2R8TA

Crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
319
Chain Sequence
RRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSIHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase class II glpX
publication title Crystal structure of the fructose 1,6-bisphosphatase GlpX from E.coli in the complex with fructose 1,6-bisphosphate
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 105
structure length 319
sequence length 323
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2r8tA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2r8tA02
1IMEA 2CZHA 4GWSA 1FPJA 1G0IA 5LDZA 2FIEA 1FBDA 1XI6A 1DK4A 2OX3A 1NUXA 1LBWA 1CNQA 1AWBA 2P3NA 2F3DA 4I3YA 2Q8MA 1FBFA 1NV6A 1NV4A 3IFCA 1LBYA 1FBGA 4GX3A 1FPGA 4N81A 5IZ3A 2P3VA 4PTKA 3B8BA 4GWUA 4I3EA 1FPIA 1NV1A 1IMCA 4I40A 1FBHA 1INPA 4GX4A 1G0HA 2CZKA 4HE2A 1NV2A 2F3BA 1NUZA 1LBXA 4GX6A 2JJKA 1DCUA 2Y5LA 5ESYA 1Q9DA 5EQAA 2QVRA 4GWYA 1VDWA 1NV7A 2WBBA 5EQ8A 4H45A 3RPLA 2Q74A 5IZ3B 2CZIA 3FBPA 2OWZA 1FBEA 4GBWA 1RDXA 3LUZA 3QMFA 1IMAA 5T3JA 4G61A 5IZ1A 1LBVA 1YZ0A 5EYGA 1NI9A 1FSAA 1RDZA 2BJIA 4IR8A 2FIXA 1FPBA 1FPFA 1BK4A 1FBPA 5DW8A 4GBVA 3RPLB 4AS5A 4GWWA 1KZ8A 2VT5A 4O7IA 1RDYA 1IMBA 4GWZA 1IMDA 1LBZA 1KA0A 2FVZA 1K9ZA 5ET6A 3BIGA 3KBZA 3KC0A 3BIHA 1NUYA 2R8TA 4HE1A 2DDKA 1KA1A 1SPIA 2WBDA 1FPDA 1NV3A 5ET7A 1NV0A 2FHYA 1EYIA 1K9YA 5ET8A 5FBPA 1EYJA 2QVVA 1FPKA 5ET5A 4GWXA 2GQ1A 1JP4A 3IFAA 2WEFA 1FPEA 2PCRA 4QXDA 1FJ6A 4MJOA 5A5LA 4AS4A 5F24A 4H46A 3ROJA 1NV5A 1LEVA 3A29A 2FBPA 3LV0A 1D9QA 1IMFA 1NUWA 5EYHA 4FBPA 1QGXA 3KC1A 3T0JA 1FPLA 2HHMA 1EYKA 2QFLA 1YYZA 1FTAA 2Y5KA 3D1RA 1DBZA 1YXIA 5J16A 2QVUA 1FRPA 4HXVA 3RYDA 1FJ9A 5I3SA 5EQ7A 4HE0A 1FBCA 5EQ9A 4KXPA
chains in the Genus database with same CATH superfamily
2V93A 1BKAA 2DXYA 1MPCA 2GFEA 3KSXA 2ANJA 4ZZAA 2F97A 1S50A 2QS4A 5IZ3A 3OD7A 2VD2A 3K02A 5AA4A 1MPDA 3C9HA 1N76A 4NF0A 5DEXB 4Z0IA 1F9BA 2XXVA 3PPNA 5FHMA 1YCJA 1ELJA 3G3HA 3B50A 4U4XA 4X48A 5EHSA 1B52A 4DI3D 5IZ1A 1Z7ME 2OLBA 3EF7A 4YZZA 2F7BA 1RYXA 3S9MC 2F6PA 2HZLA 3N94A 5F1QA 4RK2A 4E0XA 3PV0E 3UORA 1FPDA 4ELQA 4UACA 1UTHB 5TU0A 5H8SA 4F3SA 3KN8A 1BIYA 2AYSA 1MH4A 3SESA 5A5LA 3DLNA 4H46A 3A29A 4BLAA 2H99A 3Q26A 1ZLQA 4MMPA 4OVJA 4EXLA 5CMMA 1LSTA 2KLFA 4R9FA 2XX8A 4OANA 4F1YA 4HXVA 3NOHA 3MZ1A 2DSFA 1MDQA 4G68A 5TP9A 3VLVA 2KQZA 4QF9A 3R26A 3OEMA 5LOMA 2IA4A 1NV6A 2QRYA 3IFCA 4N81A 1IXCA 3H6UA 1ZJLA 3G3GA 1D3KA 4BDRA 5I7IA 5AA3A 4YICA 1OQHA 3TTMA 2Y5LA 2F78A 1L5TA 5CMCA 1VDWA 2Q8JA 2F36A 5ISUA 3TFLA 2RC8A 1DTGA 3BFTA 4RYAA 4NF8B 3JYRA 1KWHA 2I0BA 4FEDA 4ZS9A 4QFNA 4GXSB 1IMBA 3QXMA 4I8CA 3O2AA 3BIGA 2XXIA 3PD9A 4POWA 4R9GA 1XOCA 4H0WA 2I4CA 4TQUQ 4XXUA 1Y9UA 1O63A 4P3LA 2D21A 2XXUA 3V83A 4G8MA 4H5GA 4ZEKA 3USDA 3FJ7A 1QKBA 1M5CA 3ILUB 1B5JA 5CMBA 3OXNA 1EZOA 4PFBA 3IORA 1P1NA 2AL5A 1TXFA 4O3AA 1D9QA 3T22A 3S2VA 4WEDA 3G3IA 4NF4A 1YYZA 5A5XA 2VOZA 4IO2A 4F29A 3HO7A 4MH5A 5J16A 3C31A 5I2KA 1BP5A 2XWVA 4WXJA 4DDDA 1B2HA 3BKIB 3VLWA 4PFWA 2V3UA 1TFDA 1XI6A 4U23A 2OWSA 4PAKA 1FCKA 2X7PA 2VHAA 1N84A 2V4CA 3PMWA 2DOJA 3PUWE 1LGBC 4NF5B 2R6GE 1N3XA 3GYYA 4PFYA 3PGFA 1MXYA 1PB7A 2XXXA 1FW0A 2Y7IA 2OWTA 3SEXA 4JWXA 5JK4A 2Y7KA 2NXOA 3VVFA 2O84X 2VGQA 1BLFA 4MEVA 4OTEA 1TT1A 4JVDA 3E79A 3BIHA 5H8HB 3G3JA 2OPDA 4O94A 3HCQA 3SEUA 2FA7A 4I1DA 3BBRA 4ZE8A 3R7XA 3RPWA 4GIZA 4MCOA 3LSLA 2QVVA 1FPKA 4Q30B 4F39A 1M5DA 1GVCA 4FATA 2F7CA 3ONMA 2ZZVA 5F24A 1FQEA 4IO3A 4X1BA 2WKYA 1VFEA 1B3HA 4XKPA 3PUXE 3OO9A 4ESWA 3SEYA 3KOTA 4F3GA 5AA2A 4HE0A 4R75A 3IL1B 5EQ9A 3S9NC 4U21A 1MG1A 1MQHA 1FBDA 4MIJA 1USYE 4Q5TA 1LBWA 1Y3QA 1H3DA 4N6PA 3K6XA 1CB6A 3TAJA 1FBFA 1Y1MA 3H03A 5DTBA 1LFIA 4PF8A 3EQ1A 3PUZE 4EQBA 1NNPA 2A5TB 2O6AA 3H3GA 3QAXA 2VPNA 3G3KA 5ESYA 4G8NA 4NX1A 1SDXA 2Q74A 4JVIA 3CIJA 4X04A 2BJJX 2GH9A 3P7IA 3IAZA 3B6QA 3LUZA 1UIUA 4RK9A 2ZMBA 1YZ0A 2QL3A 2O68A 5DVIA 2DWJA 4O3BA 1QW0A 4H8IA 1US5A 5FHOA 3FVGA 2DE2A 3Q25A 3VXCA 1IUDA 2DXRA 4NMYA 3H6TA 1LFGA 1K9ZA 4N6DA 2B4LA 4YMBA 2WBDA 5FHNA 4DIGA 4OESA 1LCTA 2B3FA 1ZKBA 5J1DA 2XXPA 4EF2A 1A55A 2RC9A 3E4RA 3IB2A 2PFZA 1UQWA 4YMAA 3IO6A 1NUWA 4AB5A 3T0JA 2QS3A 2QMXA 4IB2A 4MHFA 5BUUA 1B7HA 3FJMA 3PUVE 3M3LA 1XVYA 4ZEDA 4G77A 1NNKA 1WDNA 3HPIA 3EHTA 1O7TA 1MXVA 5CM6A 3H6VA 2ONSA 5DT6A 4BDNA 1B4HA 3C33A 2WX9A 2ONRA 3K6UA 2HQ0A 3IOUA 4P9KA 2UVHA 4F18A 4H5FA 1WVJA 1MY4A 5I56A 1FTOA 3E3KA 1SYIA 3U93A 5TPAA 3K6VA 4YKKA 4RY1A 3ZSFA 1M5BA 4BDMA 4DZ1A 3A3UA 1B3FA 4DCXA 1RDZA 2FIXA 3FVOA 1FPFA 4LQ5A 3K0VA 3I5OA 1B51A 2YLNA 5L9MA 4ZDMA 2KR0A 4FORA 3EKIA 3Q28A 1B3LA 1FQFA 4KD5A 5IAIA 4AB6A 2UVGA 2B4MA 4OQOA 2FHYA 4DXCA 3CR9A 4EF1A 1I6BA 3N5LA 5KDTB 3VV5A 4H65A 1II5A 3DELB 4OFLA 1JQFA 2OBGA 1US4A 3GXAA 5A5XB 5ICTA 2O7IA 2HAUA 2ZNUA 3LV0A 5I2KB 3M3KA 3OO6A 1RKMA 3K6WA 1FTJA 4HTGA 4RNSA 4EXKA 4QBAA 2Z8DA 4FE8A 2XXRA 5HM4B 1FBCA 2ALUA 1MXZA 2CZHA 1ZBMA 2VP1A 3T9VA 3HHGA 1NUXA 5KCJB 4IY5A 4JVCA 1EZ9A 3O6HA 1QUIA 1UTBB 3FVNA 3S9LC 4XF5A 5I57B 4I3EA 5AA1A 1INPA 5I58A 4GX4A 1YTVA 1NV2A 1NUZA 3TTNA 2QVRA 2V84A 3TQLA 3SKPA 3LSWA 5I2NA 1HSEA 1I69A 2NUVA 1IQ7A 1JVXA 4QHQA 2O7UA 3MVZA 4R72A 2XXTA 1NFTA 3PMVA 3TTRA 1GTKA 1FPBA 4U4SA 3QIMA 1PB8A 3RPLB 5AA2D 3IK6B 4XTCQ 3KZGA 5KZTA 3JZJA 3KBZA 1IEJA 1QKAA 2PYYA 1H76A 4NTLA 1MXUA 2PFYA 3H6WA 2PVUA 1TFAA 4EQ9A 3MVYA 3QYTA 5ET5A 1ZIUA 3OENA 1B1XA 3O97A 5AE4A 4WKMA 3TELA 3KOSA 4AS4A 2QSXA 3N6UA 2WYPA 4IY6A 4KQPA 4OERA 1MH3A 4ZEBA 3O6GA 4IO7A 4LZ5A 3FASA 1MQJA 2Y7WA 1B3EA 3MYUA 1SW2A 2XX7A 3HHFA 3KBRA 3T66A 1ANFA 4L17A 5L9OA 1CNQA 5H8NA 4LVQA 2Q2AA 1B32A 5CMKA 4GX3A 2ZYOA 3MWBA 1NV1A 3C35A 3K4UA 3K00A 4I40A 1ZMGA 3FXBA 3MP1A 2OCUA 3QUJA 1MY0A 4PC9A 1LBXA 3ZS6A 1POY1 4F2OA 4PP0A 3TODA 3T9HB 3A3CA 3EPEA 4DI4B 1GV8A 2ABHA 4MLQA 4GL0A 1B05A 3KJ7A 4M1VA 1P1OA 4H1XA 4QSDA 4WEPA 2XD2A 1B46A 1JW4A 5M2VA 4QRZA 1Z7NE 2ZZWA 3MJNA 3V8XB 2ZYNA 1MQGA 3VE1B 5B7DA 1LAHE 5BWJA 1PDAA 2ZNSA 2DVCA 4QFPA 1GGGA 1DSNA 3VFJA 2HCAA 3JV9A 3KJTA 4YAHX 4ND9A 2G29A 5ET7A 2QS2A 3S4UA 4F19A 3RTFB 3TCFA 3RT8A 3H06B 1P1WA 3IFAA 2NOOA 4N15A 5CBSA 3CG3A 3DP6A 3VVDA 3EHSA 1PC3A 2FBPA 4NGUA 4YB5A 2QJEA 3OEKA 3MPLA 3D1RA 4X1DA 4F1VA 2Q2CA 2O1LA 2V25A 4HCWA 1JNFA 2FYIA 5CRYA 3PU5A 3T93B 2RCAA 3W9VA 4KYDA 5IZZA 2QPQA 2OX3A 3DP4A 4AQ4A 2HAVA 2ZYMA 4I3YA 2E0SA 1MDP1 3E9XA 4JSDA 3V5AA 5B70A 3MZBA 4F31B 5FTHA 2XXWA 4N07A 4HS7A 5I56B 3RT6B 2UYFA 1FBHA 3IX1A 4ELOA 4JB7A 2CZKA 3MP6A 4GX6A 1EH3A 2VD3A 4OA4A 2JJKA 1IITA 1I6QA 5CBRA 1PB9A 2ONKE 1B4ZA 3TMGA 3MUQA 2CEXA 4DCYA 3U65A 4R6HA 2FNCA 1D9YA 4YKJA 4C1UA 4QSCA 4MNCA 3U1OA 3LBSA 2HPGA 4OVQA 3SETA 4O7IA 3TZAA 3MSTA 4NF6A 3EHUA 4QFOA 4XIGQ 2R8TA 4HE1A 5IKBA 4OVTA 4U22A 4PQJA 5DVJA 2VPOA 5I59A 2HXRA 3K01A 5ET8A 1NMUA 2Z23A 3CRBA 4OYVA 5JTYA 3I6VA 3PMXA 4GLIA 2V3TA 4O7MA 3KC1A 2HHMA 1FTAA 4GD5A 4MAGA 4N8YA 4ZE9A 1JW1A 3SZPA 3IR1A 3LC8A 3L6HA 3FD3A 3W9WA 3CHGA 5L8DA 1MY3A 1M5EA 1DMBA 4X8RA 1IXGA 1SW1A 4NEDA 3MZ9A 4KCCA 4ECFA 4O3CA 4ISUA 4ZEIA 1FPGA 3UP9A 3WAEA 4R2FA 3B8BA 1FPIA 2B3BA 5I2NB 2CMOA 4G8HA 4RA1A 4LZ7A 1PBPA 3TTKA 5IZ3B 2WYKA 1QUKA 1QJMA 3RY3A 3QMFA 4Q0CA 4MFIA 5AA4B 3CSBA 2XXYA 2UVJA 4H8JA 3O66A 2BJIA 1BK4A 2Q9TA 1Y3NA 4KYEA 4PFIA 3AXFA 1UTHA 3T96B 4GWZA 3LUYA 3HFUA 3FUZA 1FTMA 4IO6A 1KA0A 2FVZA 2RCBA 1EZPA 4R74A 3IB1A 5L9SA 4QFLA 1RYOA 4LP2B 3ZKKA 2M8CA 2OJTA 3MC2A 3H4ZA 4R6YA 2THIA 4YKIA 1FPEA 2DWHA 3IB0A 4PBHA 2F5XA 3ROJA 3MBPA 4OVPA 4P56A 1LEVA 4YB6A 4PDDA 1QGXA 3FV1A 4FEBA 2DE3A 2HFBA 3D4GA 1DPPA 4F2QA 4NQ8A 3ILTB 4H67A 3C4MA 1QUJA 4OWDA 3KN7A 5H8NB 2F34A 3CI8A 1FPJA 3FV2A 3IJOB 4DXBA 1SVXB 1AWBA 2YJPA 5I84A 1NH7A 4YU0A 2LAOA 1XHYA 1FQBA 4G68B 2CZLA 4LATA 5TP9B 2B65A 4NWDA 4NF8A 4YB7A 3K1PA 4N91A 1N7XA 3KN3A 2XX9A 4PGPA 5ELVA 2RINA 4P47A 5H8QA 1MQIA 4GWOA 4LA9A 4OVSA 5T3JA 4LZ8A 1LAFE 3TCHA 2DWAA 1SI0A 1FBPA 1R6ZA 1NNFA 2I0CA 1B58A 1OVTA 3TEPA 2XA5A 4N4UA 5ET6A 2H98A 3FATA 3M3FA 1NUYA 3MVXA 1IXHA 4PFUA 4KCDA 1OMPA 3UK4A 2W7YA 3GZGA 3ECRA 5FBPA 5EYFA 2UVIA 5IM2A 2F8DA 1A7LA 3IOWA 1FTKA 4XKQA 2R71A 4NWCA 1B5HA 1OIBA 1VSOA 4ZECA 3KGCA 4ELPA 1D4NA 2RF1A 3EN3A 4P0IA 2DVZA 4K3FA 3O6IA 1N04A 1URDA 1SD3A 4MF3A 4TLMB 3LR1A 2UYEA 3CFLA 3OMBA 1OLAA 3L6GA 1B6HA 3I3VA 1Y4CA 4NF4B 4NF5A 3SEVA 2Q89A 1A99A 2DYXA 2F6GA 2P3VA 4GWUA 4X9TA 1FTLA 1S7YA 1DCUA 3DP8A 2WBBA 4U2RA 1LBCA 4IGTA 2Y7PA 2MKZA 4NHBA 2CZIA 2H25A 3OSQA 3V89B 4OZ9A 4Z7EA 1FBEA 1MM7A 1RDXA 4LQ2A 4YKPA 3PUYE 1LBVA 5EYGA 1FSAA 3OO7A 1Q35A 2H5YA 1S9TA 4NF6B 4JWOA 4GBVA 2VT5A 1B5IA 1MRPA 3VDFA 2PBWA 3HN0A 4XFEA 2ZZXA 1IZ1A 3QUFA 5JTYB 3VXBA 1K9YA 4GFRA 1YPNA 4R2BA 4U1OA 4OMBA 4KI0E 3UA8A 5EHMA 4GWXA 3O29A 2WEFA 3F11A 1P1UA 3MW0A 1LB9A 4MJOA 3FJGA 4XKNA 3OSRA 1XVXA 1FQCA 3GLBA 5K2YA 1JETA 1B40A 3RLFE 3CVGA 1SQYA 4QFKA 4F22A 4QSEA 4PF6A 3PPQA 1R9LA 4EUOA 2P0SA 1VR5A 2H4IA 1JVYA 3RGYA 3M8UA 1A8FA 1JW5A 3A09A 5H8FA 1P99A 1G0IA 2A5TA 4MNPA 3E13X 3RQTA 3TCGA 1NV4A 5AA2B 1SW4A 2DWIA 1M5FA 2ZNTA 4OFOA 2Y7RA 2XWKA 5JEIA 1AL3A 4N8GA 1USYH 4JBZA 2X26A 4EDPA 5EQ8A 2I3WA 4H45A 3T1BA 2QMWA 1OVBA 4Q8RA 2OWZA 4JSOA 4GBWA 1WODA 1LBBA 4FECA 4PFRA 1IMAA 4OENA 3QSLA 1OLCA 4IR8A 3PPPA 4GWWA 1Y1ZA 2HEUA 4OEUA 3TTLA 4RJZA 2Y84A 2Z8FA 1H45A 2AL4A 3Q29A 4F1UA 2L5VA 1QULA 1SBPA 4F3PA 4ELRA 1SYHA 1AIVA 2UXAA 1Y3PA 3ISPA 3SERA 4JXIA 4E0WA 3D4CA 4O8MA 3DM0A 4NG7A 2Y5KA 1YXIA 1MXXA 4ESXA 3HSTA 1LB8A 3FXQA 4POXA 4PCDA 3VLUA 2I48A 4KXPA 4DLDA 4BDOA 5LDZA 2E1SA 1DK4A 3UIFA 2ZXTA 2DQVA 3KSJA 1MQDA 2O69A 3TKDA 1NL5A 4PTKA 1B9JA 1YAEA 3IOTA 3CG1A 4HCYA 1PBQA 4THIA 4KYSA 2F3BA 5H8QB 4GOTA 2I4BA 2G93A 4R6KA 3WAFA 2GRVA 1A8EA 1VFDA 4PE3A 3ODBA 4MNIA 2F7AA 3MPKA 4H6DA 5F7VA 4ZZEA 5LTCA 2YPNA 4GVOA 3FIRA 3SEWA 4OETA 5TPAB 2I3VA 4AS5A 1KZ8A 5KDTA 1LAGE 1H43A 2PMSA 3U8QA 4F3BA 1CE2A 3MVWA 2NWJA 4KPTA 4UA8A 3KEIA 1J1NA 1B0LA 4JDFA 4TOZA 1MY1A 1OQGA 1D9VA 3H7MA 2X7QA 3FVKA 1B1HA 2OK2A 3GBBA 1HSJA 3PPOA 4C1TA 3MP8A 4RPNA 4FIMA 4LUBA 3OOAA 1PEBA 5KCJA 3O9PA 4FJPA 4I62A 2QVUA 1FRPA 1UTBA 3RYDA 1FJ9A 1IIWA 5HPQA 1QVSA 5I57A 1IMEA 4OFJA 4IO5A 4R73A 1LAXA 2OPEA 2GHBA 2Q8MA 1N3WA 4BDQA 5IGAA 2XD3A 1ZU0A 4GRKA 1IMCA 4KR5A 4PAFA 1G0HA 4HE2A 1H44A 4MX6A 4EQ7A 5EQAA 3OO8A 5DYHA 1NV7A 3SDFA 3RPLA 4UABA 3K1NA 5DEXA 4GQOA 2REGA 5I58B 4KFQA 1NH8A 4G61A 2PT1A 2D3IA 3LSFB 1LFHA 1Q1KA 2Z8EA 5DW8A 2RKMA 2F35A 4IO4A 2O1MA 4DXUA 4XKRA 1FQDA 1IMDA 1R1NA 4PGNA 5HBCA 2DDKA 1KA1A 1SPIA 3W15C 1XT8A 3G7WA 3IO4A 1EYIA 3IJXB 4P11A 3CSGA 2DP8A 1NKXA 4NN3A 2PCRA 4PETA 4QXDA 5ITOA 3UN6A 1B3GA 1DTZA 2Q88A 3RN8A 3ZKLA 4FBPA 2REJA 2XXHA 3O28A 1FPLA 1EYKA 2QFLA 4P1EA 4M4GA 2H9BA 2HXWA 1POTA 4G2ZA 5H8FB 3E78A 1TWYA 1URSA 1Y4TA 1A54A 1SI1A 3B7DA 4GWSA 3CFZA 2FIEA 1MS7A 2CEYA 1B7UA 5ITPA 2XXQA 4N13A 3TDJA 3U94A 2Z22A 2F3DA 3TYHA 4PAIA 1MY2A 2XXKA 4OXVA 1EU8A 1O64A 3FZVA 5I5PA 2PX1A 2DS9A 4GXAA 4GL8A 3UGWA 4NE4A 1NNTA 1B7ZA 2D5WA 4GWYA 4IGRA 3TUSA 4OEVA 4U1ZA 4P1LA 3K1MA 1IXIA 2AIXA 1BTJA 4GF8A 1NI9A 4PBQA 1N0TA 1AMFA 2PT2A 3TPAA 1FQAA 4RPOA 3R6UA 2XWOA 1RDYA 1DPEA 3IOVA 1LLSA 1MXWA 4C0RA 5ICQA 3KC0A 4ZEFA 3KFMA 1JEVA 2ESNA 1NV3A 1N7WA 1UIVA 1AOVA 1HSLA 4DE8A 3RUMA 5DVFA 1T0KA 1EYJA 1JP4A 3PD8A 3B6WA 1FJ6A 3FXRA 3VVEA 3BFUA 1NV5A 2P2AA 2RC7A 3RNNA 1IMFA 4BDLA 3KG2A 4JWYA 5EYHA 4NAPA 3T9UA 1MM6A 3G3FA 2A5SA 3S9EA 1DBZA 5I3SA 5FTIA 4XEQA 3MAMA 1AH5A 3FXUA 3T9XB 4P0GA 1LCFA 2P1SA 4LONB 3PTYA 4G68C 2DE4A 5K2XA 2P3NA 3TQWA 3CFXA 3HV1A 4HW8A 1LBYA 1FBGA 1VE4A 4N6KA 1I6AA 4P8BA 4RXLA 2I49A 1XC1A 1Y20A 3PPRA 4OHNA 4N17A 3C34A 2I6EA 3MQ9A 1GR2A 1P1QA 2NVUB 3THIA 1Q9DA 4ONYA 3FGSA 2HZKA 3FBPA 3U72A 1JEUA 2V3QA 4PFTA 4TLLB 5CC2A 4MLVA 1URGA 4LN5A 3C32A 1R9QA 2XWIA 3GBAA 4G4PA 4MBPA 3U92A 3C36A 1XS5A 3QK6A 1LBZA 3B6TA 1ATGA 4KHZE 3N26A 2GHAA 1SW5A 1NV0A 5H8HA 2XHDA 4PE5B 3RTWB 2OZZA 2GQ1A 4FAJA 2R9JA 1MPBA 3N6TA 5CI5A 3OELA 3K2DA 5I59B 2IEEA 1ZTYA 2ZYKA 2QS1A 1A40A 1B0HA 5EQ7A 1DOTA 4OVRA 3Q27A 4I9DA 3LSXA 2O51A 2I58A 4PDHA
chains in the Genus database with same CATH topology
3W9WA 5LDZA 1DK4A 3CHGA 5CM6A 4X8RA 2WX9A 1FPGA 5IZ3A 4PTKA 3B8BA 1FPIA 4P9KA 4HCYA 4F18A 2F3BA 4NF0A 5IZ3B 2WYKA 4PE3A 3QMFA 3B50A 4MNIA 5IZ1A 4DI3D 5LTCA 2BJIA 1RDZA 2FIXA 1FPFA 1BK4A 2Q9TA 4PFIA 4YZZA 4AS5A 1KZ8A 2KR0A 4GWZA 3EKIA 2HZLA 3HFUA 1KA0A 2FVZA 1FPDA 2B4MA 2FHYA 1FPEA 4PBHA 2F5XA 5A5LA 4H46A 3ROJA 4OVPA 4P56A 1LEVA 3A29A 3LV0A 4PDDA 4MMPA 1QGXA 2DE3A 4OANA 4QBAA 2QVUA 1FRPA 4HXVA 3RYDA 1FJ9A 4NQ8A 3NOHA 1FBCA 1IMEA 2CZHA 1FPJA 2KQZA 1NUXA 4JVCA 1AWBA 2Q8MA 1NV6A 3IFCA 4N81A 4XF5A 5IGAA 4I3EA 1IMCA 5I7IA 4PAFA 1INPA 4GX4A 1G0HA 4YICA 4HE2A 1NV2A 1NUZA 4N91A 4MX6A 2Y5LA 5EQAA 2QVRA 1VDWA 1NV7A 4PGPA 3RPLA 4UABA 4P47A 4OVSA 5T3JA 4G61A 1FPBA 1FBPA 5DW8A 3RPLB 2XA5A 1IMBA 4N4UA 1IMDA 5ET6A 3BIGA 4PGNA 3KBZA 1NUYA 2DDKA 1KA1A 1SPIA 2PFYA 4P3LA 1EYIA 5FBPA 5ET5A 4NN3A 5IM2A 2PCRA 4PETA 4QXDA 4PFBA 4AS4A 1D9QA 2WYPA 4FBPA 1FPLA 1EYKA 2QFLA 1YYZA 4P1EA 5J16A 3E78A 2XWVA 2DVZA 3MYUA 4GWSA 2FIEA 1XI6A 2CEYA 1CNQA 4PAKA 2F3DA 4PAIA 4GX3A 2P3VA 4GWUA 2XXKA 1NV1A 5I5PA 4I40A 2V4CA 3FXBA 4X9TA 4PC9A 1LBXA 1DCUA 4GWYA 2WBBA 3GYYA 4DI4B 2MKZA 4NHBA 2CZIA 4M1VA 1FBEA 4P1LA 1RDXA 5JK4A 1LBVA 2ZZWA 5EYGA 4PBQA 1NI9A 1FSAA 4GBVA 2VT5A 2XWOA 1RDYA 4MEVA 4JVDA 3E79A 3KC0A 3BIHA 4O94A 4XFEA 1NV3A 2ZZXA 5ET7A 4F19A 1K9YA 4MCOA 1EYJA 2QVVA 1FPKA 4GWXA 1JP4A 3IFAA 2WEFA 4N15A 2ZZVA 1FJ6A 4MJOA 5F24A 1NV5A 2FBPA 4NGUA 1IMFA 5EYHA 4NAPA 3D1RA 1DBZA 4F1VA 5I3SA 4PF6A 4XEQA 4HE0A 4HCWA 5EQ9A 3W9VA 1G0IA 3PTYA 1FBDA 4MIJA 5IZZA 2QPQA 2OX3A 1LBWA 2DE4A 4MNPA 2P3NA 4I3YA 1FBFA 1NV4A 1LBYA 1FBGA 4N6KA 4PF8A 4P8BA 2XWKA 1FBHA 4N17A 2CZKA 2VPNA 4GX6A 4N8GA 4OA4A 2JJKA 5ESYA 1Q9DA 4NX1A 5EQ8A 3T1BA 4H45A 2Q74A 2HZKA 4JVIA 4X04A 3FBPA 2V3QA 2OWZA 4GBWA 2CEXA 3LUZA 4PFRA 3U65A 1IMAA 4LN5A 1YZ0A 4IR8A 4MNCA 2XWIA 2HPGA 4OVQA 4GWWA 4O7IA 2DE2A 3MSTA 1LBZA 1K9ZA 4N6DA 4F1UA 2B4LA 2R8TA 4HE1A 2WBDA 4OVTA 2VPOA 2HXRA 1NV0A 2L5VA 5ET8A 2GQ1A 5J1DA 2PFZA 3ISPA 4O8MA 1NUWA 4O7MA 4NG7A 3KC1A 3T0JA 2HHMA 1FTAA 2Y5KA 4MAGA 1YXIA 4MHFA 5EQ7A 4N8YA 4OVRA 3SZPA 4PCDA 4KXPA 4PDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IME A;  2CZH A;  4GWS A;  1FPJ A;  1G0I A;  5LDZ A;  2FIE A;  1FBD A;  1XI6 A;  1DK4 A;  2OX3 A;  1NUX A;  1LBW A;  1CNQ A;  1AWB A;  2P3N A;  2F3D A;  4I3Y A;  2Q8M A;  1FBF A;  1NV6 A;  1NV4 A;  3IFC A;  1LBY A;  1FBG A;  4GX3 A;  1FPG A;  4N81 A;  5IZ3 A;  2P3V A;  4PTK A;  3B8B A;  4GWU A;  4I3E A;  1FPI A;  1NV1 A;  1IMC A;  4I40 A;  1FBH A;  1INP A;  4GX4 A;  1G0H A;  2CZK A;  4HE2 A;  1NV2 A;  2F3B A;  1NUZ A;  1LBX A;  4GX6 A;  2JJK A;  1DCU A;  2Y5L A;  5ESY A;  1Q9D A;  5EQA A;  2QVR A;  4GWY A;  1VDW A;  1NV7 A;  2WBB A;  5EQ8 A;  4H45 A;  3RPL A;  2Q74 A;  5IZ3 B;  2CZI A;  3FBP A;  2OWZ A;  1FBE A;  4GBW A;  1RDX A;  3LUZ A;  3QMF A;  1IMA A;  5T3J A;  4G61 A;  5IZ1 A;  1LBV A;  1YZ0 A;  5EYG A;  1NI9 A;  1FSA A;  1RDZ A;  2BJI A;  4IR8 A;  2FIX A;  1FPB A;  1FPF A;  1BK4 A;  1FBP A;  5DW8 A;  4GBV A;  3RPL B;  4AS5 A;  4GWW A;  1KZ8 A;  2VT5 A;  4O7I A;  1RDY A;  1IMB A;  4GWZ A;  1IMD A;  1LBZ A;  1KA0 A;  2FVZ A;  1K9Z A;  5ET6 A;  3BIG A;  3KBZ A;  3KC0 A;  3BIH A;  1NUY A;  2R8T A;  4HE1 A;  2DDK A;  1KA1 A;  1SPI A;  2WBD A;  1FPD A;  1NV3 A;  5ET7 A;  1NV0 A;  2FHY A;  1EYI A;  1K9Y A;  5ET8 A;  5FBP A;  1EYJ A;  2QVV A;  1FPK A;  5ET5 A;  4GWX A;  2GQ1 A;  1JP4 A;  3IFA A;  2WEF A;  1FPE A;  2PCR A;  4QXD A;  1FJ6 A;  4MJO A;  5A5L A;  4AS4 A;  5F24 A;  4H46 A;  3ROJ A;  1NV5 A;  1LEV A;  3A29 A;  2FBP A;  3LV0 A;  1D9Q A;  1IMF A;  1NUW A;  5EYH A;  4FBP A;  1QGX A;  3KC1 A;  3T0J A;  1FPL A;  2HHM A;  1EYK A;  2QFL A;  1YYZ A;  1FTA A;  2Y5K A;  3D1R A;  1DBZ A;  1YXI A;  5J16 A;  2QVU A;  1FRP A;  4HXV A;  3RYD A;  1FJ9 A;  5I3S A;  5EQ7 A;  4HE0 A;  1FBC A;  5EQ9 A;  4KXP A; 
#chains in the Genus database with same CATH topology
 2V93 A;  1BKA A;  2DXY A;  1MPC A;  2GFE A;  3KSX A;  2ANJ A;  4ZZA A;  2F97 A;  1S50 A;  2QS4 A;  5IZ3 A;  3OD7 A;  2VD2 A;  3K02 A;  5AA4 A;  1MPD A;  3C9H A;  1N76 A;  4NF0 A;  5DEX B;  4Z0I A;  1F9B A;  2XXV A;  3PPN A;  5FHM A;  1YCJ A;  1ELJ A;  3G3H A;  3B50 A;  4U4X A;  4X48 A;  5EHS A;  1B52 A;  4DI3 D;  5IZ1 A;  1Z7M E;  2OLB A;  3EF7 A;  4YZZ A;  2F7B A;  1RYX A;  3S9M C;  2F6P A;  2HZL A;  3N94 A;  5F1Q A;  4RK2 A;  4E0X A;  3PV0 E;  3UOR A;  1FPD A;  4ELQ A;  4UAC A;  1UTH B;  5TU0 A;  5H8S A;  4F3S A;  3KN8 A;  1BIY A;  2AYS A;  1MH4 A;  3SES A;  5A5L A;  3DLN A;  4H46 A;  3A29 A;  4BLA A;  2H99 A;  3Q26 A;  1ZLQ A;  4MMP A;  4OVJ A;  4EXL A;  5CMM A;  1LST A;  2KLF A;  4R9F A;  2XX8 A;  4OAN A;  4F1Y A;  4HXV A;  3NOH A;  3MZ1 A;  2DSF A;  1MDQ A;  4G68 A;  5TP9 A;  3VLV A;  2KQZ A;  4QF9 A;  3R26 A;  3OEM A;  5LOM A;  2IA4 A;  1NV6 A;  2QRY A;  3IFC A;  4N81 A;  1IXC A;  3H6U A;  1ZJL A;  3G3G A;  1D3K A;  4BDR A;  5I7I A;  5AA3 A;  4YIC A;  1OQH A;  3TTM A;  2Y5L A;  2F78 A;  1L5T A;  5CMC A;  1VDW A;  2Q8J A;  2F36 A;  5ISU A;  3TFL A;  2RC8 A;  1DTG A;  3BFT A;  4RYA A;  4NF8 B;  3JYR A;  1KWH A;  2I0B A;  4FED A;  4ZS9 A;  4QFN A;  4GXS B;  1IMB A;  3QXM A;  4I8C A;  3O2A A;  3BIG A;  2XXI A;  3PD9 A;  4POW A;  4R9G A;  1XOC A;  4H0W A;  2I4C A;  4TQU Q;  4XXU A;  1Y9U A;  1O63 A;  4P3L A;  2D21 A;  2XXU A;  3V83 A;  4G8M A;  4H5G A;  4ZEK A;  3USD A;  3FJ7 A;  1QKB A;  1M5C A;  3ILU B;  1B5J A;  5CMB A;  3OXN A;  1EZO A;  4PFB A;  3IOR A;  1P1N A;  2AL5 A;  1TXF A;  4O3A A;  1D9Q A;  3T22 A;  3S2V A;  4WED A;  3G3I A;  4NF4 A;  1YYZ A;  5A5X A;  2VOZ A;  4IO2 A;  4F29 A;  3HO7 A;  4MH5 A;  5J16 A;  3C31 A;  5I2K A;  1BP5 A;  2XWV A;  4WXJ A;  4DDD A;  1B2H A;  3BKI B;  3VLW A;  4PFW A;  2V3U A;  1TFD A;  1XI6 A;  4U23 A;  2OWS A;  4PAK A;  1FCK A;  2X7P A;  2VHA A;  1N84 A;  2V4C A;  3PMW A;  2DOJ A;  3PUW E;  1LGB C;  4NF5 B;  2R6G E;  1N3X A;  3GYY A;  4PFY A;  3PGF A;  1MXY A;  1PB7 A;  2XXX A;  1FW0 A;  2Y7I A;  2OWT A;  3SEX A;  4JWX A;  5JK4 A;  2Y7K A;  2NXO A;  3VVF A;  2O84 X;  2VGQ A;  1BLF A;  4MEV A;  4OTE A;  1TT1 A;  4JVD A;  3E79 A;  3BIH A;  5H8H B;  3G3J A;  2OPD A;  4O94 A;  3HCQ A;  3SEU A;  2FA7 A;  4I1D A;  3BBR A;  4ZE8 A;  3R7X A;  3RPW A;  4GIZ A;  4MCO A;  3LSL A;  2QVV A;  1FPK A;  4Q30 B;  4F39 A;  1M5D A;  1GVC A;  4FAT A;  2F7C A;  3ONM A;  2ZZV A;  5F24 A;  1FQE A;  4IO3 A;  4X1B A;  2WKY A;  1VFE A;  1B3H A;  4XKP A;  3PUX E;  3OO9 A;  4ESW A;  3SEY A;  3KOT A;  4F3G A;  5AA2 A;  4HE0 A;  4R75 A;  3IL1 B;  5EQ9 A;  3S9N C;  4U21 A;  1MG1 A;  1MQH A;  1FBD A;  4MIJ A;  1USY E;  4Q5T A;  1LBW A;  1Y3Q A;  1H3D A;  4N6P A;  3K6X A;  1CB6 A;  3TAJ A;  1FBF A;  1Y1M A;  3H03 A;  5DTB A;  1LFI A;  4PF8 A;  3EQ1 A;  3PUZ E;  4EQB A;  1NNP A;  2A5T B;  2O6A A;  3H3G A;  3QAX A;  2VPN A;  3G3K A;  5ESY A;  4G8N A;  4NX1 A;  1SDX A;  2Q74 A;  4JVI A;  3CIJ A;  4X04 A;  2BJJ X;  2GH9 A;  3P7I A;  3IAZ A;  3B6Q A;  3LUZ A;  1UIU A;  4RK9 A;  2ZMB A;  1YZ0 A;  2QL3 A;  2O68 A;  5DVI A;  2DWJ A;  4O3B A;  1QW0 A;  4H8I A;  1US5 A;  5FHO A;  3FVG A;  2DE2 A;  3Q25 A;  3VXC A;  1IUD A;  2DXR A;  4NMY A;  3H6T A;  1LFG A;  1K9Z A;  4N6D A;  2B4L A;  4YMB A;  2WBD A;  5FHN A;  4DIG A;  4OES A;  1LCT A;  2B3F A;  1ZKB A;  5J1D A;  2XXP A;  4EF2 A;  1A55 A;  2RC9 A;  3E4R A;  3IB2 A;  2PFZ A;  1UQW A;  4YMA A;  3IO6 A;  1NUW A;  4AB5 A;  3T0J A;  2QS3 A;  2QMX A;  4IB2 A;  4MHF A;  5BUU A;  1B7H A;  3FJM A;  3PUV E;  3M3L A;  1XVY A;  4ZED A;  4G77 A;  1NNK A;  1WDN A;  3HPI A;  3EHT A;  1O7T A;  1MXV A;  5CM6 A;  3H6V A;  2ONS A;  5DT6 A;  4BDN A;  1B4H A;  3C33 A;  2WX9 A;  2ONR A;  3K6U A;  2HQ0 A;  3IOU A;  4P9K A;  2UVH A;  4F18 A;  4H5F A;  1WVJ A;  1MY4 A;  5I56 A;  1FTO A;  3E3K A;  1SYI A;  3U93 A;  5TPA A;  3K6V A;  4YKK A;  4RY1 A;  3ZSF A;  1M5B A;  4BDM A;  4DZ1 A;  3A3U A;  1B3F A;  4DCX A;  1RDZ A;  2FIX A;  3FVO A;  1FPF A;  4LQ5 A;  3K0V A;  3I5O A;  1B51 A;  2YLN A;  5L9M A;  4ZDM A;  2KR0 A;  4FOR A;  3EKI A;  3Q28 A;  1B3L A;  1FQF A;  4KD5 A;  5IAI A;  4AB6 A;  2UVG A;  2B4M A;  4OQO A;  2FHY A;  4DXC A;  3CR9 A;  4EF1 A;  1I6B A;  3N5L A;  5KDT B;  3VV5 A;  4H65 A;  1II5 A;  3DEL B;  4OFL A;  1JQF A;  2OBG A;  1US4 A;  3GXA A;  5A5X B;  5ICT A;  2O7I A;  2HAU A;  2ZNU A;  3LV0 A;  5I2K B;  3M3K A;  3OO6 A;  1RKM A;  3K6W A;  1FTJ A;  4HTG A;  4RNS A;  4EXK A;  4QBA A;  2Z8D A;  4FE8 A;  2XXR A;  5HM4 B;  1FBC A;  2ALU A;  1MXZ A;  2CZH A;  1ZBM A;  2VP1 A;  3T9V A;  3HHG A;  1NUX A;  5KCJ B;  4IY5 A;  4JVC A;  1EZ9 A;  3O6H A;  1QUI A;  1UTB B;  3FVN A;  3S9L C;  4XF5 A;  5I57 B;  4I3E A;  5AA1 A;  1INP A;  5I58 A;  4GX4 A;  1YTV A;  1NV2 A;  1NUZ A;  3TTN A;  2QVR A;  2V84 A;  3TQL A;  3SKP A;  3LSW A;  5I2N A;  1HSE A;  1I69 A;  2NUV A;  1IQ7 A;  1JVX A;  4QHQ A;  2O7U A;  3MVZ A;  4R72 A;  2XXT A;  1NFT A;  3PMV A;  3TTR A;  1GTK A;  1FPB A;  4U4S A;  3QIM A;  1PB8 A;  3RPL B;  5AA2 D;  3IK6 B;  4XTC Q;  3KZG A;  5KZT A;  3JZJ A;  3KBZ A;  1IEJ A;  1QKA A;  2PYY A;  1H76 A;  4NTL A;  1MXU A;  2PFY A;  3H6W A;  2PVU A;  1TFA A;  4EQ9 A;  3MVY A;  3QYT A;  5ET5 A;  1ZIU A;  3OEN A;  1B1X A;  3O97 A;  5AE4 A;  4WKM A;  3TEL A;  3KOS A;  4AS4 A;  2QSX A;  3N6U A;  2WYP A;  4IY6 A;  4KQP A;  4OER A;  1MH3 A;  4ZEB A;  3O6G A;  4IO7 A;  4LZ5 A;  3FAS A;  1MQJ A;  2Y7W A;  1B3E A;  3MYU A;  1SW2 A;  2XX7 A;  3HHF A;  3KBR A;  3T66 A;  1ANF A;  4L17 A;  5L9O A;  1CNQ A;  5H8N A;  4LVQ A;  2Q2A A;  1B32 A;  5CMK A;  4GX3 A;  2ZYO A;  3MWB A;  1NV1 A;  3C35 A;  3K4U A;  3K00 A;  4I40 A;  1ZMG A;  3FXB A;  3MP1 A;  2OCU A;  3QUJ A;  1MY0 A;  4PC9 A;  1LBX A;  3ZS6 A;  1POY 1;  4F2O A;  4PP0 A;  3TOD A;  3T9H B;  3A3C A;  3EPE A;  4DI4 B;  1GV8 A;  2ABH A;  4MLQ A;  4GL0 A;  1B05 A;  3KJ7 A;  4M1V A;  1P1O A;  4H1X A;  4QSD A;  4WEP A;  2XD2 A;  1B46 A;  1JW4 A;  5M2V A;  4QRZ A;  1Z7N E;  2ZZW A;  3MJN A;  3V8X B;  2ZYN A;  1MQG A;  3VE1 B;  5B7D A;  1LAH E;  5BWJ A;  1PDA A;  2ZNS A;  2DVC A;  4QFP A;  1GGG A;  1DSN A;  3VFJ A;  2HCA A;  3JV9 A;  3KJT A;  4YAH X;  4ND9 A;  2G29 A;  5ET7 A;  2QS2 A;  3S4U A;  4F19 A;  3RTF B;  3TCF A;  3RT8 A;  3H06 B;  1P1W A;  3IFA A;  2NOO A;  4N15 A;  5CBS A;  3CG3 A;  3DP6 A;  3VVD A;  3EHS A;  1PC3 A;  2FBP A;  4NGU A;  4YB5 A;  2QJE A;  3OEK A;  3MPL A;  3D1R A;  4X1D A;  4F1V A;  2Q2C A;  2O1L A;  2V25 A;  4HCW A;  1JNF A;  2FYI A;  5CRY A;  3PU5 A;  3T93 B;  2RCA A;  3W9V A;  4KYD A;  5IZZ A;  2QPQ A;  2OX3 A;  3DP4 A;  4AQ4 A;  2HAV A;  2ZYM A;  4I3Y A;  2E0S A;  1MDP 1;  3E9X A;  4JSD A;  3V5A A;  5B70 A;  3MZB A;  4F31 B;  5FTH A;  2XXW A;  4N07 A;  4HS7 A;  5I56 B;  3RT6 B;  2UYF A;  1FBH A;  3IX1 A;  4ELO A;  4JB7 A;  2CZK A;  3MP6 A;  4GX6 A;  1EH3 A;  2VD3 A;  4OA4 A;  2JJK A;  1IIT A;  1I6Q A;  5CBR A;  1PB9 A;  2ONK E;  1B4Z A;  3TMG A;  3MUQ A;  2CEX A;  4DCY A;  3U65 A;  4R6H A;  2FNC A;  1D9Y A;  4YKJ A;  4C1U A;  4QSC A;  4MNC A;  3U1O A;  3LBS A;  2HPG A;  4OVQ A;  3SET A;  4O7I A;  3TZA A;  3MST A;  4NF6 A;  3EHU A;  4QFO A;  4XIG Q;  2R8T A;  4HE1 A;  5IKB A;  4OVT A;  4U22 A;  4PQJ A;  5DVJ A;  2VPO A;  5I59 A;  2HXR A;  3K01 A;  5ET8 A;  1NMU A;  2Z23 A;  3CRB A;  4OYV A;  5JTY A;  3I6V A;  3PMX A;  4GLI A;  2V3T A;  4O7M A;  3KC1 A;  2HHM A;  1FTA A;  4GD5 A;  4MAG A;  4N8Y A;  4ZE9 A;  1JW1 A;  3SZP A;  3IR1 A;  3LC8 A;  3L6H A;  3FD3 A;  3W9W A;  3CHG A;  5L8D A;  1MY3 A;  1M5E A;  1DMB A;  4X8R A;  1IXG A;  1SW1 A;  4NED A;  3MZ9 A;  4KCC A;  4ECF A;  4O3C A;  4ISU A;  4ZEI A;  1FPG A;  3UP9 A;  3WAE A;  4R2F A;  3B8B A;  1FPI A;  2B3B A;  5I2N B;  2CMO A;  4G8H A;  4RA1 A;  4LZ7 A;  1PBP A;  3TTK A;  5IZ3 B;  2WYK A;  1QUK A;  1QJM A;  3RY3 A;  3QMF A;  4Q0C A;  4MFI A;  5AA4 B;  3CSB A;  2XXY A;  2UVJ A;  4H8J A;  3O66 A;  2BJI A;  1BK4 A;  2Q9T A;  1Y3N A;  4KYE A;  4PFI A;  3AXF A;  1UTH A;  3T96 B;  4GWZ A;  3LUY A;  3HFU A;  3FUZ A;  1FTM A;  4IO6 A;  1KA0 A;  2FVZ A;  2RCB A;  1EZP A;  4R74 A;  3IB1 A;  5L9S A;  4QFL A;  1RYO A;  4LP2 B;  3ZKK A;  2M8C A;  2OJT A;  3MC2 A;  3H4Z A;  4R6Y A;  2THI A;  4YKI A;  1FPE A;  2DWH A;  3IB0 A;  4PBH A;  2F5X A;  3ROJ A;  3MBP A;  4OVP A;  4P56 A;  1LEV A;  4YB6 A;  4PDD A;  1QGX A;  3FV1 A;  4FEB A;  2DE3 A;  2HFB A;  3D4G A;  1DPP A;  4F2Q A;  4NQ8 A;  3ILT B;  4H67 A;  3C4M A;  1QUJ A;  4OWD A;  3KN7 A;  5H8N B;  2F34 A;  3CI8 A;  1FPJ A;  3FV2 A;  3IJO B;  4DXB A;  1SVX B;  1AWB A;  2YJP A;  5I84 A;  1NH7 A;  4YU0 A;  2LAO A;  1XHY A;  1FQB A;  4G68 B;  2CZL A;  4LAT A;  5TP9 B;  2B65 A;  4NWD A;  4NF8 A;  4YB7 A;  3K1P A;  4N91 A;  1N7X A;  3KN3 A;  2XX9 A;  4PGP A;  5ELV A;  2RIN A;  4P47 A;  5H8Q A;  1MQI A;  4GWO A;  4LA9 A;  4OVS A;  5T3J A;  4LZ8 A;  1LAF E;  3TCH A;  2DWA A;  1SI0 A;  1FBP A;  1R6Z A;  1NNF A;  2I0C A;  1B58 A;  1OVT A;  3TEP A;  2XA5 A;  4N4U A;  5ET6 A;  2H98 A;  3FAT A;  3M3F A;  1NUY A;  3MVX A;  1IXH A;  4PFU A;  4KCD A;  1OMP A;  3UK4 A;  2W7Y A;  3GZG A;  3ECR A;  5FBP A;  5EYF A;  2UVI A;  5IM2 A;  2F8D A;  1A7L A;  3IOW A;  1FTK A;  4XKQ A;  2R71 A;  4NWC A;  1B5H A;  1OIB A;  1VSO A;  4ZEC A;  3KGC A;  4ELP A;  1D4N A;  2RF1 A;  3EN3 A;  4P0I A;  2DVZ A;  4K3F A;  3O6I A;  1N04 A;  1URD A;  1SD3 A;  4MF3 A;  4TLM B;  3LR1 A;  2UYE A;  3CFL A;  3OMB A;  1OLA A;  3L6G A;  1B6H A;  3I3V A;  1Y4C A;  4NF4 B;  4NF5 A;  3SEV A;  2Q89 A;  1A99 A;  2DYX A;  2F6G A;  2P3V A;  4GWU A;  4X9T A;  1FTL A;  1S7Y A;  1DCU A;  3DP8 A;  2WBB A;  4U2R A;  1LBC A;  4IGT A;  2Y7P A;  2MKZ A;  4NHB A;  2CZI A;  2H25 A;  3OSQ A;  3V89 B;  4OZ9 A;  4Z7E A;  1FBE A;  1MM7 A;  1RDX A;  4LQ2 A;  4YKP A;  3PUY E;  1LBV A;  5EYG A;  1FSA A;  3OO7 A;  1Q35 A;  2H5Y A;  1S9T A;  4NF6 B;  4JWO A;  4GBV A;  2VT5 A;  1B5I A;  1MRP A;  3VDF A;  2PBW A;  3HN0 A;  4XFE A;  2ZZX A;  1IZ1 A;  3QUF A;  5JTY B;  3VXB A;  1K9Y A;  4GFR A;  1YPN A;  4R2B A;  4U1O A;  4OMB A;  4KI0 E;  3UA8 A;  5EHM A;  4GWX A;  3O29 A;  2WEF A;  3F11 A;  1P1U A;  3MW0 A;  1LB9 A;  4MJO A;  3FJG A;  4XKN A;  3OSR A;  1XVX A;  1FQC A;  3GLB A;  5K2Y A;  1JET A;  1B40 A;  3RLF E;  3CVG A;  1SQY A;  4QFK A;  4F22 A;  4QSE A;  4PF6 A;  3PPQ A;  1R9L A;  4EUO A;  2P0S A;  1VR5 A;  2H4I A;  1JVY A;  3RGY A;  3M8U A;  1A8F A;  1JW5 A;  3A09 A;  5H8F A;  1P99 A;  1G0I A;  2A5T A;  4MNP A;  3E13 X;  3RQT A;  3TCG A;  1NV4 A;  5AA2 B;  1SW4 A;  2DWI A;  1M5F A;  2ZNT A;  4OFO A;  2Y7R A;  2XWK A;  5JEI A;  1AL3 A;  4N8G A;  1USY H;  4JBZ A;  2X26 A;  4EDP A;  5EQ8 A;  2I3W A;  4H45 A;  3T1B A;  2QMW A;  1OVB A;  4Q8R A;  2OWZ A;  4JSO A;  4GBW A;  1WOD A;  1LBB A;  4FEC A;  4PFR A;  1IMA A;  4OEN A;  3QSL A;  1OLC A;  4IR8 A;  3PPP A;  4GWW A;  1Y1Z A;  2HEU A;  4OEU A;  3TTL A;  4RJZ A;  2Y84 A;  2Z8F A;  1H45 A;  2AL4 A;  3Q29 A;  4F1U A;  2L5V A;  1QUL A;  1SBP A;  4F3P A;  4ELR A;  1SYH A;  1AIV A;  2UXA A;  1Y3P A;  3ISP A;  3SER A;  4JXI A;  4E0W A;  3D4C A;  4O8M A;  3DM0 A;  4NG7 A;  2Y5K A;  1YXI A;  1MXX A;  4ESX A;  3HST A;  1LB8 A;  3FXQ A;  4POX A;  4PCD A;  3VLU A;  2I48 A;  4KXP A;  4DLD A;  4BDO A;  5LDZ A;  2E1S A;  1DK4 A;  3UIF A;  2ZXT A;  2DQV A;  3KSJ A;  1MQD A;  2O69 A;  3TKD A;  1NL5 A;  4PTK A;  1B9J A;  1YAE A;  3IOT A;  3CG1 A;  4HCY A;  1PBQ A;  4THI A;  4KYS A;  2F3B A;  5H8Q B;  4GOT A;  2I4B A;  2G93 A;  4R6K A;  3WAF A;  2GRV A;  1A8E A;  1VFD A;  4PE3 A;  3ODB A;  4MNI A;  2F7A A;  3MPK A;  4H6D A;  5F7V A;  4ZZE A;  5LTC A;  2YPN A;  4GVO A;  3FIR A;  3SEW A;  4OET A;  5TPA B;  2I3V A;  4AS5 A;  1KZ8 A;  5KDT A;  1LAG E;  1H43 A;  2PMS A;  3U8Q A;  4F3B A;  1CE2 A;  3MVW A;  2NWJ A;  4KPT A;  4UA8 A;  3KEI A;  1J1N A;  1B0L A;  4JDF A;  4TOZ A;  1MY1 A;  1OQG A;  1D9V A;  3H7M A;  2X7Q A;  3FVK A;  1B1H A;  2OK2 A;  3GBB A;  1HSJ A;  3PPO A;  4C1T A;  3MP8 A;  4RPN A;  4FIM A;  4LUB A;  3OOA A;  1PEB A;  5KCJ A;  3O9P A;  4FJP A;  4I62 A;  2QVU A;  1FRP A;  1UTB A;  3RYD A;  1FJ9 A;  1IIW A;  5HPQ A;  1QVS A;  5I57 A;  1IME A;  4OFJ A;  4IO5 A;  4R73 A;  1LAX A;  2OPE A;  2GHB A;  2Q8M A;  1N3W A;  4BDQ A;  5IGA A;  2XD3 A;  1ZU0 A;  4GRK A;  1IMC A;  4KR5 A;  4PAF A;  1G0H A;  4HE2 A;  1H44 A;  4MX6 A;  4EQ7 A;  5EQA A;  3OO8 A;  5DYH A;  1NV7 A;  3SDF A;  3RPL A;  4UAB A;  3K1N A;  5DEX A;  4GQO A;  2REG A;  5I58 B;  4KFQ A;  1NH8 A;  4G61 A;  2PT1 A;  2D3I A;  3LSF B;  1LFH A;  1Q1K A;  2Z8E A;  5DW8 A;  2RKM A;  2F35 A;  4IO4 A;  2O1M A;  4DXU A;  4XKR A;  1FQD A;  1IMD A;  1R1N A;  4PGN A;  5HBC A;  2DDK A;  1KA1 A;  1SPI A;  3W15 C;  1XT8 A;  3G7W A;  3IO4 A;  1EYI A;  3IJX B;  4P11 A;  3CSG A;  2DP8 A;  1NKX A;  4NN3 A;  2PCR A;  4PET A;  4QXD A;  5ITO A;  3UN6 A;  1B3G A;  1DTZ A;  2Q88 A;  3RN8 A;  3ZKL A;  4FBP A;  2REJ A;  2XXH A;  3O28 A;  1FPL A;  1EYK A;  2QFL A;  4P1E A;  4M4G A;  2H9B A;  2HXW A;  1POT A;  4G2Z A;  5H8F B;  3E78 A;  1TWY A;  1URS A;  1Y4T A;  1A54 A;  1SI1 A;  3B7D A;  4GWS A;  3CFZ A;  2FIE A;  1MS7 A;  2CEY A;  1B7U A;  5ITP A;  2XXQ A;  4N13 A;  3TDJ A;  3U94 A;  2Z22 A;  2F3D A;  3TYH A;  4PAI A;  1MY2 A;  2XXK A;  4OXV A;  1EU8 A;  1O64 A;  3FZV A;  5I5P A;  2PX1 A;  2DS9 A;  4GXA A;  4GL8 A;  3UGW A;  4NE4 A;  1NNT A;  1B7Z A;  2D5W A;  4GWY A;  4IGR A;  3TUS A;  4OEV A;  4U1Z A;  4P1L A;  3K1M A;  1IXI A;  2AIX A;  1BTJ A;  4GF8 A;  1NI9 A;  4PBQ A;  1N0T A;  1AMF A;  2PT2 A;  3TPA A;  1FQA A;  4RPO A;  3R6U A;  2XWO A;  1RDY A;  1DPE A;  3IOV A;  1LLS A;  1MXW A;  4C0R A;  5ICQ A;  3KC0 A;  4ZEF A;  3KFM A;  1JEV A;  2ESN A;  1NV3 A;  1N7W A;  1UIV A;  1AOV A;  1HSL A;  4DE8 A;  3RUM A;  5DVF A;  1T0K A;  1EYJ A;  1JP4 A;  3PD8 A;  3B6W A;  1FJ6 A;  3FXR A;  3VVE A;  3BFU A;  1NV5 A;  2P2A A;  2RC7 A;  3RNN A;  1IMF A;  4BDL A;  3KG2 A;  4JWY A;  5EYH A;  4NAP A;  3T9U A;  1MM6 A;  3G3F A;  2A5S A;  3S9E A;  1DBZ A;  5I3S A;  5FTI A;  4XEQ A;  3MAM A;  1AH5 A;  3FXU A;  3T9X B;  4P0G A;  1LCF A;  2P1S A;  4LON B;  3PTY A;  4G68 C;  2DE4 A;  5K2X A;  2P3N A;  3TQW A;  3CFX A;  3HV1 A;  4HW8 A;  1LBY A;  1FBG A;  1VE4 A;  4N6K A;  1I6A A;  4P8B A;  4RXL A;  2I49 A;  1XC1 A;  1Y20 A;  3PPR A;  4OHN A;  4N17 A;  3C34 A;  2I6E A;  3MQ9 A;  1GR2 A;  1P1Q A;  2NVU B;  3THI A;  1Q9D A;  4ONY A;  3FGS A;  2HZK A;  3FBP A;  3U72 A;  1JEU A;  2V3Q A;  4PFT A;  4TLL B;  5CC2 A;  4MLV A;  1URG A;  4LN5 A;  3C32 A;  1R9Q A;  2XWI A;  3GBA A;  4G4P A;  4MBP A;  3U92 A;  3C36 A;  1XS5 A;  3QK6 A;  1LBZ A;  3B6T A;  1ATG A;  4KHZ E;  3N26 A;  2GHA A;  1SW5 A;  1NV0 A;  5H8H A;  2XHD A;  4PE5 B;  3RTW B;  2OZZ A;  2GQ1 A;  4FAJ A;  2R9J A;  1MPB A;  3N6T A;  5CI5 A;  3OEL A;  3K2D A;  5I59 B;  2IEE A;  1ZTY A;  2ZYK A;  2QS1 A;  1A40 A;  1B0H A;  5EQ7 A;  1DOT A;  4OVR A;  3Q27 A;  4I9D A;  3LSX A;  2O51 A;  2I58 A;  4PDH A; 
#chains in the Genus database with same CATH homology
 3W9W A;  5LDZ A;  1DK4 A;  3CHG A;  5CM6 A;  4X8R A;  2WX9 A;  1FPG A;  5IZ3 A;  4PTK A;  3B8B A;  1FPI A;  4P9K A;  4HCY A;  4F18 A;  2F3B A;  4NF0 A;  5IZ3 B;  2WYK A;  4PE3 A;  3QMF A;  3B50 A;  4MNI A;  5IZ1 A;  4DI3 D;  5LTC A;  2BJI A;  1RDZ A;  2FIX A;  1FPF A;  1BK4 A;  2Q9T A;  4PFI A;  4YZZ A;  4AS5 A;  1KZ8 A;  2KR0 A;  4GWZ A;  3EKI A;  2HZL A;  3HFU A;  1KA0 A;  2FVZ A;  1FPD A;  2B4M A;  2FHY A;  1FPE A;  4PBH A;  2F5X A;  5A5L A;  4H46 A;  3ROJ A;  4OVP A;  4P56 A;  1LEV A;  3A29 A;  3LV0 A;  4PDD A;  4MMP A;  1QGX A;  2DE3 A;  4OAN A;  4QBA A;  2QVU A;  1FRP A;  4HXV A;  3RYD A;  1FJ9 A;  4NQ8 A;  3NOH A;  1FBC A;  1IME A;  2CZH A;  1FPJ A;  2KQZ A;  1NUX A;  4JVC A;  1AWB A;  2Q8M A;  1NV6 A;  3IFC A;  4N81 A;  4XF5 A;  5IGA A;  4I3E A;  1IMC A;  5I7I A;  4PAF A;  1INP A;  4GX4 A;  1G0H A;  4YIC A;  4HE2 A;  1NV2 A;  1NUZ A;  4N91 A;  4MX6 A;  2Y5L A;  5EQA A;  2QVR A;  1VDW A;  1NV7 A;  4PGP A;  3RPL A;  4UAB A;  4P47 A;  4OVS A;  5T3J A;  4G61 A;  1FPB A;  1FBP A;  5DW8 A;  3RPL B;  2XA5 A;  1IMB A;  4N4U A;  1IMD A;  5ET6 A;  3BIG A;  4PGN A;  3KBZ A;  1NUY A;  2DDK A;  1KA1 A;  1SPI A;  2PFY A;  4P3L A;  1EYI A;  5FBP A;  5ET5 A;  4NN3 A;  5IM2 A;  2PCR A;  4PET A;  4QXD A;  4PFB A;  4AS4 A;  1D9Q A;  2WYP A;  4FBP A;  1FPL A;  1EYK A;  2QFL A;  1YYZ A;  4P1E A;  5J16 A;  3E78 A;  2XWV A;  2DVZ A;  3MYU A;  4GWS A;  2FIE A;  1XI6 A;  2CEY A;  1CNQ A;  4PAK A;  2F3D A;  4PAI A;  4GX3 A;  2P3V A;  4GWU A;  2XXK A;  1NV1 A;  5I5P A;  4I40 A;  2V4C A;  3FXB A;  4X9T A;  4PC9 A;  1LBX A;  1DCU A;  4GWY A;  2WBB A;  3GYY A;  4DI4 B;  2MKZ A;  4NHB A;  2CZI A;  4M1V A;  1FBE A;  4P1L A;  1RDX A;  5JK4 A;  1LBV A;  2ZZW A;  5EYG A;  4PBQ A;  1NI9 A;  1FSA A;  4GBV A;  2VT5 A;  2XWO A;  1RDY A;  4MEV A;  4JVD A;  3E79 A;  3KC0 A;  3BIH A;  4O94 A;  4XFE A;  1NV3 A;  2ZZX A;  5ET7 A;  4F19 A;  1K9Y A;  4MCO A;  1EYJ A;  2QVV A;  1FPK A;  4GWX A;  1JP4 A;  3IFA A;  2WEF A;  4N15 A;  2ZZV A;  1FJ6 A;  4MJO A;  5F24 A;  1NV5 A;  2FBP A;  4NGU A;  1IMF A;  5EYH A;  4NAP A;  3D1R A;  1DBZ A;  4F1V A;  5I3S A;  4PF6 A;  4XEQ A;  4HE0 A;  4HCW A;  5EQ9 A;  3W9V A;  1G0I A;  3PTY A;  1FBD A;  4MIJ A;  5IZZ A;  2QPQ A;  2OX3 A;  1LBW A;  2DE4 A;  4MNP A;  2P3N A;  4I3Y A;  1FBF A;  1NV4 A;  1LBY A;  1FBG A;  4N6K A;  4PF8 A;  4P8B A;  2XWK A;  1FBH A;  4N17 A;  2CZK A;  2VPN A;  4GX6 A;  4N8G A;  4OA4 A;  2JJK A;  5ESY A;  1Q9D A;  4NX1 A;  5EQ8 A;  3T1B A;  4H45 A;  2Q74 A;  2HZK A;  4JVI A;  4X04 A;  3FBP A;  2V3Q A;  2OWZ A;  4GBW A;  2CEX A;  3LUZ A;  4PFR A;  3U65 A;  1IMA A;  4LN5 A;  1YZ0 A;  4IR8 A;  4MNC A;  2XWI A;  2HPG A;  4OVQ A;  4GWW A;  4O7I A;  2DE2 A;  3MST A;  1LBZ A;  1K9Z A;  4N6D A;  4F1U A;  2B4L A;  2R8T A;  4HE1 A;  2WBD A;  4OVT A;  2VPO A;  2HXR A;  1NV0 A;  2L5V A;  5ET8 A;  2GQ1 A;  5J1D A;  2PFZ A;  3ISP A;  4O8M A;  1NUW A;  4O7M A;  4NG7 A;  3KC1 A;  3T0J A;  2HHM A;  1FTA A;  2Y5K A;  4MAG A;  1YXI A;  4MHF A;  5EQ7 A;  4N8Y A;  4OVR A;  3SZP A;  4PCD A;  4KXP A;  4PDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...