 3KC0A 2Q8MA 1LBWA 1D9QA 1K9ZA 4PTKA 4GWZA 5IZ3B 1NV0A 1LEVA 2P3NA 4GWXA 4N81A 5EQ9A 3IFCA 2HHMA 5EQ7A 1KA0A 3A29A 1FPDA 1K9YA 1RDXA 1IMAA 2DDKA 3QMFA 3RPLB 1FJ6A 3BIHA 5A5LA 1QGXA 5T3JA 2QVUA 2F3DA 1IMCA 2F3BA 4QXDA 5FBPA 1G0HA 1FPEA 2Y5LA 4MJOA 1FPBA 1EYIA 3D1RA 1IMBA 1NUXA 1SPIA 4KXPA 5ET6A 1FPGA 1NV3A 2FIXA 5ET8A 4GWWA 5IZ3A 1FBPA 4HXVA 1FJ9A 1JP4A 1NV6A 2Q74A 1NV4A 2QVVA 2WEFA 3LUZA 2OWZA 3LV0A 4H46A 1FPJA 4I3EA 2FVZA 1G0IA 1LBZA 1FBEA 1FBHA 1FPKA 5ET5A 1FBFA 2JJKA 2WBBA 4GBVA 2R8TA 3KBZA 5J16A 4FBPA 2WBDA 5ESYA 2CZIA 1FPFA 1INPA 1Q9DA 1FBDA 4AS5A 5IZ1A
chains in the Genus database with same CATH superfamily
3PU5A 1VDWA 1RYXA 1MQJA 3PD8A 4ELPA 5EYFA 5ET7A 4Q8RA 4U4XA 2FNCA 2RF1A 2CEXA 3IJXB 4THIA 4GOTA 3H6WA 3LR1A 3O6GA 4OZ9A 1PB7A 4ZEFA 5I84A 4BDLA 4WXJA 1EZPA 1RDYA 4ESXA 1SVXB 2AYSA 2G29A 2V3UA 3G7WA 3PMWA 4Z7EA 4Q5TA 1Y1ZA 3Q26A 4GBWA 3FGSA 3MPKA 4OEUA 1SI1A 4KCDA 3WAEA 3PPQA 1HSJA 4UACA 4N17A 5CC2A 2HZLA 4ZECA 4XIGQ 5DT6A 5I2KA 5M2VA 1B40A 5I58A 4N8YA 1K9YA 3O29A 5ISUA 3BIHA 1FQCA 2DWIA 3N5LA 1IEJA 4MJOA 3TPAA 2L5VA 2CEYA 5H8QA 1NUXA 1TFAA 4F2OA 4QRZA 3CG1A 2B3BA 3V5AA 4OWDA 4QSCA 2XXVA 5CMCA 3THIA 1QW0A 1NV4A 2X26A 4QFKA 4BLAA 4MCOA 2F6PA 3PPPA 1G0IA 5H8HB 3KBZA 4XFEA 3K1MA 5IZZA 3R26A 4IY6A 1N04A 2QVRA 4MEVA 1NV2A 1LB8A 1GVCA 3PUWE 1MPBA 3RLFE 1B3FA 2ZMBA 3TUSA 3H03A 2ZZWA 3TDJA 3DP8A 2XXYA 1A8FA 3KSJA 1XC1A 1MY2A 3G3HA 4C1UA 1LB9A 2V3QA 1FBCA 4DCXA 4E0WA 1XVXA 4C1TA 3RT6B 1FTKA 1ZTYA 3T9VA 5A5XA 3IR1A 1LFGA 1T0KA 3RYDA 1SW2A 4H45A 1NH7A 1I6AA 4OVRA 4IY5A 5DEXA 2ZNUA 5K2XA 3C31A 4FIMA 3C33A 1QGXA 1II5A 2UVHA 3Q27A 5KZTA 5JK4A 3TCFA 1N7WA 1SPIA 5DEXB 3T22A 3EN3A 4R74A 3UK4A 1JP4A 1N7XA 1UTBA 2NUVA 2P2AA 2I49A 4GXAA 2F6GA 3SKPA 4UA8A 1LSTA 4P8BA 4PAFA 4F3GA 1ZLQA 4KI0E 3HHGA 1DK4A 1FPLA 3C35A 4U1OA 4EDPA 3M3KA 2F35A 4DI4B 5EQ8A 1SQYA 2GHBA 3P7IA 4IO3A 4FECA 4BDNA 5I3SA 5F1QA 3I6VA 1NUZA 3ILTB 4OANA 2ZYMA 1LBBA 2KR0A 4Q30B 2PCRA 4MAGA 3TAJA 4F22A 3FVKA 3S2VA 2Q2AA 1BK4A 2F7AA 1FPIA 4EXKA 1NUWA 1NV1A 1DTGA 1AL3A 4ISUA 4O7IA 1YXIA 2DWHA 3OO8A 4LQ5A 4NQ8A 2UXAA 1CE2A 2CZHA 3O2AA 4PTKA 3ONMA 2VPNA 2I48A 1LEVA 4GFRA 2VD2A 4NF4A 2Z23A 3T1BA 2DDKA 1XOCA 3OMBA 3K1PA 3CR9A 1R9QA 2XXUA 3H7MA 3MP6A 4BDQA 4X1DA 1IMBA 2NXOA 4EQ9A 3MSTA 2RCAA 4OXVA 1MS7A 4WEDA 1B58A 1OVBA 2H99A 3BFUA 4XXUA 1M5CA 1SW4A 4FEDA 4C0RA 3S9NC 3Q29A 5CMMA 2ZYKA 3MJNA 3EHSA 3G3IA 2OPDA 4PF8A 2XXTA 3M3LA 4HCWA 1M5DA 2DXRA 4OMBA 2HAUA 4OA4A 3ZKKA 5DYHA 1VR5A 5DTBA 1N3XA 3U72A 2OWSA 3T93B 3OELA 2XXHA 3MP1A 1IMEA 3MYUA 4PAKA 4R9FA 2B65A 3V89B 4H0WA 2NWJA 1PDAA 5KDTB 1YAEA 4PGPA 2WYPA 5I57B 2H9BA 5ICTA 2XD2A 1NFTA 5FTHA 3B6TA 1ZJLA 1P1UA 3BBRA 1FW0A 1PEBA 5LTCA 1D9YA 5KDTA 2QFLA 1WDNA 3HN0A 5AA4A 2V3TA 3RN8A 2Q2CA 2ZZXA 1LBYA 4JDFA 3D4GA 3BIGA 4K3FA 3KC0A 2Q88A 5B7DA 3PUVE 4KPTA 4I62A 3FIRA 3A29A 3IORA 3QMFA 2OZZA 3VVDA 4JSDA 2G93A 3L6GA 4FE8A 2Z8FA 2QS2A 1FPBA 4P1EA 1M5EA 1JEVA 3S9EA 3PMXA 1M5BA 2W7YA 4PFYA 4N13A 3HPIA 1SDXA 2PMSA 4HW8A 4ECFA 5ITOA 2NOOA 4IO2A 5DVFA 3LV0A 3RQTA 2FVZA 1A7LA 2DOJA 4DIGA 3A3UA 4I8CA 1UIUA 4EUOA 1NL5A 4IO6A 2A5SA 4RA1A 1KA1A 4OESA 4HE1A 1MXYA 4BDMA 4TLMB 3FJ7A 1WODA 3PV0E 1MY3A 2QMWA 2Z8EA 1Y3QA 1B3GA 3VLWA 2PT2A 5DW8A 1TWYA 4YB7A 4G77A 5I7IA 2Z22A 3MPLA 4LZ5A 4RK2A 1IMDA 3VV5A 4KHZE 1NI9A 4F3PA 4OVJA 4MHFA 2ALUA 2WYKA 1FCKA 1MQHA 1MY4A 4GX4A 1R6ZA 2VD3A 1Y20A 2DP8A 1USYE 1JETA 1ANFA 2BJIA 4AB6A 5AA1A 1D9QA 3ISPA 3ZKLA 3RPLB 4JXIA 3C4MA 5A5LA 3HFUA 1IMCA 1NH8A 5CI5A 3LUYA 1Y4TA 1H76A 4ESWA 4OFOA 4NF5B 3VDFA 4PCDA 2XXPA 4MX6A 5LOMA 1B7UA 2OBGA 3EPEA 4H8IA 4R6HA 3RNNA 1H3DA 3IK6B 4HS7A 1Z7NE 4IGTA 4F3SA 2Z8DA 4F19A 4Q0CA 5ET5A 1MY1A 5IAIA 2NVUB 4YU0A 1XVYA 1LBCA 2V25A 4XEQA 3GBBA 3FVOA 4O7MA 4TOZA 4ELQA 1PBPA 1FBDA 2O69A 4NGUA 3Q25A 4I40A 1JVXA 2Y7KA 3PPOA 4AS4A 4PBQA 1YYZA 1IXGA 1S50A 2XXQA 5IGAA 3CFXA 4U4SA 3K0VA 1TT1A 1IMFA 2QJEA 3U65A 5H8SA 1FSAA 2QMXA 3FD3A 1B5IA 5TU0A 3FV2A 3JZJA 3LSLA 1LCFA 3KJ7A 3IO4A 1L5TA 1GV8A 4FJPA 2XWKA 4QFNA 4OTEA 3QAXA 3GXAA 5EHMA 1NNKA 1UQWA 1P99A 1MM7A 4YKPA 3C34A 1R9LA 5T3JA 1GTKA 3U92A 1Y1MA 2OK2A 3IOWA 1ZBMA 4JVCA 2OPEA 1B1HA 4DZ1A 3RT8A 3MZ9A 5ITPA 1NV3A 4GD5A 3K4UA 3C32A 3Q28A 2RC8A 3QK6A 3B6QA 1JEUA 3MUQA 4YZZA 5CBSA 3HCQA 1HSEA 4I9DA 2FA7A 5AE4A 3U8QA 5CM6A 2OWZA 4ZEIA 1MG1A 5L9OA 3DP6A 1FBEA 3E3KA 4RY1A 4QSDA 3EKIA 3GLBA 3O6HA 2CZIA 3OD7A 5AA3A 1PB9A 3VVEA 4GXSB 3RPWA 3TYHA 4GWSA 1H45A 3KOTA 2O68A 1RKMA 3MVZA 3USDA 5ICQA 3C36A 3K01A 4H65A 3OO7A 3MVWA 2XXIA 3E9XA 2F97A 2XD3A 1B6HA 2R71A 2HEUA 3UN6A 4AB5A 4GWYA 4QSEA 1QKAA 2THIA 3TMGA 4PDHA 3FVGA 3VXBA 4IR8A 4N8GA 5EYHA 3FXQA 3B6WA 1RDZA 1Y9UA 3RUMA 2UVGA 4MF3A 5I56A 4FORA 4U22A 3U94A 1KA0A 3B7DA 2XXKA 1Z7ME 1MQGA 3V83A 1B3EA 4RPOA 1B51A 4JVDA 2XX9A 4XTCQ 3S4UA 4GQOA 4X9TA 2IA4A 2VGQA 4LN5A 1URGA 1MXWA 2I0CA 2DWJA 2DE2A 4NF5A 5IZ3A 1ZU0A 3JYRA 1JW5A 3VLVA 4MNIA 1PC3A 4IGRA 4KQPA 2CZLA 2XWIA 4R6YA 2PBWA 1IITA 4FBPA 2DQVA 2WBDA 4DI3D 5ESYA 1LGBC 3O28A 1Y4CA 4G8NA 1FQEA 4KYSA 3WAFA 5L9MA 1LAGE 1I6BA 1QULA 2D5WA 4QF9A 2E1SA 3PPRA 1S7YA 1ELJA 3KOSA 2UVIA 2XWOA 3T96B 2GH9A 4PE5B 2XXWA 3M8UA 3O66A 1JW1A 4ZS9A 1NV7A 1FRPA 3GBAA 5J1DA 3KGCA 4OFLA 4YKIA 5L8DA 3B8BA 3EHTA 1MXXA 4YKJA 3CI8A 4GIZA 3MVXA 5CMBA 4E0XA 4PFRA 4NX1A 4LQ2A 3IO6A 2QS1A 3G3JA 1LCTA 3QSLA 1MQIA 2Y7PA 4KYDA 4NHBA 3I3VA 5IM2A 5I59B 3FZVA 5IZ3B 1JNFA 1OVTA 5EQ9A 2XWVA 2DWAA 1NNFA 3W9WA 4PQJA 1NNPA 1EH3A 3R7XA 4NF8A 5AA2D 1B9JA 3H6UA 4JB7A 3D1RA 4EQBA 3G3FA 2O84X 1FPGA 2O7UA 5F7VA 3TCHA 3TODA 1FBPA 2I3VA 4O3AA 4LUBA 3SESA 2ZZVA 4X8RA 3K2DA 3S9LC 3D4CA 3EQ1A 1LBZA 3SEXA 2HFBA 1SI0A 5TP9A 1R1NA 4H67A 3MP8A 2DS9A 5JEIA 1B3LA 4YICA 3PUYE 1YZ0A 4DDDA 4P3LA 1XI6A 1Y3NA 3MZBA 1OLAA 1AWBA 1SW5A 2B3FA 3CRBA 1US5A 2O6AA 3H4ZA 4KFQA 1B2HA 5KCJA 1NUYA 4AQ4A 3JV9A 4MNPA 1MXZA 4ZE9A 4JWXA 2KQZA 4FEBA 3SEUA 5EYGA 1US4A 3BFTA 4HE0A 5DVIA 2KLFA 2OLBA 3OENA 3SERA 1N76A 4BDRA 1N0TA 4IB2A 1BTJA 4EF1A 3N94A 2XXXA 4FAJA 2XX7A 3LC8A 3LSXA 1VFEA 4DLDA 3E78A 1NKXA 4WKMA 4X48A 4JBZA 4GWXA 3KN3A 3ZS6A 3CSBA 3OXNA 3OO9A 1ZMGA 4KCCA 3L6HA 1OQHA 1FJ6A 4BDOA 1JVYA 3OSRA 4M1VA 1YTVA 3H6VA 3KSXA 5JTYB 3G3KA 3IOVA 2HQ0A 4GVOA 2Q89A 3MWBA 4OVQA 3CSGA 4L17A 1MPCA 3PUZE 4KR5A 1O64A 3C9HA 2GHAA 1A40A 4R2FA 3N6UA 1LLSA 4RYAA 1USYH 4NF0A 5A5XB 1LAFE 5J16A 1B3HA 3V8XB 4GF8A 2ZNSA 1RYOA 5I5PA 2QS4A 2CMOA 2Y7WA 4PFUA 2VOZA 4FATA 3TZAA 3RY3A 3T9UA 4PF6A 1MY0A 2QL3A 2P0SA 2RKMA 4PAIA 4PFIA 3KN8A 2DVCA 2ZYNA 2Y84A 5H8QB 4G2ZA 1XT8A 5IKBA 4M4GA 3VE1B 4MIJA 1MH3A 3I5OA 1URSA 4NWDA 3IX1A 2PFZA 3KN7A 3DELB 5DVJA 1H44A 1VFDA 3TQWA 5H8HA 4ZEDA 2QRYA 4YB6A 2DE3A 3TELA 4F29A 1P1OA 4PBHA 1GR2A 4I1DA 4N81A 3N26A 4RK9A 4XF5A 3FXRA 3HSTA 1QUKA 1UTBB 4KD5A 4PFWA 1B52A 4Z0IA 3AXFA 4P56A 5FBPA 4QFOA 2O1LA 4F18A 3IB0A 4XKNA 1JQFA 1EYIA 3TCGA 3E79A 1FTJA 2I6EA 3OOAA 5AA2A 4JWOA 3O97A 3SDFA 3UA8A 4EQ7A 5HPQA 2ABHA 2PT1A 1TXFA 3PGFA 4RNSA 5I2NB 3HO7A 1BIYA 1QJMA 1SW1A 3TTMA 5KCJB 3CFLA 2I0BA 1FBHA 3FVNA 3RGYA 4P9KA 3N6TA 4G68C 2E0SA 2UYFA 1B0HA 3T0JA 3RPLA 3H6TA 4POWA 1JW4A 1KWHA 4O3CA 3T9XB 2Y5KA 1S9TA 3GZGA 3OEKA 2REGA 4X04A 3DP4A 3NOHA 3U93A 3IAZA 3SEYA 3DM0A 3OEMA 1TFDA 4GL8A 5EHSA 3R6UA 4P0GA 3RTFB 2ZNTA 4PC9A 3QIMA 4DXBA 2Y7IA 2F5XA 3VVFA 4RXLA 1AMFA 4MLQA 3O9PA 3OSQA 4N6PA 1YCJA 2RC7A 1MRPA 1XHYA 3FUZA 4OVSA 1F9BA 4YB5A 4JVIA 2R6GE 1UTHB 4GWZA 1VE4A 2UYEA 1AH5A 4ZDMA 2Y7RA 1SYIA 1RDXA 1IMAA 1YPNA 1DOTA 4U23A 1DSNA 3CIJA 2PFYA 4ZEBA 1G0HA 4WEPA 3HHFA 2ESNA 2XHDA 1FQBA 1QUJA 1LFHA 4NF6A 1DMBA 4NF8B 4ZE8A 4F3BA 5K2YA 1B1XA 3FV1A 4YMBA 1WVJA 5H8NB 4NAPA 5CBRA 4I3EA 1MQDA 4NTLA 4QFLA 4PGNA 4ZZAA 3TQLA 2R8TA 4F1YA 5JTYA 3LBSA 4ND9A 1B5JA 1B32A 2HXWA 1INPA 1MH4A 3TTRA 4R9GA 2R9JA 5BWJA 2XX8A 2FHYA 4PP0A 3TKDA 3M3FA 3ROJA 4PFTA 5TP9B 4QHQA 3ECRA 5EQAA 1LAHE 4OQOA 1P1QA 2I4BA 4GX6A 3CHGA 4HTGA 5CMKA 4GLIA 4OFJA 4NF6B 1KZ8A 1POTA 1A55A 4GRKA 1EYJA 4OETA 5FHMA 4UABA 3QYTA 2DVZA 1IZ1A 2Q8MA 1LAXA 2D21A 3QUFA 2V84A 3IFCA 5H8NA 1ATGA 2REJA 5ELVA 4OEVA 2HXRA 4QXDA 4NWCA 2B4MA 4IO4A 5CRYA 4ZZEA 2HCAA 1MXUA 4R73A 3FASA 4EXLA 1Q1KA 5FHNA 2FIXA 4TQUQ 3FXBA 4P0IA 2GRVA 4PETA 3GYYA 4OVTA 4MBPA 2WEFA 2A5TA 4P1LA 5HM4B 5TPAA 2WBBA 4POXA 5I56B 3O6IA 3TTLA 2Q8JA 1FPFA 3PMVA 1FTOA 1B05A 1O63A 4N4UA 4NEDA 2ZXTA 2HPGA 4LZ7A 1MM6A 2H98A 1NNTA 3U1OA 4H6DA 2WX9A 1AIVA 1B5HA 2QPQA 4NMYA 5I2NA 2IEEA 1IXCA 4G61A 3FBPA 4G4PA 3MW0A 5I57A 2PYYA 3A3CA 4OYVA 4P47A 4RJZA 5I59A 2GQ1A 2FIEA 4PDDA 3IOUA 1MPDA 2OJTA 2V4CA 4OHNA 2H4IA 4LVQA 4R2BA 2HAVA 4XKPA 1FTAA 4R6KA 1A8EA 4GWUA 3DLNA 3CFZA 1IUDA 1LBVA 2H5YA 5H8FB 2Q9TA 2O51A 4GWOA 4JSOA 4KYEA 2OX3A 4YAHX 1K9ZA 2RINA 2DE4A 2YLNA 1BLFA 5BUUA 2H25A 5EQ7A 4N15A 1N84A 3S9MC 1DPPA 2DXYA 3T9HB 1B7HA 1PBQA 3E4RA 1D3KA 4PFBA 4XKRA 2GFEA 3K00A 3K6VA 2XXRA 3FXUA 1D4NA 4HXVA 3IJOB 4QFPA 3VXCA 2PX1A 3H3GA 1Y3PA 1H43A 4LP2B 3VLUA 1OIBA 5AA2B 2HZKA 2X7QA 5B70A 1UIVA 3MZ1A 2I58A 1Q35A 2MKZA 3KC1A 2F34A 4F1VA 5LDZA 2ONRA 3KZGA 2V93A 2OCUA 1MXVA 3IB2A 4ONYA 2CZKA 4EF2A 1IQ7A 3K6XA 4F1UA 3LSWA 3T66A 1DCUA 4LA9A 1ZIUA 4HE2A 3SEVA 2VHAA 1P1NA 3W9VA 4I3YA 1MDQA 2M8CA 3PTYA 1FQDA 3K1NA 5F24A 3MQ9A 1B7ZA 1LBXA 2QSXA 1BKAA 4OVPA 1GGGA 2F78A 3CVGA 5TPAB 1SD3A 2PVUA 3IFAA 3G3GA 2P3NA 2QS3A 3UP9A 1FPDA 3MC2A 4F2QA 4GL0A 1FQFA 3W15C 2F3DA 1B4ZA 3KFMA 2F3BA 3ODBA 1ZKBA 2D3IA 1D9VA 3EF7A 2VP1A 1FTLA 2VPOA 4O3BA 3K02A 4TLLB 1FJ9A 4U2RA 1N3WA 3QXMA 2LAOA 4OERA 3PD9A 1FPJA 1I69A 1LFIA 3K6UA 1FPKA 2F7CA 4GBVA 4R72A 5AA4B 1I6QA 4DCYA 2I4CA 3KG2A 1P1WA 4IO7A 2F7BA 4QBAA 2WKYA 3SETA 4X1BA 4ELRA 5L9SA 3ZSFA 1A54A 4MFIA 3OO6A 4N91A 2FBPA 2RC9A 3LSFB 1NMUA 1DBZA 4IO5A 4DE8A 4F31B 4YMAA 1B0LA 5FHOA 2P1SA 2F36A 3SZPA 3KBRA 2ANJA 4P11A 2VT5A 1POY1 3CG3A 2FYIA 2UVJA 3E13X 4RPNA 3QUJA 4LZ8A 3MVYA 1CNQA 4H5GA 2YJPA 1FBGA 3A09A 2BJJX 5I2KB 1EZOA 4ELOA 3RTWB 4NN3A 1B4HA 1NV0A 3ILUB 1BP5A 2HHMA 2ZYOA 3MAMA 3IOTA 3TEPA 1SYHA 4YKKA 2QVUA 2DSFA 1B46A 1QVSA 1J1NA 1FPEA 3EHUA 4DXUA 1MDP1 3HV1A 5ET6A 4R75A 4XKQA 1IIWA 1IXHA 1NV6A 1EU8A 2Q74A 3FATA 2I3WA 3F11A 1OLCA 2RCBA 4N07A 1FQAA 4G68B 1Q9DA 2O7IA 4H1XA 4LONB 4AS5A 5IZ1A 2ONSA 1FTMA 1EYKA 1IXIA 5HBCA 4PE3A 2A5TB 4MNCA 1O7TA 3MBPA 5I58B 2ONKE 4OENA 4GX3A 1NV5A 3VFJA 1M5FA 4JWYA 1CB6A 3FJMA 2P3VA 1QUIA 5H8FA 4U21A 4H8JA 4ZEKA 2B4LA 4G8MA 2O1MA 2AIXA 1EZ9A 4NG7A 1XS5A 4O94A 3SEWA 3PPNA 3KEIA 1OQGA 4N6KA 4MH5A 1SBPA 2DYXA 2OWTA 4N6DA 1A99A 1DTZA 1VSOA 3TTNA 1AOVA 1LBWA 3KJTA 2XA5A 3UORA 1PB8A 2AL5A 4F39A 3FJGA 3PUXE 1DPEA 2AL4A 3H06B 3B50A 4U1ZA 2Y5LA 1URDA 2YPNA 4MMPA 4LATA 3K6WA 4G68A 4KXPA 3UGWA 4NF4B 5ET8A 4GWWA 3TTKA 1UTHA 3IB1A 4NE4A 1QKBA 5FTIA 4HCYA 3IL1B 2QVVA 3LUZA 3BKIB 4H46A 4DXCA 1HSLA 1FBFA 2JJKA 4MLVA 2X7PA 4H5FA 1OMPA 3TFLA 4G8HA 4O8MA 2F8DA 3UIFA
chains in the Genus database with same CATH topology
1DK4A 1EYKA 1FPLA 4NGUA 1YZ0A 1VDWA 4N4UA 4YICA 2HPGA 4I40A 2QVRA 2MKZA 1XI6A 4GWSA 4P3LA 4PE3A 1IMEA 3KC1A 3T0JA 2FHYA 3MYUA 2WX9A 1NV2A 5ET7A 4MEVA 4PAKA 4DI4B 5EQ8A 4AS4A 5LDZA 3RPLA 4F1VA 4N91A 2QPQA 2FBPA 4MNCA 3ROJA 4PBQA 4PF6A 1KA1A 1AWBA 2CEXA 4HE1A 4G61A 5I3SA 3FBPA 1YYZA 2CZKA 1DBZA 4PGPA 4GX3A 2WYPA 2Y5KA 5IGAA 5EQAA 4F1UA 1NUZA 4P47A 4PAIA 2XWOA 4PFIA 1NUYA 5DW8A 4X04A 2ZZWA 1NV5A 2GQ1A 4OANA 1RDYA 4MNPA 1DCUA 5I7IA 2KR0A 4GX6A 3CHGA 2FIEA 3NOHA 5I5PA 4HE2A 2P3VA 4PDDA 1IMFA 2PCRA 2KQZA 1NV7A 4MAGA 3SZPA 3U65A 1FRPA 5EYGA 5J1DA 1IMDA 1FSAA 2B4LA 4HE0A 4MIJA 3B8BA 4I3YA 3W9VA 2V4CA 2VT5A 4GBWA 1NI9A 3PTYA 5LTCA 1BK4A 4GWYA 1FPIA 2PFZA 1KZ8A 2QFLA 4NG7A 1NUWA 1FTAA 5F24A 2V3QA 4PDHA 4PFRA 1FBCA 1NV1A 4O94A 4GWUA 1LBXA 4MHFA 4QBAA 4PBHA 4IR8A 4PC9A 4NX1A 2WYKA 4N8GA 1EYJA 4OVPA 1CNQA 1LBVA 1YXIA 4O7IA 5EYHA 2XWKA 2F5XA 2ZZXA 4N6KA 2Q9TA 1RDZA 4GX4A 4NQ8A 4N17A 1LBYA 3RYDA 4N6DA 1FBGA 3IFAA 2CZHA 2OX3A 3BIGA 4H45A 2DVZA 4UABA 2BJIA 3KC0A 4OVSA 3E78A 2Q8MA 1LBWA 2DE3A 4NHBA 4JVIA 5IM2A 1D9QA 1K9ZA 2XA5A 4NN3A 4PTKA 4GWZA 5IZ3B 2DE4A 2VPNA 1NV0A 3ISPA 2HZLA 1LEVA 2P3NA 4GWXA 4N81A 4OVRA 4XF5A 5EQ9A 3IFCA 2HHMA 5EQ7A 2XWVA 1KA0A 4N15A 3A29A 2XXKA 1FPDA 4N8YA 1K9YA 1RDXA 3T1BA 1IMAA 2DDKA 3QMFA 3RPLB 3W9WA 1FJ6A 3BIHA 5A5LA 1QGXA 5T3JA 2HXRA 2QVUA 3HFUA 2F3DA 1IMCA 2F3BA 2PFYA 4QXDA 4M1VA 4JVDA 4P56A 5FBPA 1G0HA 2B4MA 3B50A 4F18A 1FPEA 4PFBA 2Y5LA 4MJOA 1FPBA 4JVCA 4MMPA 4P1EA 4PCDA 2L5VA 1EYIA 3D1RA 2CEYA 4MX6A 1IMBA 4X9TA 5JK4A 3E79A 4LN5A 1NUXA 3MSTA 1SPIA 4KXPA 5ET6A 1FPGA 2DE2A 1NV3A 2FIXA 2VPOA 5ET8A 4GWWA 4OVQA 3FXBA 5IZ3A 1FBPA 4HXVA 4PETA 3GYYA 1FJ9A 1JP4A 1NV6A 4OVTA 4YZZA 4HCYA 2Q74A 1NV4A 2QVVA 2WEFA 3LUZA 5CM6A 2ZZVA 2OWZA 4MCOA 3LV0A 4NAPA 4PF8A 4MNIA 4X8RA 4H46A 1FPJA 4I3EA 2FVZA 1G0IA 4HCWA 1LBZA 4P1LA 4PGNA 1FBEA 2XWIA 1FBHA 1FPKA 4NF0A 5ET5A 4OA4A 1FBFA 2JJKA 4F19A 2WBBA 4GBVA 2R8TA 3KBZA 5J16A 2HZKA 4P8BA 4FBPA 4P9KA 4XFEA 3EKIA 5IZZA 2WBDA 4DI3D 5ESYA 4PAFA 4XEQA 2CZIA 1FPFA 4O8MA 4O7MA 1INPA 1Q9DA 1FBDA 4AS5A 5IZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DK4 A;  1EYK A;  1FPL A;  1YZ0 A;  1VDW A;  4I40 A;  2QVR A;  1XI6 A;  4GWS A;  1IME A;  3KC1 A;  3T0J A;  2FHY A;  1NV2 A;  5ET7 A;  5EQ8 A;  4AS4 A;  5LDZ A;  3RPL A;  2FBP A;  3ROJ A;  1KA1 A;  1AWB A;  4HE1 A;  4G61 A;  5I3S A;  3FBP A;  1YYZ A;  2CZK A;  1DBZ A;  4GX3 A;  2Y5K A;  5EQA A;  1NUZ A;  1NUY A;  5DW8 A;  1NV5 A;  2GQ1 A;  1RDY A;  1DCU A;  4GX6 A;  2FIE A;  4HE2 A;  2P3V A;  1IMF A;  2PCR A;  1NV7 A;  1FRP A;  5EYG A;  1IMD A;  1FSA A;  4HE0 A;  3B8B A;  4I3Y A;  2VT5 A;  4GBW A;  1NI9 A;  1BK4 A;  4GWY A;  1FPI A;  1KZ8 A;  2QFL A;  1NUW A;  1FTA A;  5F24 A;  1FBC A;  1NV1 A;  4GWU A;  1LBX A;  4IR8 A;  1EYJ A;  1CNQ A;  1LBV A;  1YXI A;  4O7I A;  5EYH A;  1RDZ A;  4GX4 A;  1LBY A;  3RYD A;  1FBG A;  3IFA A;  2CZH A;  2OX3 A;  3BIG A;  4H45 A;  2BJI A;  3KC0 A;  2Q8M A;  1LBW A;  1D9Q A;  1K9Z A;  4PTK A;  4GWZ A;  5IZ3 B;  1NV0 A;  1LEV A;  2P3N A;  4GWX A;  4N81 A;  5EQ9 A;  3IFC A;  2HHM A;  5EQ7 A;  1KA0 A;  3A29 A;  1FPD A;  1K9Y A;  1RDX A;  1IMA A;  2DDK A;  3QMF A;  3RPL B;  1FJ6 A;  3BIH A;  5A5L A;  1QGX A;  5T3J A;  2QVU A;  2F3D A;  1IMC A;  2F3B A;  4QXD A;  5FBP A;  1G0H A;  1FPE A;  2Y5L A;  4MJO A;  1FPB A;  1EYI A;  3D1R A;  1IMB A;  1NUX A;  1SPI A;  4KXP A;  5ET6 A;  1FPG A;  1NV3 A;  2FIX A;  5ET8 A;  4GWW A;  5IZ3 A;  1FBP A;  4HXV A;  1FJ9 A;  1JP4 A;  1NV6 A;  2Q74 A;  1NV4 A;  2QVV A;  2WEF A;  3LUZ A;  2OWZ A;  3LV0 A;  4H46 A;  1FPJ A;  4I3E A;  2FVZ A;  1G0I A;  1LBZ A;  1FBE A;  1FBH A;  1FPK A;  5ET5 A;  1FBF A;  2JJK A;  2WBB A;  4GBV A;  2R8T A;  3KBZ A;  5J16 A;  4FBP A;  2WBD A;  5ESY A;  2CZI A;  1FPF A;  1INP A;  1Q9D A;  1FBD A;  4AS5 A;  5IZ1 A; 
#chains in the Genus database with same CATH topology
 3PU5 A;  1VDW A;  1RYX A;  1MQJ A;  3PD8 A;  4ELP A;  5EYF A;  5ET7 A;  4Q8R A;  4U4X A;  2FNC A;  2RF1 A;  2CEX A;  3IJX B;  4THI A;  4GOT A;  3H6W A;  3LR1 A;  3O6G A;  4OZ9 A;  1PB7 A;  4ZEF A;  5I84 A;  4BDL A;  4WXJ A;  1EZP A;  1RDY A;  4ESX A;  1SVX B;  2AYS A;  2G29 A;  2V3U A;  3G7W A;  3PMW A;  4Z7E A;  4Q5T A;  1Y1Z A;  3Q26 A;  4GBW A;  3FGS A;  3MPK A;  4OEU A;  1SI1 A;  4KCD A;  3WAE A;  3PPQ A;  1HSJ A;  4UAC A;  4N17 A;  5CC2 A;  2HZL A;  4ZEC A;  4XIG Q;  5DT6 A;  5I2K A;  5M2V A;  1B40 A;  5I58 A;  4N8Y A;  1K9Y A;  3O29 A;  5ISU A;  3BIH A;  1FQC A;  2DWI A;  3N5L A;  1IEJ A;  4MJO A;  3TPA A;  2L5V A;  2CEY A;  5H8Q A;  1NUX A;  1TFA A;  4F2O A;  4QRZ A;  3CG1 A;  2B3B A;  3V5A A;  4OWD A;  4QSC A;  2XXV A;  5CMC A;  3THI A;  1QW0 A;  1NV4 A;  2X26 A;  4QFK A;  4BLA A;  4MCO A;  2F6P A;  3PPP A;  1G0I A;  5H8H B;  3KBZ A;  4XFE A;  3K1M A;  5IZZ A;  3R26 A;  4IY6 A;  1N04 A;  2QVR A;  4MEV A;  1NV2 A;  1LB8 A;  1GVC A;  3PUW E;  1MPB A;  3RLF E;  1B3F A;  2ZMB A;  3TUS A;  3H03 A;  2ZZW A;  3TDJ A;  3DP8 A;  2XXY A;  1A8F A;  3KSJ A;  1XC1 A;  1MY2 A;  3G3H A;  4C1U A;  1LB9 A;  2V3Q A;  1FBC A;  4DCX A;  4E0W A;  1XVX A;  4C1T A;  3RT6 B;  1FTK A;  1ZTY A;  3T9V A;  5A5X A;  3IR1 A;  1LFG A;  1T0K A;  3RYD A;  1SW2 A;  4H45 A;  1NH7 A;  1I6A A;  4OVR A;  4IY5 A;  5DEX A;  2ZNU A;  5K2X A;  3C31 A;  4FIM A;  3C33 A;  1QGX A;  1II5 A;  2UVH A;  3Q27 A;  5KZT A;  5JK4 A;  3TCF A;  1N7W A;  1SPI A;  5DEX B;  3T22 A;  3EN3 A;  4R74 A;  3UK4 A;  1JP4 A;  1N7X A;  1UTB A;  2NUV A;  2P2A A;  2I49 A;  4GXA A;  2F6G A;  3SKP A;  4UA8 A;  1LST A;  4P8B A;  4PAF A;  4F3G A;  1ZLQ A;  4KI0 E;  3HHG A;  1DK4 A;  1FPL A;  3C35 A;  4U1O A;  4EDP A;  3M3K A;  2F35 A;  4DI4 B;  5EQ8 A;  1SQY A;  2GHB A;  3P7I A;  4IO3 A;  4FEC A;  4BDN A;  5I3S A;  5F1Q A;  3I6V A;  1NUZ A;  3ILT B;  4OAN A;  2ZYM A;  1LBB A;  2KR0 A;  4Q30 B;  2PCR A;  4MAG A;  3TAJ A;  4F22 A;  3FVK A;  3S2V A;  2Q2A A;  1BK4 A;  2F7A A;  1FPI A;  4EXK A;  1NUW A;  1NV1 A;  1DTG A;  1AL3 A;  4ISU A;  4O7I A;  1YXI A;  2DWH A;  3OO8 A;  4LQ5 A;  4NQ8 A;  2UXA A;  1CE2 A;  2CZH A;  3O2A A;  4PTK A;  3ONM A;  2VPN A;  2I48 A;  1LEV A;  4GFR A;  2VD2 A;  4NF4 A;  2Z23 A;  3T1B A;  2DDK A;  1XOC A;  3OMB A;  3K1P A;  3CR9 A;  1R9Q A;  2XXU A;  3H7M A;  3MP6 A;  4BDQ A;  4X1D A;  1IMB A;  2NXO A;  4EQ9 A;  3MST A;  2RCA A;  4OXV A;  1MS7 A;  4WED A;  1B58 A;  1OVB A;  2H99 A;  3BFU A;  4XXU A;  1M5C A;  1SW4 A;  4FED A;  4C0R A;  3S9N C;  3Q29 A;  5CMM A;  2ZYK A;  3MJN A;  3EHS A;  3G3I A;  2OPD A;  4PF8 A;  2XXT A;  3M3L A;  4HCW A;  1M5D A;  2DXR A;  4OMB A;  2HAU A;  4OA4 A;  3ZKK A;  5DYH A;  1VR5 A;  5DTB A;  1N3X A;  3U72 A;  2OWS A;  3T93 B;  3OEL A;  2XXH A;  3MP1 A;  1IME A;  3MYU A;  4PAK A;  4R9F A;  2B65 A;  3V89 B;  4H0W A;  2NWJ A;  1PDA A;  5KDT B;  1YAE A;  4PGP A;  2WYP A;  5I57 B;  2H9B A;  5ICT A;  2XD2 A;  1NFT A;  5FTH A;  3B6T A;  1ZJL A;  1P1U A;  3BBR A;  1FW0 A;  1PEB A;  5LTC A;  1D9Y A;  5KDT A;  2QFL A;  1WDN A;  3HN0 A;  5AA4 A;  2V3T A;  3RN8 A;  2Q2C A;  2ZZX A;  1LBY A;  4JDF A;  3D4G A;  3BIG A;  4K3F A;  3KC0 A;  2Q88 A;  5B7D A;  3PUV E;  4KPT A;  4I62 A;  3FIR A;  3A29 A;  3IOR A;  3QMF A;  2OZZ A;  3VVD A;  4JSD A;  2G93 A;  3L6G A;  4FE8 A;  2Z8F A;  2QS2 A;  1FPB A;  4P1E A;  1M5E A;  1JEV A;  3S9E A;  3PMX A;  1M5B A;  2W7Y A;  4PFY A;  4N13 A;  3HPI A;  1SDX A;  2PMS A;  4HW8 A;  4ECF A;  5ITO A;  2NOO A;  4IO2 A;  5DVF A;  3LV0 A;  3RQT A;  2FVZ A;  1A7L A;  2DOJ A;  4DIG A;  3A3U A;  4I8C A;  1UIU A;  4EUO A;  1NL5 A;  4IO6 A;  2A5S A;  4RA1 A;  1KA1 A;  4OES A;  4HE1 A;  1MXY A;  4BDM A;  4TLM B;  3FJ7 A;  1WOD A;  3PV0 E;  1MY3 A;  2QMW A;  2Z8E A;  1Y3Q A;  1B3G A;  3VLW A;  2PT2 A;  5DW8 A;  1TWY A;  4YB7 A;  4G77 A;  5I7I A;  2Z22 A;  3MPL A;  4LZ5 A;  4RK2 A;  1IMD A;  3VV5 A;  4KHZ E;  1NI9 A;  4F3P A;  4OVJ A;  4MHF A;  2ALU A;  2WYK A;  1FCK A;  1MQH A;  1MY4 A;  4GX4 A;  1R6Z A;  2VD3 A;  1Y20 A;  2DP8 A;  1USY E;  1JET A;  1ANF A;  2BJI A;  4AB6 A;  5AA1 A;  1D9Q A;  3ISP A;  3ZKL A;  3RPL B;  4JXI A;  3C4M A;  5A5L A;  3HFU A;  1IMC A;  1NH8 A;  5CI5 A;  3LUY A;  1Y4T A;  1H76 A;  4ESW A;  4OFO A;  4NF5 B;  3VDF A;  4PCD A;  2XXP A;  4MX6 A;  5LOM A;  1B7U A;  2OBG A;  3EPE A;  4H8I A;  4R6H A;  3RNN A;  1H3D A;  3IK6 B;  4HS7 A;  1Z7N E;  4IGT A;  4F3S A;  2Z8D A;  4F19 A;  4Q0C A;  5ET5 A;  1MY1 A;  5IAI A;  2NVU B;  4YU0 A;  1XVY A;  1LBC A;  2V25 A;  4XEQ A;  3GBB A;  3FVO A;  4O7M A;  4TOZ A;  4ELQ A;  1PBP A;  1FBD A;  2O69 A;  4NGU A;  3Q25 A;  4I40 A;  1JVX A;  2Y7K A;  3PPO A;  4AS4 A;  4PBQ A;  1YYZ A;  1IXG A;  1S50 A;  2XXQ A;  5IGA A;  3CFX A;  4U4S A;  3K0V A;  1TT1 A;  1IMF A;  2QJE A;  3U65 A;  5H8S A;  1FSA A;  2QMX A;  3FD3 A;  1B5I A;  5TU0 A;  3FV2 A;  3JZJ A;  3LSL A;  1LCF A;  3KJ7 A;  3IO4 A;  1L5T A;  1GV8 A;  4FJP A;  2XWK A;  4QFN A;  4OTE A;  3QAX A;  3GXA A;  5EHM A;  1NNK A;  1UQW A;  1P99 A;  1MM7 A;  4YKP A;  3C34 A;  1R9L A;  5T3J A;  1GTK A;  3U92 A;  1Y1M A;  2OK2 A;  3IOW A;  1ZBM A;  4JVC A;  2OPE A;  1B1H A;  4DZ1 A;  3RT8 A;  3MZ9 A;  5ITP A;  1NV3 A;  4GD5 A;  3K4U A;  3C32 A;  3Q28 A;  2RC8 A;  3QK6 A;  3B6Q A;  1JEU A;  3MUQ A;  4YZZ A;  5CBS A;  3HCQ A;  1HSE A;  4I9D A;  2FA7 A;  5AE4 A;  3U8Q A;  5CM6 A;  2OWZ A;  4ZEI A;  1MG1 A;  5L9O A;  3DP6 A;  1FBE A;  3E3K A;  4RY1 A;  4QSD A;  3EKI A;  3GLB A;  3O6H A;  2CZI A;  3OD7 A;  5AA3 A;  1PB9 A;  3VVE A;  4GXS B;  3RPW A;  3TYH A;  4GWS A;  1H45 A;  3KOT A;  2O68 A;  1RKM A;  3MVZ A;  3USD A;  5ICQ A;  3C36 A;  3K01 A;  4H65 A;  3OO7 A;  3MVW A;  2XXI A;  3E9X A;  2F97 A;  2XD3 A;  1B6H A;  2R71 A;  2HEU A;  3UN6 A;  4AB5 A;  4GWY A;  4QSE A;  1QKA A;  2THI A;  3TMG A;  4PDH A;  3FVG A;  3VXB A;  4IR8 A;  4N8G A;  5EYH A;  3FXQ A;  3B6W A;  1RDZ A;  1Y9U A;  3RUM A;  2UVG A;  4MF3 A;  5I56 A;  4FOR A;  4U22 A;  3U94 A;  1KA0 A;  3B7D A;  2XXK A;  1Z7M E;  1MQG A;  3V83 A;  1B3E A;  4RPO A;  1B51 A;  4JVD A;  2XX9 A;  4XTC Q;  3S4U A;  4GQO A;  4X9T A;  2IA4 A;  2VGQ A;  4LN5 A;  1URG A;  1MXW A;  2I0C A;  2DWJ A;  2DE2 A;  4NF5 A;  5IZ3 A;  1ZU0 A;  3JYR A;  1JW5 A;  3VLV A;  4MNI A;  1PC3 A;  4IGR A;  4KQP A;  2CZL A;  2XWI A;  4R6Y A;  2PBW A;  1IIT A;  4FBP A;  2DQV A;  2WBD A;  4DI3 D;  5ESY A;  1LGB C;  3O28 A;  1Y4C A;  4G8N A;  1FQE A;  4KYS A;  3WAF A;  5L9M A;  1LAG E;  1I6B A;  1QUL A;  2D5W A;  4QF9 A;  2E1S A;  3PPR A;  1S7Y A;  1ELJ A;  3KOS A;  2UVI A;  2XWO A;  3T96 B;  2GH9 A;  4PE5 B;  2XXW A;  3M8U A;  3O66 A;  1JW1 A;  4ZS9 A;  1NV7 A;  1FRP A;  3GBA A;  5J1D A;  3KGC A;  4OFL A;  4YKI A;  5L8D A;  3B8B A;  3EHT A;  1MXX A;  4YKJ A;  3CI8 A;  4GIZ A;  3MVX A;  5CMB A;  4E0X A;  4PFR A;  4NX1 A;  4LQ2 A;  3IO6 A;  2QS1 A;  3G3J A;  1LCT A;  3QSL A;  1MQI A;  2Y7P A;  4KYD A;  4NHB A;  3I3V A;  5IM2 A;  5I59 B;  3FZV A;  5IZ3 B;  1JNF A;  1OVT A;  5EQ9 A;  2XWV A;  2DWA A;  1NNF A;  3W9W A;  4PQJ A;  1NNP A;  1EH3 A;  3R7X A;  4NF8 A;  5AA2 D;  1B9J A;  3H6U A;  4JB7 A;  3D1R A;  4EQB A;  3G3F A;  2O84 X;  1FPG A;  2O7U A;  5F7V A;  3TCH A;  3TOD A;  1FBP A;  2I3V A;  4O3A A;  4LUB A;  3SES A;  2ZZV A;  4X8R A;  3K2D A;  3S9L C;  3D4C A;  3EQ1 A;  1LBZ A;  3SEX A;  2HFB A;  1SI0 A;  5TP9 A;  1R1N A;  4H67 A;  3MP8 A;  2DS9 A;  5JEI A;  1B3L A;  4YIC A;  3PUY E;  1YZ0 A;  4DDD A;  4P3L A;  1XI6 A;  1Y3N A;  3MZB A;  1OLA A;  1AWB A;  1SW5 A;  2B3F A;  3CRB A;  1US5 A;  2O6A A;  3H4Z A;  4KFQ A;  1B2H A;  5KCJ A;  1NUY A;  4AQ4 A;  3JV9 A;  4MNP A;  1MXZ A;  4ZE9 A;  4JWX A;  2KQZ A;  4FEB A;  3SEU A;  5EYG A;  1US4 A;  3BFT A;  4HE0 A;  5DVI A;  2KLF A;  2OLB A;  3OEN A;  3SER A;  1N76 A;  4BDR A;  1N0T A;  4IB2 A;  1BTJ A;  4EF1 A;  3N94 A;  2XXX A;  4FAJ A;  2XX7 A;  3LC8 A;  3LSX A;  1VFE A;  4DLD A;  3E78 A;  1NKX A;  4WKM A;  4X48 A;  4JBZ A;  4GWX A;  3KN3 A;  3ZS6 A;  3CSB A;  3OXN A;  3OO9 A;  1ZMG A;  4KCC A;  3L6H A;  1OQH A;  1FJ6 A;  4BDO A;  1JVY A;  3OSR A;  4M1V A;  1YTV A;  3H6V A;  3KSX A;  5JTY B;  3G3K A;  3IOV A;  2HQ0 A;  4GVO A;  2Q89 A;  3MWB A;  4OVQ A;  3CSG A;  4L17 A;  1MPC A;  3PUZ E;  4KR5 A;  1O64 A;  3C9H A;  2GHA A;  1A40 A;  4R2F A;  3N6U A;  1LLS A;  4RYA A;  1USY H;  4NF0 A;  5A5X B;  1LAF E;  5J16 A;  1B3H A;  3V8X B;  4GF8 A;  2ZNS A;  1RYO A;  5I5P A;  2QS4 A;  2CMO A;  2Y7W A;  4PFU A;  2VOZ A;  4FAT A;  3TZA A;  3RY3 A;  3T9U A;  4PF6 A;  1MY0 A;  2QL3 A;  2P0S A;  2RKM A;  4PAI A;  4PFI A;  3KN8 A;  2DVC A;  2ZYN A;  2Y84 A;  5H8Q B;  4G2Z A;  1XT8 A;  5IKB A;  4M4G A;  3VE1 B;  4MIJ A;  1MH3 A;  3I5O A;  1URS A;  4NWD A;  3IX1 A;  2PFZ A;  3KN7 A;  3DEL B;  5DVJ A;  1H44 A;  1VFD A;  3TQW A;  5H8H A;  4ZED A;  2QRY A;  4YB6 A;  2DE3 A;  3TEL A;  4F29 A;  1P1O A;  4PBH A;  1GR2 A;  4I1D A;  4N81 A;  3N26 A;  4RK9 A;  4XF5 A;  3FXR A;  3HST A;  1QUK A;  1UTB B;  4KD5 A;  4PFW A;  1B52 A;  4Z0I A;  3AXF A;  4P56 A;  5FBP A;  4QFO A;  2O1L A;  4F18 A;  3IB0 A;  4XKN A;  1JQF A;  1EYI A;  3TCG A;  3E79 A;  1FTJ A;  2I6E A;  3OOA A;  5AA2 A;  4JWO A;  3O97 A;  3SDF A;  3UA8 A;  4EQ7 A;  5HPQ A;  2ABH A;  2PT1 A;  1TXF A;  3PGF A;  4RNS A;  5I2N B;  3HO7 A;  1BIY A;  1QJM A;  1SW1 A;  3TTM A;  5KCJ B;  3CFL A;  2I0B A;  1FBH A;  3FVN A;  3RGY A;  4P9K A;  3N6T A;  4G68 C;  2E0S A;  2UYF A;  1B0H A;  3T0J A;  3RPL A;  3H6T A;  4POW A;  1JW4 A;  1KWH A;  4O3C A;  3T9X B;  2Y5K A;  1S9T A;  3GZG A;  3OEK A;  2REG A;  4X04 A;  3DP4 A;  3NOH A;  3U93 A;  3IAZ A;  3SEY A;  3DM0 A;  3OEM A;  1TFD A;  4GL8 A;  5EHS A;  3R6U A;  4P0G A;  3RTF B;  2ZNT A;  4PC9 A;  3QIM A;  4DXB A;  2Y7I A;  2F5X A;  3VVF A;  4RXL A;  1AMF A;  4MLQ A;  3O9P A;  3OSQ A;  4N6P A;  1YCJ A;  2RC7 A;  1MRP A;  1XHY A;  3FUZ A;  4OVS A;  1F9B A;  4YB5 A;  4JVI A;  2R6G E;  1UTH B;  4GWZ A;  1VE4 A;  2UYE A;  1AH5 A;  4ZDM A;  2Y7R A;  1SYI A;  1RDX A;  1IMA A;  1YPN A;  1DOT A;  4U23 A;  1DSN A;  3CIJ A;  2PFY A;  4ZEB A;  1G0H A;  4WEP A;  3HHF A;  2ESN A;  2XHD A;  1FQB A;  1QUJ A;  1LFH A;  4NF6 A;  1DMB A;  4NF8 B;  4ZE8 A;  4F3B A;  5K2Y A;  1B1X A;  3FV1 A;  4YMB A;  1WVJ A;  5H8N B;  4NAP A;  5CBR A;  4I3E A;  1MQD A;  4NTL A;  4QFL A;  4PGN A;  4ZZA A;  3TQL A;  2R8T A;  4F1Y A;  5JTY A;  3LBS A;  4ND9 A;  1B5J A;  1B32 A;  2HXW A;  1INP A;  1MH4 A;  3TTR A;  4R9G A;  2R9J A;  5BWJ A;  2XX8 A;  2FHY A;  4PP0 A;  3TKD A;  3M3F A;  3ROJ A;  4PFT A;  5TP9 B;  4QHQ A;  3ECR A;  5EQA A;  1LAH E;  4OQO A;  1P1Q A;  2I4B A;  4GX6 A;  3CHG A;  4HTG A;  5CMK A;  4GLI A;  4OFJ A;  4NF6 B;  1KZ8 A;  1POT A;  1A55 A;  4GRK A;  1EYJ A;  4OET A;  5FHM A;  4UAB A;  3QYT A;  2DVZ A;  1IZ1 A;  2Q8M A;  1LAX A;  2D21 A;  3QUF A;  2V84 A;  3IFC A;  5H8N A;  1ATG A;  2REJ A;  5ELV A;  4OEV A;  2HXR A;  4QXD A;  4NWC A;  2B4M A;  4IO4 A;  5CRY A;  4ZZE A;  2HCA A;  1MXU A;  4R73 A;  3FAS A;  4EXL A;  1Q1K A;  5FHN A;  2FIX A;  4TQU Q;  3FXB A;  4P0I A;  2GRV A;  4PET A;  3GYY A;  4OVT A;  4MBP A;  2WEF A;  2A5T A;  4P1L A;  5HM4 B;  5TPA A;  2WBB A;  4POX A;  5I56 B;  3O6I A;  3TTL A;  2Q8J A;  1FPF A;  3PMV A;  1FTO A;  1B05 A;  1O63 A;  4N4U A;  4NED A;  2ZXT A;  2HPG A;  4LZ7 A;  1MM6 A;  2H98 A;  1NNT A;  3U1O A;  4H6D A;  2WX9 A;  1AIV A;  1B5H A;  2QPQ A;  4NMY A;  5I2N A;  2IEE A;  1IXC A;  4G61 A;  3FBP A;  4G4P A;  3MW0 A;  5I57 A;  2PYY A;  3A3C A;  4OYV A;  4P47 A;  4RJZ A;  5I59 A;  2GQ1 A;  2FIE A;  4PDD A;  3IOU A;  1MPD A;  2OJT A;  2V4C A;  4OHN A;  2H4I A;  4LVQ A;  4R2B A;  2HAV A;  4XKP A;  1FTA A;  4R6K A;  1A8E A;  4GWU A;  3DLN A;  3CFZ A;  1IUD A;  1LBV A;  2H5Y A;  5H8F B;  2Q9T A;  2O51 A;  4GWO A;  4JSO A;  4KYE A;  2OX3 A;  4YAH X;  1K9Z A;  2RIN A;  2DE4 A;  2YLN A;  1BLF A;  5BUU A;  2H25 A;  5EQ7 A;  4N15 A;  1N84 A;  3S9M C;  1DPP A;  2DXY A;  3T9H B;  1B7H A;  1PBQ A;  3E4R A;  1D3K A;  4PFB A;  4XKR A;  2GFE A;  3K00 A;  3K6V A;  2XXR A;  3FXU A;  1D4N A;  4HXV A;  3IJO B;  4QFP A;  3VXC A;  2PX1 A;  3H3G A;  1Y3P A;  1H43 A;  4LP2 B;  3VLU A;  1OIB A;  5AA2 B;  2HZK A;  2X7Q A;  5B70 A;  1UIV A;  3MZ1 A;  2I58 A;  1Q35 A;  2MKZ A;  3KC1 A;  2F34 A;  4F1V A;  5LDZ A;  2ONR A;  3KZG A;  2V93 A;  2OCU A;  1MXV A;  3IB2 A;  4ONY A;  2CZK A;  4EF2 A;  1IQ7 A;  3K6X A;  4F1U A;  3LSW A;  3T66 A;  1DCU A;  4LA9 A;  1ZIU A;  4HE2 A;  3SEV A;  2VHA A;  1P1N A;  3W9V A;  4I3Y A;  1MDQ A;  2M8C A;  3PTY A;  1FQD A;  3K1N A;  5F24 A;  3MQ9 A;  1B7Z A;  1LBX A;  2QSX A;  1BKA A;  4OVP A;  1GGG A;  2F78 A;  3CVG A;  5TPA B;  1SD3 A;  2PVU A;  3IFA A;  3G3G A;  2P3N A;  2QS3 A;  3UP9 A;  1FPD A;  3MC2 A;  4F2Q A;  4GL0 A;  1FQF A;  3W15 C;  2F3D A;  1B4Z A;  3KFM A;  2F3B A;  3ODB A;  1ZKB A;  2D3I A;  1D9V A;  3EF7 A;  2VP1 A;  1FTL A;  2VPO A;  4O3B A;  3K02 A;  4TLL B;  1FJ9 A;  4U2R A;  1N3W A;  3QXM A;  2LAO A;  4OER A;  3PD9 A;  1FPJ A;  1I69 A;  1LFI A;  3K6U A;  1FPK A;  2F7C A;  4GBV A;  4R72 A;  5AA4 B;  1I6Q A;  4DCY A;  2I4C A;  3KG2 A;  1P1W A;  4IO7 A;  2F7B A;  4QBA A;  2WKY A;  3SET A;  4X1B A;  4ELR A;  5L9S A;  3ZSF A;  1A54 A;  4MFI A;  3OO6 A;  4N91 A;  2FBP A;  2RC9 A;  3LSF B;  1NMU A;  1DBZ A;  4IO5 A;  4DE8 A;  4F31 B;  4YMA A;  1B0L A;  5FHO A;  2P1S A;  2F36 A;  3SZP A;  3KBR A;  2ANJ A;  4P11 A;  2VT5 A;  1POY 1;  3CG3 A;  2FYI A;  2UVJ A;  3E13 X;  4RPN A;  3QUJ A;  4LZ8 A;  3MVY A;  1CNQ A;  4H5G A;  2YJP A;  1FBG A;  3A09 A;  2BJJ X;  5I2K B;  1EZO A;  4ELO A;  3RTW B;  4NN3 A;  1B4H A;  1NV0 A;  3ILU B;  1BP5 A;  2HHM A;  2ZYO A;  3MAM A;  3IOT A;  3TEP A;  1SYH A;  4YKK A;  2QVU A;  2DSF A;  1B46 A;  1QVS A;  1J1N A;  1FPE A;  3EHU A;  4DXU A;  1MDP 1;  3HV1 A;  5ET6 A;  4R75 A;  4XKQ A;  1IIW A;  1IXH A;  1NV6 A;  1EU8 A;  2Q74 A;  3FAT A;  2I3W A;  3F11 A;  1OLC A;  2RCB A;  4N07 A;  1FQA A;  4G68 B;  1Q9D A;  2O7I A;  4H1X A;  4LON B;  4AS5 A;  5IZ1 A;  2ONS A;  1FTM A;  1EYK A;  1IXI A;  5HBC A;  4PE3 A;  2A5T B;  4MNC A;  1O7T A;  3MBP A;  5I58 B;  2ONK E;  4OEN A;  4GX3 A;  1NV5 A;  3VFJ A;  1M5F A;  4JWY A;  1CB6 A;  3FJM A;  2P3V A;  1QUI A;  5H8F A;  4U21 A;  4H8J A;  4ZEK A;  2B4L A;  4G8M A;  2O1M A;  2AIX A;  1EZ9 A;  4NG7 A;  1XS5 A;  4O94 A;  3SEW A;  3PPN A;  3KEI A;  1OQG A;  4N6K A;  4MH5 A;  1SBP A;  2DYX A;  2OWT A;  4N6D A;  1A99 A;  1DTZ A;  1VSO A;  3TTN A;  1AOV A;  1LBW A;  3KJT A;  2XA5 A;  3UOR A;  1PB8 A;  2AL5 A;  4F39 A;  3FJG A;  3PUX E;  1DPE A;  2AL4 A;  3H06 B;  3B50 A;  4U1Z A;  2Y5L A;  1URD A;  2YPN A;  4MMP A;  4LAT A;  3K6W A;  4G68 A;  4KXP A;  3UGW A;  4NF4 B;  5ET8 A;  4GWW A;  3TTK A;  1UTH A;  3IB1 A;  4NE4 A;  1QKB A;  5FTI A;  4HCY A;  3IL1 B;  2QVV A;  3LUZ A;  3BKI B;  4H46 A;  4DXC A;  1HSL A;  1FBF A;  2JJK A;  4MLV A;  2X7P A;  4H5F A;  1OMP A;  3TFL A;  4G8H A;  4O8M A;  2F8D A;  3UIF A; 
#chains in the Genus database with same CATH homology
 1DK4 A;  1EYK A;  1FPL A;  4NGU A;  1YZ0 A;  1VDW A;  4N4U A;  4YIC A;  2HPG A;  4I40 A;  2QVR A;  2MKZ A;  1XI6 A;  4GWS A;  4P3L A;  4PE3 A;  1IME A;  3KC1 A;  3T0J A;  2FHY A;  3MYU A;  2WX9 A;  1NV2 A;  5ET7 A;  4MEV A;  4PAK A;  4DI4 B;  5EQ8 A;  4AS4 A;  5LDZ A;  3RPL A;  4F1V A;  4N91 A;  2QPQ A;  2FBP A;  4MNC A;  3ROJ A;  4PBQ A;  4PF6 A;  1KA1 A;  1AWB A;  2CEX A;  4HE1 A;  4G61 A;  5I3S A;  3FBP A;  1YYZ A;  2CZK A;  1DBZ A;  4PGP A;  4GX3 A;  2WYP A;  2Y5K A;  5IGA A;  5EQA A;  4F1U A;  1NUZ A;  4P47 A;  4PAI A;  2XWO A;  4PFI A;  1NUY A;  5DW8 A;  4X04 A;  2ZZW A;  1NV5 A;  2GQ1 A;  4OAN A;  1RDY A;  4MNP A;  1DCU A;  5I7I A;  2KR0 A;  4GX6 A;  3CHG A;  2FIE A;  3NOH A;  5I5P A;  4HE2 A;  2P3V A;  4PDD A;  1IMF A;  2PCR A;  2KQZ A;  1NV7 A;  4MAG A;  3SZP A;  3U65 A;  1FRP A;  5EYG A;  5J1D A;  1IMD A;  1FSA A;  2B4L A;  4HE0 A;  4MIJ A;  3B8B A;  4I3Y A;  3W9V A;  2V4C A;  2VT5 A;  4GBW A;  1NI9 A;  3PTY A;  5LTC A;  1BK4 A;  4GWY A;  1FPI A;  2PFZ A;  1KZ8 A;  2QFL A;  4NG7 A;  1NUW A;  1FTA A;  5F24 A;  2V3Q A;  4PDH A;  4PFR A;  1FBC A;  1NV1 A;  4O94 A;  4GWU A;  1LBX A;  4MHF A;  4QBA A;  4PBH A;  4IR8 A;  4PC9 A;  4NX1 A;  2WYK A;  4N8G A;  1EYJ A;  4OVP A;  1CNQ A;  1LBV A;  1YXI A;  4O7I A;  5EYH A;  2XWK A;  2F5X A;  2ZZX A;  4N6K A;  2Q9T A;  1RDZ A;  4GX4 A;  4NQ8 A;  4N17 A;  1LBY A;  3RYD A;  4N6D A;  1FBG A;  3IFA A;  2CZH A;  2OX3 A;  3BIG A;  4H45 A;  2DVZ A;  4UAB A;  2BJI A;  3KC0 A;  4OVS A;  3E78 A;  2Q8M A;  1LBW A;  2DE3 A;  4NHB A;  4JVI A;  5IM2 A;  1D9Q A;  1K9Z A;  2XA5 A;  4NN3 A;  4PTK A;  4GWZ A;  5IZ3 B;  2DE4 A;  2VPN A;  1NV0 A;  3ISP A;  2HZL A;  1LEV A;  2P3N A;  4GWX A;  4N81 A;  4OVR A;  4XF5 A;  5EQ9 A;  3IFC A;  2HHM A;  5EQ7 A;  2XWV A;  1KA0 A;  4N15 A;  3A29 A;  2XXK A;  1FPD A;  4N8Y A;  1K9Y A;  1RDX A;  3T1B A;  1IMA A;  2DDK A;  3QMF A;  3RPL B;  3W9W A;  1FJ6 A;  3BIH A;  5A5L A;  1QGX A;  5T3J A;  2HXR A;  2QVU A;  3HFU A;  2F3D A;  1IMC A;  2F3B A;  2PFY A;  4QXD A;  4M1V A;  4JVD A;  4P56 A;  5FBP A;  1G0H A;  2B4M A;  3B50 A;  4F18 A;  1FPE A;  4PFB A;  2Y5L A;  4MJO A;  1FPB A;  4JVC A;  4MMP A;  4P1E A;  4PCD A;  2L5V A;  1EYI A;  3D1R A;  2CEY A;  4MX6 A;  1IMB A;  4X9T A;  5JK4 A;  3E79 A;  4LN5 A;  1NUX A;  3MST A;  1SPI A;  4KXP A;  5ET6 A;  1FPG A;  2DE2 A;  1NV3 A;  2FIX A;  2VPO A;  5ET8 A;  4GWW A;  4OVQ A;  3FXB A;  5IZ3 A;  1FBP A;  4HXV A;  4PET A;  3GYY A;  1FJ9 A;  1JP4 A;  1NV6 A;  4OVT A;  4YZZ A;  4HCY A;  2Q74 A;  1NV4 A;  2QVV A;  2WEF A;  3LUZ A;  5CM6 A;  2ZZV A;  2OWZ A;  4MCO A;  3LV0 A;  4NAP A;  4PF8 A;  4MNI A;  4X8R A;  4H46 A;  1FPJ A;  4I3E A;  2FVZ A;  1G0I A;  4HCW A;  1LBZ A;  4P1L A;  4PGN A;  1FBE A;  2XWI A;  1FBH A;  1FPK A;  4NF0 A;  5ET5 A;  4OA4 A;  1FBF A;  2JJK A;  4F19 A;  2WBB A;  4GBV A;  2R8T A;  3KBZ A;  5J16 A;  2HZK A;  4P8B A;  4FBP A;  4P9K A;  4XFE A;  3EKI A;  5IZZ A;  2WBD A;  4DI3 D;  5ESY A;  4PAF A;  4XEQ A;  2CZI A;  1FPF A;  4O8M A;  4O7M A;  1INP A;  1Q9D A;  1FBD A;  4AS5 A;  5IZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...