2R8TA

Crystal structure of the fructose 1,6-bisphosphatase glpx from e.coli in the complex with fructose 1,6-bisphosphate
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
323
structure length
319
Chain Sequence
RRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEIAEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYMEKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVRVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNIATTETLLIRGKSRTIRRIQSIHYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase class II glpX
publication title Crystal structure of the fructose 1,6-bisphosphatase GlpX from E.coli in the complex with fructose 1,6-bisphosphate
rcsb
source organism Escherichia coli
total genus 105
structure length 319
sequence length 323
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03320 FBPase_glpX Bacterial fructose-1,6-bisphosphatase, glpX-encoded
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2r8tA01
3.40.190.90 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2r8tA02
5J16A 1LBZA 2QFLA 3IFAA 1IMBA 4GX4A 5EQ9A 1FJ6A 5ET6A 1FRPA 4MJOA 2FIEA 2DDKA 2CZKA 5EYGA 4GWUA 4AS5A 1YXIA 5EYHA 1YZ0A 4GWWA 1FBGA 3A29A 4AS4A 2WBDA 5LDZA 1RDYA 2F3DA 2PCRA 1INPA 4GX6A 1NV2A 1FSAA 2P3VA 1EYJA 1KZ8A 5ET7A 5ET5A 4PTKA 2FIXA 1NV1A 5T3JA 1NUYA 5DW8A 4GWXA 1FPKA 1NV0A 2CZHA 2QVVA 3T0JA 1Q9DA 1NUWA 5ESYA 1NV6A 1FJ9A 1K9ZA 4GBVA 4GWYA 1IMEA 3B8BA 2Y5LA 4KXPA 2JJKA 5EQAA 2P3NA 1QGXA 1XI6A 4HE0A 2WBBA 1EYKA 3ROJA 4HE1A 4I3YA 4GWSA 1D9QA 5EQ7A 1LEVA 4GX3A 5IZ3A 1NV3A 4H45A 1FPIA 1FBFA 1K9YA 3LUZA 5FBPA 4HE2A 1G0IA 1LBYA 1KA1A 2FBPA 3IFCA 3KC0A 1NUZA 3RPLA 1RDZA 3KC1A 3FBPA 2R8TA 3BIHA 1NUXA 4QXDA 2FVZA 2Q8MA 1FPDA 1LBVA 5A5LA 1JP4A 2FHYA 2QVRA 1FBPA 1LBXA 1FBCA 1FPLA 3RYDA 3QMFA 1CNQA 1FPGA 2Q74A 1DCUA 1FPEA 1NV7A 1DBZA 5I3SA 2HHMA 1DK4A 1FPBA 4O7IA 3D1RA 1IMAA 4I3EA 5IZ3B 1EYIA 1AWBA 2F3BA 2OWZA 1LBWA 2VT5A 1NV5A 1FPJA 2OX3A 3BIGA 1YYZA 3RPLB 1FBDA 1NV4A 2CZIA 4GBWA 2GQ1A 2WEFA 4N81A 5IZ1A 1FBHA 2QVUA 3KBZA 5EQ8A 1SPIA 1BK4A 1RDXA 4I40A 4HXVA 1VDWA 1IMFA 4H46A 2Y5KA 1IMCA 1FBEA 3LV0A 2BJIA 5F24A 1FPFA 4IR8A 4GWZA 1IMDA 1FTAA 5ET8A 1G0HA 1KA0A 4FBPA 1NI9A 4G61A
chains in the Genus database with same CATH superfamily
3MSTA 4JWOA 1IMBA 5EQ9A 2ZYMA 4KFQA 5TPAA 4O94A 4WXJA 3IL1B 4YICA 2IA4A 4ZE8A 3QUJA 1OVTA 1RKMA 4IO2A 1TFAA 5I59A 2Z22A 2XX7A 4P56A 1B1XA 3PV0E 1B0HA 2JJKA 1QJMA 2I3WA 4OERA 3I3VA 1SW1A 4LA9A 1URDA 4X48A 5HM4B 4JWXA 3IO4A 2WYPA 3PUVE 4N8YA 4NF8B 5J1DA 2Z8FA 1B5IA 4YKPA 3S9MC 3UIFA 1P1QA 3K2DA 4JVIA 3H6UA 1B9JA 2ZMBA 4H67A 4ZE9A 2NUVA 1B5HA 3N94A 1DBZA 1SI0A 2H25A 3PGFA 1DK4A 3T9UA 3PPOA 4LQ2A 2H5YA 4OXVA 2IEEA 5I57B 4MLQA 4LUBA 4OVRA 1B7UA 3PUXE 1IEJA 1UTHB 4OQOA 2V84A 2CZLA 4NEDA 1DPEA 2HZLA 3O28A 4F3PA 2BJIA 3K02A 3TPAA 2R6GE 4LONB 4YAHX 4C1UA 3G3GA 4DI4B 1B6HA 2OWSA 4EQ9A 4BDNA 3RUMA 2WBDA 3IOVA 4YKIA 1POY1 2CEYA 4F31B 1SW5A 4PTKA 2FIXA 5DW8A 1WODA 3EF7A 3ZSFA 1B4ZA 2F97A 3M8UA 1Y1MA 1A99A 3HV1A 5DVJA 3B50A 1K9ZA 4NGUA 4KYSA 4F1VA 1B4HA 1SDXA 5ITOA 4H6DA 3V83A 4ELOA 1WDNA 4F29A 4MNPA 1Q1KA 4PE3A 2O6AA 3T9VA 4YMBA 4KQPA 2F7AA 2YLNA 2ONSA 5F1QA 5I2KA 2FVZA 3CFLA 4RK2A 4FJPA 2QVRA 1NNKA 5LTCA 3KJTA 2R71A 3CR9A 3RT6B 4P0IA 2ZNUA 4M4GA 4PC9A 3DLNA 4KYEA 3LSLA 3OEMA 3KN8A 5DEXB 3PD9A 2ZYNA 3G3JA 5H8NA 1A55A 1H43A 3IK6B 1MM7A 3SEUA 4HXVA 2GHAA 3CFZA 5H8HB 4DDDA 2P2AA 4WEDA 4Q5TA 3LUZA 3QSLA 3VLUA 1OIBA 2M8CA 5AA4B 3MAMA 3T96B 1FQCA 1FJ6A 3R6UA 4MEVA 3SEWA 2H9BA 2ZZXA 4QSCA 3MVWA 5I58A 4DXUA 4NF4B 1I69A 4O3CA 4DXBA 4HTGA 1EYJA 2ZXTA 5T3JA 1ZJLA 2O69A 1VFDA 4TOZA 3TTKA 4PFRA 5ESYA 1DTZA 4MNCA 4BDLA 1Y1ZA 5FTHA 4F2QA 1MXYA 4IB2A 1TFDA 2Y7WA 1I6QA 4YB5A 4G2ZA 1NKXA 1ZIUA 3TTRA 5JTYA 1LB8A 2GH9A 1M5BA 3E9XA 1G0IA 1US4A 1NUZA 1JW1A 3FBPA 3TQWA 3FZVA 1IUDA 3G3FA 1LAGE 4JSOA 2ONKE 4X9TA 1LBBA 1B0LA 4EUOA 1LB9A 2Q2AA 3FUZA 3QIMA 4TQUQ 1AH5A 4RPNA 1ZLQA 4IO3A 3SERA 4PDDA 3U94A 3ISPA 1NV5A 2CZIA 4GBWA 3H06B 3KOTA 4NG7A 5KCJB 1N0TA 3KGCA 3KOSA 1IMFA 3V5AA 1PC3A 3M3FA 4OYVA 4RYAA 1OVBA 5ET8A 4LVQA 4GIZA 4DIGA 4N91A 5KDTB 2CZKA 4PFYA 1YXIA 4FATA 1GR2A 3ILUB 2ZNSA 4GX6A 3T9HB 4QFKA 3TUSA 5I57A 2I48A 1NUWA 2DWIA 3CG3A 4RK9A 1BTJA 4KXPA 1H44A 1XI6A 1B3EA 3ROJA 4ZZAA 4ONYA 4KI0E 1JEUA 4OVJA 3TCFA 3DELB 1LFGA 3B6WA 1LBYA 4F39A 4P1EA 1N84A 4KR5A 3U1OA 5B7DA 1URGA 4N6DA 1HSLA 2UYEA 4Z0IA 3HPIA 2Y7IA 3T66A 4NQ8A 1AL3A 3W9WA 5TP9A 5BWJA 1P1WA 2NVUB 1CNQA 4ZEBA 4U1ZA 5IM2A 3U8QA 4AB5A 4LP2B 3MUQA 4KYDA 2KR0A 2HAUA 3H3GA 1YCJA 1VFEA 4X1BA 1SI1A 2WEFA 5IZ1A 3KBZA 2X26A 5DTBA 3OSRA 4HCYA 2FA7A 4G8MA 4PFBA 2V25A 3IOWA 5AA2D 5ISUA 1JETA 4N6PA 4G61A 3ILTB 1LBZA 3HHGA 2F7CA 4HS7A 5EYFA 4RPOA 5CMMA 1NH7A 1MY1A 4GWUA 3C31A 5EYHA 4ZEKA 2O1MA 1T0KA 2V4CA 2UVGA 1MQIA 1NNPA 2Q9TA 5ET7A 1FCKA 1FW0A 4LZ8A 1S50A 4QFLA 3TTNA 2YPNA 1JW5A 3BKIB 5LOMA 1QULA 2F34A 5H8HA 4DLDA 2I4BA 2UVJA 1D9QA 3MW0A 4JVCA 5EQ7A 1GV8A 2QS2A 4I1DA 2REGA 5IZ3A 2G29A 5AA4A 3K01A 1WVJA 3BFTA 5H8SA 3OENA 3KC1A 3RLFE 3PPRA 3L6HA 1FTOA 1LBVA 3ZS6A 1FPLA 3RNNA 5I5PA 1B58A 3VXBA 1DSNA 2V3QA 2DE3A 2HEUA 4OWDA 3H6VA 2RKMA 3KBRA 1J1NA 2D21A 1IZ1A 2Z8DA 2OJTA 2WX9A 2Y7PA 1KWHA 1B5JA 1JEVA 2UVIA 1O63A 1D9VA 4PF8A 4H0WA 5FHNA 3WAFA 1FBEA 4OESA 4PFTA 4R75A 1DPPA 2Q88A 2A5TA 1MY2A 1MQHA 3U93A 1SYHA 3E4RA 4K3FA 3MJNA 2WYKA 2GRVA 4P9KA 2PX1A 3CSGA 2RC9A 3HSTA 1MPBA 1EZPA 2OPEA 4DZ1A 1SW4A 5LDZA 2XXPA 5CRYA 1GGGA 3W9VA 4XFEA 4DCYA 2HCAA 3H6TA 1MDP1 3MP1A 4FAJA 1QKBA 4O3AA 2QJEA 4GBVA 4GWYA 2F6GA 3TFLA 3K6VA 1CB6A 1MXWA 3K1PA 1YPNA 3FVGA 3FV2A 1S7YA 2H4IA 4NF6B 4NF5B 3L6GA 1LEVA 1NNTA 1OMPA 2HFBA 3B6TA 4PETA 3IFCA 3N5LA 5KDTA 1B3HA 3A09A 3FJGA 5F7VA 1NUXA 3PMXA 4MMPA 1MXVA 4H8JA 3TMGA 1PB7A 1ATGA 3VV5A 3SETA 1NL5A 1MM6A 2I6EA 3D4CA 3O29A 3G3HA 3QUFA 4GLIA 2HPGA 4OVQA 1A8EA 1JQFA 4X1DA 2AL4A 4P47A 3UP9A 2VPOA 4U23A 4I3EA 5AA2A 4TLLB 3FXUA 3VVFA 1FTMA 3QYTA 4ZECA 4HCWA 3U92A 2ZZVA 1RDXA 4I40A 4LATA 1VDWA 4H46A 2RCAA 1KA0A 4F3SA 2B3BA 2Z8EA 4QFPA 4MNIA 1FQFA 4XKPA 3FXQA 3VXCA 2B4MA 3JZJA 3VE1B 5EYGA 3IX1A 2DQVA 4AS4A 5ICQA 2VPNA 2VD3A 4OEUA 5FTIA 3GBAA 3GLBA 4MAGA 3TTMA 4OEVA 2ONRA 1NUYA 4GWXA 1FPKA 4YKJA 3KZGA 4KCDA 1NV6A 1B3LA 4IGTA 1MH3A 2PFZA 3TCHA 2WBBA 4F18A 4I3YA 5H8FA 2RF1A 2XA5A 1BKAA 3IORA 1R6ZA 2XX9A 3MVZA 4GFRA 3RT8A 2DYXA 5DT6A 1I6BA 3MP6A 1LBXA 2DE4A 5CC2A 3O6HA 2QMXA 4MLVA 2L5VA 3EHTA 5I3SA 3FIRA 1OQGA 4I8CA 4TLMB 3S9EA 1N04A 3OELA 3PUWE 3W15C 1DTGA 1LAHE 2QPQA 2XD2A 2OX3A 1YYZA 1FBDA 4XXUA 4PFUA 1PDAA 2GQ1A 4EF2A 4PAIA 4ELPA 1LGBC 5DVIA 4GWOA 2XWKA 2RINA 3TTLA 1NNFA 2DE2A 4AQ4A 1FTLA 3C9HA 1H45A 4PGPA 3IFAA 4MJOA 4PF6A 4ELQA 4H5FA 2Y7RA 1IXGA 5I2NB 1D9YA 3ECRA 1O64A 3HHFA 2P1SA 1EZ9A 1MY3A 4RXLA 3U65A 5EHMA 4GRKA 4ND9A 2AL5A 3FGSA 3T0JA 3R7XA 2REJA 1UTBA 1A40A 4OVTA 4ECFA 2OCUA 1D4NA 4N4UA 5DVFA 1B32A 3RN8A 3PU5A 2THIA 3M3LA 3S9LC 3EHUA 1Y3PA 4P0GA 1MPCA 4N13A 1FPIA 2AYSA 2DXRA 5FBPA 4HE2A 4EQBA 1SBPA 4EXLA 3KC0A 1RYXA 1NFTA 3EKIA 2H99A 2OBGA 1SD3A 3QXMA 2R8TA 1FPDA 2V3UA 4N17A 5H8QB 1MQJA 1YTVA 2QSXA 1SYIA 3FVNA 1AWBA 2F3BA 1QVSA 2G93A 1LBWA 3RPLB 2F36A 3MZ9A 5I56B 1QUJA 4OHNA 4R2BA 3MVYA 1VSOA 4EXKA 3Q27A 4GWZA 4O3BA 2DS9A 4XEQA 3FATA 2GFEA 3T9XB 1FRPA 3OO6A 1MY0A 4YMAA 4QSEA 1INPA 4ZZEA 2P3VA 2CEXA 2XXYA 3R26A 5TU0A 2PMSA 4F1UA 1NV0A 5AA3A 2OK2A 1XOCA 3TKDA 4NF8A 2QVVA 3T93B 1N3WA 3D4GA 4NF0A 1IQ7A 4POWA 4O8MA 2O68A 5AA1A 1US5A 4JDFA 2PFYA 5TPAB 1EU8A 4FEBA 3LBSA 1MRPA 3OEKA 3CI8A 3EQ1A 4IGRA 4PBHA 3NOHA 3O9PA 1K9YA 3IB1A 1P1UA 4U4XA 3VLVA 2DWAA 1EZOA 5L8DA 5I59B 4L17A 4XIGQ 5A5LA 4FORA 4PQJA 1UTHA 2Q8JA 2B4LA 4MFIA 1B46A 3ODBA 1MXXA 3FVKA 4PFIA 3DP8A 1XHYA 3H7MA 2O1LA 3FD3A 3SEXA 4R74A 3RPWA 2PT2A 4FECA 1FBHA 2XHDA 3B6QA 4OMBA 1DMBA 2F7BA 3SZPA 2Y5KA 2ZZWA 4OETA 4OTEA 2OWTA 5A5XB 3MYUA 4I9DA 3KSJA 4X04A 3ZKLA 3PUYE 3E79A 1XC1A 1B3FA 2QFLA 3CIJA 1BP5A 1XT8A 4UACA 3AXFA 4PAKA 1FQBA 4NHBA 1MQDA 4ELRA 4F22A 3OO9A 3HN0A 2Y84A 3MPKA 4R6KA 1XS5A 4EF1A 2ZYKA 4QF9A 1N76A 4ZEDA 4YB6A 3OOAA 3S4UA 2XX8A 2P0SA 3PPQA 4F3GA 1OLAA 1B2HA 2VP1A 4H65A 4GWSA 2O84X 5HBCA 4KCCA 5DEXA 3K6WA 1A54A 1O7TA 3DP6A 4G68B 3MWBA 2B65A 4FE8A 4MBPA 1BLFA 3C35A 1JP4A 2FHYA 1JVYA 1P99A 1Z7ME 3K00A 4IY5A 1Y9UA 3C36A 3K4UA 2XXTA 1SVXB 1FPEA 1MH4A 3BBRA 2XWVA 3TAJA 1PEBA 2HHMA 3UORA 3TYHA 4YU0A 4OA4A 3ZKKA 4QBAA 3G3KA 1JVXA 4BDQA 4OENA 1AOVA 5I2KB 4P8BA 1PBPA 4NF4A 1M5CA 4JBZA 4GD5A 1IMCA 3K0VA 4F19A 4O7MA 3MQ9A 1FPFA 4IR8A 1IMDA 4JB7A 1G0HA 1LAFE 1MXUA 2QS1A 1NI9A 4BLAA 3O2AA 4F2OA 5ET6A 4U2RA 3MC2A 1LFIA 3VVDA 2DDKA 2VGQA 3KSXA 5H8NB 1B51A 3TELA 3ONMA 4JXIA 2KLFA 3K6XA 1ANFA 4DE8A 4DCXA 3Q29A 4JWYA 3O66A 2ANJA 3TQLA 4U4SA 5CBRA 1D3KA 1ELJA 4ZEFA 1H3DA 5CM6A 1Z7NE 5EQAA 5ICTA 2DOJA 2HAVA 1VE4A 4GL8A 4U1OA 3PD8A 4EQ7A 3VVEA 4IO6A 3LR1A 2E1SA 1L5TA 3FVOA 1FBFA 1B05A 3T1BA 5B70A 4Q30B 2I4CA 3BIHA 3H4ZA 4H1XA 2Q8MA 4M1VA 3USDA 5KCJA 2F35A 3H03A 1TXFA 1FBCA 3OSQA 3KN7A 1GVCA 1MS7A 3G7WA 2UXAA 4RY1A 2PBWA 3O6IA 4NE4A 5IAIA 3D1RA 5JTYB 1IMAA 3BFUA 4U22A 1MG1A 2XXXA 1SPIA 4PFWA 3A3UA 2ZNTA 3LV0A 3CFXA 3CHGA 3TZAA 3MPLA 4OFLA 4XKQA 1FTAA 2HQ0A 5K2YA 4R9FA 1MPDA 1ZTYA 1ZMGA 3N6TA 3UA8A 3VDFA 4XKNA 1NH8A 2OLBA 3IO6A 5CMCA 1FBGA 2X7PA 4R6HA 3IAZA 1KZ8A 5ET5A 1MY4A 3F11A 1NV1A 4E0XA 1Y4TA 4IY6A 4PE5B 1QUKA 2CZHA 4GVOA 3LC8A 2V93A 4PP0A 1IMEA 4BDOA 1N3XA 4P3LA 4GF8A 2P3NA 2F5XA 4QFNA 5A5XA 2KQZA 5L9OA 4MCOA 3VFJA 4F1YA 3JV9A 3JYRA 4ZS9A 4DXCA 1XVXA 2FYIA 4Q8RA 4XF5A 3UN6A 2GHBA 3IJOB 2XXIA 1POTA 4R6YA 1N7WA 4QSDA 2I49A 2BJJX 5K2XA 1FPGA 2Q74A 1LAXA 1NV7A 2ABHA 4Z7EA 4HW8A 4PCDA 3E3KA 4O7IA 3IB2A 1ZBMA 1IXIA 4X8RA 1FTJA 2OWZA 3PPPA 1FPJA 4N81A 5TP9B 3U72A 1Y3QA 3K1MA 2B3FA 4G68A 1USYH 3RTFB 4U21A 4G77A 3BIGA 2F78A 3MP8A 2Q2CA 5J16A 2QS3A 1AMFA 4GX4A 4OANA 3Q26A 2FIEA 4GL0A 3MBPA 4OVSA 5IKBA 1Y20A 1R9LA 3UK4A 2DWHA 4P11A 2D5WA 2F3DA 3RY3A 2XXHA 1NV2A 1B7ZA 2MKZA 2PVUA 3RQTA 3FXRA 4DI3D 1LBCA 1UIUA 3IJXB 1CE2A 4N6KA 5JEIA 1FJ9A 2RC8A 4C1TA 3C32A 4ISUA 1AIVA 4Q0CA 3FV1A 1IITA 3C33A 1JW4A 4HE1A 5CI5A 2XWIA 2ESNA 2QMWA 2W7YA 3HCQA 3HFUA 1NV3A 4H45A 1OLCA 2UVHA 4E0WA 4YB7A 2XD3A 1PBQA 3O6GA 1II5A 4RJZA 2DVZA 4FIMA 3PMWA 2VD2A 4THIA 1B1HA 1R9QA 1FBPA 2Y7KA 3HO7A 1USYE 1H76A 4IO5A 2XXVA 3LSXA 3KFMA 4JSDA 5IZ3B 2VOZA 1DOTA 1A8FA 4ESXA 1Y4CA 3LUYA 3PTYA 1NV4A 3VLWA 5EQ8A 3PMVA 1HSEA 3THIA 4ZDMA 1FQEA 1ZU0A 2HXRA 2D3IA 2O7IA 4MX6A 1S9TA 5ELVA 3MZ1A 5BUUA 3P7IA 3N26A 3C34A 3SKPA 3IOUA 3CSBA 4AS5A 1B40A 2NXOA 3A29A 4NF6A 4NF5A 1M5EA 4MH5A 1URSA 1FTKA 3LSWA 4G8NA 5CMBA 4XTCQ 3WAEA 4G8HA 2DWJA 4RA1A 4GQOA 2A5TB 4NMYA 1PB8A 1LCFA 1QW0A 5FHOA 1NMUA 4POXA 3B8BA 2Y5LA 2OPDA 4R9GA 2DSFA 4P1LA 1MDQA 3H6WA 4I62A 1UIVA 1SQYA 3MVXA 2F8DA 1Q35A 1B7HA 4N8GA 4GX3A 1B52A 1HSJA 3PUZE 1JNFA 2UYFA 3TEPA 4QXDA 3DP4A 4NWCA 1IXCA 1LFHA 1B3GA 4IO4A 3RYDA 2WKYA 4C0RA 1QUIA 1LSTA 2V3TA 3V89B 4LQ5A 4EDPA 3B7DA 2QRYA 3GZGA 3O97A 1GTKA 1EH3A 5DYHA 3I5OA 5CBSA 3TODA 3S9NC 4N15A 4ESWA 1F9BA 2XXRA 2O51A 3A3CA 2QVUA 1BK4A 2XXKA 2PT1A 3G3IA 2ALUA 5I84A 1FQDA 2FNCA 4UABA 2YJPA 3M3KA 3GXAA 4PBQA 4QHQA 4FBPA 4WEPA 1OQHA 2I0CA 2X7QA 2RC7A 5AA2B 4LZ5A 2Z23A 3GYYA 3FASA 2I3VA 3CVGA 3GBBA 4OFOA 2PCRA 3IOTA 4PDHA 5L9SA 2PYYA 3KJ7A 4F3BA 4NWDA 3OO8A 3PPNA 1LLSA 4YZZA 4XKRA 2QS4A 4BDRA 4LN5A 3T22A 4GXSB 1P1OA 3IR1A 1XVYA 3Q28A 1EYKA 1MQGA 1R1NA 3LSFB 3FJMA 4LZ7A 4R2FA 3RTWB 4PAFA 2Q89A 2LAOA 2FBPA 4R73A 2ZYOA 4OVPA 2XXWA 4KPTA 3MZBA 2R9JA 4QRZA 5HPQA 4OFJA 4MF3A 5IZZA 4N07A 3QMFA 3V8XB 3UGWA 2XXUA 4UA8A 3SEVA 2XXQA 5H8FB 4KHZE 4NN3A 1FPBA 3SESA 1EYIA 1YAEA 3E13X 5IGAA 1I6AA 4R72A 2HZKA 5I2NA 5ITPA 1IIWA 3SEYA 3FXBA 3DM0A 4AB6A 3OMBA 3C4MA 3KN3A 4RNSA 4FEDA 3EHSA 4NTLA 4GXAA 3CG1A 4PGNA 1QKAA 2NOOA 4BDMA 1YZ0A 4GWWA 1IXHA 1RDYA 4OZ9A 1SW2A 1P1NA 3TCGA 1FSAA 1N7XA 4MIJA 2HXWA 5JK4A 5L9MA 3K1NA 4JVDA 4G68C 1Q9DA 3SDFA 3FJ7A 4IO7A 2QL3A 1PB9A 4ZEIA 3QAXA 1LCTA 3I6VA 1MXZA 3OD7A 5H8QA 2NWJA 1QGXA 4HE0A 5FHMA 5I7IA 5KZTA 3EN3A 3RGYA 3K6UA 4H8IA 3Q25A 3S2VA 4NAPA 4WKMA 3KG2A 4YKKA 4KD5A 1KA1A 2A5SA 2DVCA 1A7LA 5M2VA 3EPEA 3RPLA 1RDZA 5AE4A 2DP8A 2I0BA 2F6PA 1UTBB 5I56A 2XWOA 4NX1A 2VHAA 2I58A 2OZZA 3OO7A 4GOTA 5CMKA 1DCUA 4MHFA 1M5DA 1TT1A 1ZKBA 5I58B 2H98A 3TDJA 4QFOA 3OXNA 2AIXA 3N6UA 2RCBA 2VT5A 3E78A 1VR5A 2CMOA 2E0SA 3CRBA 4G4PA 5EHSA 1UQWA 2DXYA 1Y3NA 3IB0A 1RYOA 1M5FA 4H5GA 3KEIA 5F24A 3QK6A 1FQAA 2O7UA 1TWYA 1BIYA
chains in the Genus database with same CATH topology
3MSTA 5J16A 1LBZA 1IMBA 4GX4A 5EQ9A 1FRPA 4OANA 2FIEA 4O94A 4GWUA 5EYHA 4OVSA 4YICA 2F3DA 1INPA 2V4CA 1NV2A 2MKZA 2P3VA 2Q9TA 5ET7A 2CEXA 4F1UA 4DI3D 1NV0A 2QVVA 4N6KA 4P56A 1FJ9A 4NF0A 4O8MA 2JJKA 2PFYA 4HE1A 2XWIA 1D9QA 4JVCA 5EQ7A 3HFUA 5IZ3A 1NV3A 4H45A 4PBHA 3NOHA 1K9YA 2WYPA 4N8YA 3KC1A 2DVZA 5J1DA 1LBVA 5A5LA 1FBPA 2B4LA 4JVIA 1FPLA 5I5PA 4PFIA 1DBZA 2V3QA 2DE3A 1DK4A 5IZ3B 3PTYA 1NV4A 1FBHA 4OVRA 5EQ8A 2WX9A 4PF8A 2Y5KA 2ZZWA 3SZPA 2HZLA 1FBEA 3MYUA 2BJIA 2HXRA 4MX6A 4X04A 3E79A 4DI4B 2QFLA 2WYKA 4PAKA 4P9KA 4NHBA 4AS5A 3A29A 2WBDA 5LDZA 2CEYA 3W9VA 4XFEA 4PTKA 2FIXA 5DW8A 3B50A 1K9ZA 4GBVA 4NGUA 4GWYA 3B8BA 2Y5LA 4F1VA 4P1LA 4GWSA 1LEVA 4MNPA 4N8GA 4GX3A 4PE3A 4PETA 3IFCA 1NUXA 4QXDA 2FVZA 4MMPA 1JP4A 2FHYA 2QVRA 5LTCA 3RYDA 1FPEA 2HPGA 2XWVA 4OVQA 4PC9A 2HHMA 4P47A 2VPOA 4OA4A 4I3EA 4QBAA 4N15A 4HCWA 2ZZVA 2QVUA 4P8BA 1BK4A 1RDXA 2XXKA 4I40A 4HXVA 1VDWA 4H46A 1IMCA 4F19A 4O7MA 4UABA 1FPFA 4IR8A 1IMDA 4PBQA 3LUZA 1G0HA 1KA0A 4FBPA 1NI9A 4MNIA 5ET6A 2B4MA 1FJ6A 4MEVA 2DDKA 3GYYA 5EYGA 2ZZXA 4AS4A 2VPNA 2PCRA 4PDHA 1EYJA 4MAGA 5T3JA 1NUYA 4GWXA 1FPKA 4YZZA 4PFRA 5ESYA 1NV6A 4MNCA 4LN5A 5CM6A 2PFZA 5EQAA 2WBBA 1EYKA 4F18A 4I3YA 2XA5A 4PAFA 1FBFA 3T1BA 1G0IA 2FBPA 1NUZA 4OVPA 3FBPA 3BIHA 2Q8MA 4M1VA 4X9TA 1LBXA 1FBCA 5IZZA 2DE4A 3QMFA 2L5VA 5I3SA 4NN3A 1FPBA 3D1RA 1IMAA 1EYIA 4PDDA 5IGAA 3ISPA 2QPQA 1NV5A 2OX3A 1YYZA 2HZKA 1FBDA 2CZIA 4GBWA 2GQ1A 1SPIA 4NG7A 4PAIA 3FXBA 2XWKA 1IMFA 3LV0A 3CHGA 1FTAA 5ET8A 2DE2A 4PGPA 3IFAA 4N91A 4MJOA 4PF6A 2CZKA 4PGNA 1YXIA 1YZ0A 4GWWA 1FBGA 1RDYA 4GX6A 1FSAA 4MIJA 1KZ8A 5ET5A 3U65A 5JK4A 1NV1A 2CZHA 4JVDA 3T0JA 1Q9DA 1NUWA 4OVTA 1IMEA 4N4UA 4P3LA 4KXPA 2P3NA 1QGXA 1XI6A 4HE0A 2F5XA 2KQZA 4MCOA 3ROJA 5I7IA 4NAPA 1FPIA 5FBPA 4HE2A 1LBYA 1KA1A 3KC0A 4XF5A 4P1EA 3EKIA 3RPLA 1RDZA 4N6DA 2R8TA 1FPDA 2XWOA 4NX1A 4NQ8A 3W9WA 4N17A 1CNQA 1FPGA 2Q74A 1DCUA 4MHFA 1NV7A 5IM2A 4PCDA 4O7IA 4X8RA 2KR0A 1AWBA 2F3BA 2OWZA 1LBWA 2VT5A 1FPJA 3RPLB 3E78A 4N81A 2WEFA 5IZ1A 3KBZA 4HCYA 4PFBA 5F24A 4GWZA 4XEQA 3BIGA 4G61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J16 A;  1LBZ A;  2QFL A;  3IFA A;  1IMB A;  4GX4 A;  5EQ9 A;  1FJ6 A;  5ET6 A;  1FRP A;  4MJO A;  2FIE A;  2DDK A;  2CZK A;  5EYG A;  4GWU A;  4AS5 A;  1YXI A;  5EYH A;  1YZ0 A;  4GWW A;  1FBG A;  3A29 A;  4AS4 A;  2WBD A;  5LDZ A;  1RDY A;  2F3D A;  2PCR A;  1INP A;  4GX6 A;  1NV2 A;  1FSA A;  2P3V A;  1EYJ A;  1KZ8 A;  5ET7 A;  5ET5 A;  4PTK A;  2FIX A;  1NV1 A;  5T3J A;  1NUY A;  5DW8 A;  4GWX A;  1FPK A;  1NV0 A;  2CZH A;  2QVV A;  3T0J A;  1Q9D A;  1NUW A;  5ESY A;  1NV6 A;  1FJ9 A;  1K9Z A;  4GBV A;  4GWY A;  1IME A;  3B8B A;  2Y5L A;  4KXP A;  2JJK A;  5EQA A;  2P3N A;  1QGX A;  1XI6 A;  4HE0 A;  2WBB A;  1EYK A;  3ROJ A;  4HE1 A;  4I3Y A;  4GWS A;  1D9Q A;  5EQ7 A;  1LEV A;  4GX3 A;  5IZ3 A;  1NV3 A;  4H45 A;  1FPI A;  1FBF A;  1K9Y A;  3LUZ A;  5FBP A;  4HE2 A;  1G0I A;  1LBY A;  1KA1 A;  2FBP A;  3IFC A;  3KC0 A;  1NUZ A;  3RPL A;  1RDZ A;  3KC1 A;  3FBP A;  2R8T A;  3BIH A;  1NUX A;  4QXD A;  2FVZ A;  2Q8M A;  1FPD A;  1LBV A;  5A5L A;  1JP4 A;  2FHY A;  2QVR A;  1FBP A;  1LBX A;  1FBC A;  1FPL A;  3RYD A;  3QMF A;  1CNQ A;  1FPG A;  2Q74 A;  1DCU A;  1FPE A;  1NV7 A;  1DBZ A;  5I3S A;  2HHM A;  1DK4 A;  1FPB A;  4O7I A;  3D1R A;  1IMA A;  4I3E A;  5IZ3 B;  1EYI A;  1AWB A;  2F3B A;  2OWZ A;  1LBW A;  2VT5 A;  1NV5 A;  1FPJ A;  2OX3 A;  3BIG A;  1YYZ A;  3RPL B;  1FBD A;  1NV4 A;  2CZI A;  4GBW A;  2GQ1 A;  2WEF A;  4N81 A;  5IZ1 A;  1FBH A;  2QVU A;  3KBZ A;  5EQ8 A;  1SPI A;  1BK4 A;  1RDX A;  4I40 A;  4HXV A;  1VDW A;  1IMF A;  4H46 A;  2Y5K A;  1IMC A;  1FBE A;  3LV0 A;  2BJI A;  5F24 A;  1FPF A;  4IR8 A;  4GWZ A;  1IMD A;  1FTA A;  5ET8 A;  1G0H A;  1KA0 A;  4FBP A;  1NI9 A;  4G61 A; 
#chains in the Genus database with same CATH topology
 3MST A;  4JWO A;  1IMB A;  5EQ9 A;  2ZYM A;  4KFQ A;  5TPA A;  4O94 A;  4WXJ A;  3IL1 B;  4YIC A;  2IA4 A;  4ZE8 A;  3QUJ A;  1OVT A;  1RKM A;  4IO2 A;  1TFA A;  5I59 A;  2Z22 A;  2XX7 A;  4P56 A;  1B1X A;  3PV0 E;  1B0H A;  2JJK A;  1QJM A;  2I3W A;  4OER A;  3I3V A;  1SW1 A;  4LA9 A;  1URD A;  4X48 A;  5HM4 B;  4JWX A;  3IO4 A;  2WYP A;  3PUV E;  4N8Y A;  4NF8 B;  5J1D A;  2Z8F A;  1B5I A;  4YKP A;  3S9M C;  3UIF A;  1P1Q A;  3K2D A;  4JVI A;  3H6U A;  1B9J A;  2ZMB A;  4H67 A;  4ZE9 A;  2NUV A;  1B5H A;  3N94 A;  1DBZ A;  1SI0 A;  2H25 A;  3PGF A;  1DK4 A;  3T9U A;  3PPO A;  4LQ2 A;  2H5Y A;  4OXV A;  2IEE A;  5I57 B;  4MLQ A;  4LUB A;  4OVR A;  1B7U A;  3PUX E;  1IEJ A;  1UTH B;  4OQO A;  2V84 A;  2CZL A;  4NED A;  1DPE A;  2HZL A;  3O28 A;  4F3P A;  2BJI A;  3K02 A;  3TPA A;  2R6G E;  4LON B;  4YAH X;  4C1U A;  3G3G A;  4DI4 B;  1B6H A;  2OWS A;  4EQ9 A;  4BDN A;  3RUM A;  2WBD A;  3IOV A;  4YKI A;  1POY 1;  2CEY A;  4F31 B;  1SW5 A;  4PTK A;  2FIX A;  5DW8 A;  1WOD A;  3EF7 A;  3ZSF A;  1B4Z A;  2F97 A;  3M8U A;  1Y1M A;  1A99 A;  3HV1 A;  5DVJ A;  3B50 A;  1K9Z A;  4NGU A;  4KYS A;  4F1V A;  1B4H A;  1SDX A;  5ITO A;  4H6D A;  3V83 A;  4ELO A;  1WDN A;  4F29 A;  4MNP A;  1Q1K A;  4PE3 A;  2O6A A;  3T9V A;  4YMB A;  4KQP A;  2F7A A;  2YLN A;  2ONS A;  5F1Q A;  5I2K A;  2FVZ A;  3CFL A;  4RK2 A;  4FJP A;  2QVR A;  1NNK A;  5LTC A;  3KJT A;  2R71 A;  3CR9 A;  3RT6 B;  4P0I A;  2ZNU A;  4M4G A;  4PC9 A;  3DLN A;  4KYE A;  3LSL A;  3OEM A;  3KN8 A;  5DEX B;  3PD9 A;  2ZYN A;  3G3J A;  5H8N A;  1A55 A;  1H43 A;  3IK6 B;  1MM7 A;  3SEU A;  4HXV A;  2GHA A;  3CFZ A;  5H8H B;  4DDD A;  2P2A A;  4WED A;  4Q5T A;  3LUZ A;  3QSL A;  3VLU A;  1OIB A;  2M8C A;  5AA4 B;  3MAM A;  3T96 B;  1FQC A;  1FJ6 A;  3R6U A;  4MEV A;  3SEW A;  2H9B A;  2ZZX A;  4QSC A;  3MVW A;  5I58 A;  4DXU A;  4NF4 B;  1I69 A;  4O3C A;  4DXB A;  4HTG A;  1EYJ A;  2ZXT A;  5T3J A;  1ZJL A;  2O69 A;  1VFD A;  4TOZ A;  3TTK A;  4PFR A;  5ESY A;  1DTZ A;  4MNC A;  4BDL A;  1Y1Z A;  5FTH A;  4F2Q A;  1MXY A;  4IB2 A;  1TFD A;  2Y7W A;  1I6Q A;  4YB5 A;  4G2Z A;  1NKX A;  1ZIU A;  3TTR A;  5JTY A;  1LB8 A;  2GH9 A;  1M5B A;  3E9X A;  1G0I A;  1US4 A;  1NUZ A;  1JW1 A;  3FBP A;  3TQW A;  3FZV A;  1IUD A;  3G3F A;  1LAG E;  4JSO A;  2ONK E;  4X9T A;  1LBB A;  1B0L A;  4EUO A;  1LB9 A;  2Q2A A;  3FUZ A;  3QIM A;  4TQU Q;  1AH5 A;  4RPN A;  1ZLQ A;  4IO3 A;  3SER A;  4PDD A;  3U94 A;  3ISP A;  1NV5 A;  2CZI A;  4GBW A;  3H06 B;  3KOT A;  4NG7 A;  5KCJ B;  1N0T A;  3KGC A;  3KOS A;  1IMF A;  3V5A A;  1PC3 A;  3M3F A;  4OYV A;  4RYA A;  1OVB A;  5ET8 A;  4LVQ A;  4GIZ A;  4DIG A;  4N91 A;  5KDT B;  2CZK A;  4PFY A;  1YXI A;  4FAT A;  1GR2 A;  3ILU B;  2ZNS A;  4GX6 A;  3T9H B;  4QFK A;  3TUS A;  5I57 A;  2I48 A;  1NUW A;  2DWI A;  3CG3 A;  4RK9 A;  1BTJ A;  4KXP A;  1H44 A;  1XI6 A;  1B3E A;  3ROJ A;  4ZZA A;  4ONY A;  4KI0 E;  1JEU A;  4OVJ A;  3TCF A;  3DEL B;  1LFG A;  3B6W A;  1LBY A;  4F39 A;  4P1E A;  1N84 A;  4KR5 A;  3U1O A;  5B7D A;  1URG A;  4N6D A;  1HSL A;  2UYE A;  4Z0I A;  3HPI A;  2Y7I A;  3T66 A;  4NQ8 A;  1AL3 A;  3W9W A;  5TP9 A;  5BWJ A;  1P1W A;  2NVU B;  1CNQ A;  4ZEB A;  4U1Z A;  5IM2 A;  3U8Q A;  4AB5 A;  4LP2 B;  3MUQ A;  4KYD A;  2KR0 A;  2HAU A;  3H3G A;  1YCJ A;  1VFE A;  4X1B A;  1SI1 A;  2WEF A;  5IZ1 A;  3KBZ A;  2X26 A;  5DTB A;  3OSR A;  4HCY A;  2FA7 A;  4G8M A;  4PFB A;  2V25 A;  3IOW A;  5AA2 D;  5ISU A;  1JET A;  4N6P A;  4G61 A;  3ILT B;  1LBZ A;  3HHG A;  2F7C A;  4HS7 A;  5EYF A;  4RPO A;  5CMM A;  1NH7 A;  1MY1 A;  4GWU A;  3C31 A;  5EYH A;  4ZEK A;  2O1M A;  1T0K A;  2V4C A;  2UVG A;  1MQI A;  1NNP A;  2Q9T A;  5ET7 A;  1FCK A;  1FW0 A;  4LZ8 A;  1S50 A;  4QFL A;  3TTN A;  2YPN A;  1JW5 A;  3BKI B;  5LOM A;  1QUL A;  2F34 A;  5H8H A;  4DLD A;  2I4B A;  2UVJ A;  1D9Q A;  3MW0 A;  4JVC A;  5EQ7 A;  1GV8 A;  2QS2 A;  4I1D A;  2REG A;  5IZ3 A;  2G29 A;  5AA4 A;  3K01 A;  1WVJ A;  3BFT A;  5H8S A;  3OEN A;  3KC1 A;  3RLF E;  3PPR A;  3L6H A;  1FTO A;  1LBV A;  3ZS6 A;  1FPL A;  3RNN A;  5I5P A;  1B58 A;  3VXB A;  1DSN A;  2V3Q A;  2DE3 A;  2HEU A;  4OWD A;  3H6V A;  2RKM A;  3KBR A;  1J1N A;  2D21 A;  1IZ1 A;  2Z8D A;  2OJT A;  2WX9 A;  2Y7P A;  1KWH A;  1B5J A;  1JEV A;  2UVI A;  1O63 A;  1D9V A;  4PF8 A;  4H0W A;  5FHN A;  3WAF A;  1FBE A;  4OES A;  4PFT A;  4R75 A;  1DPP A;  2Q88 A;  2A5T A;  1MY2 A;  1MQH A;  3U93 A;  1SYH A;  3E4R A;  4K3F A;  3MJN A;  2WYK A;  2GRV A;  4P9K A;  2PX1 A;  3CSG A;  2RC9 A;  3HST A;  1MPB A;  1EZP A;  2OPE A;  4DZ1 A;  1SW4 A;  5LDZ A;  2XXP A;  5CRY A;  1GGG A;  3W9V A;  4XFE A;  4DCY A;  2HCA A;  3H6T A;  1MDP 1;  3MP1 A;  4FAJ A;  1QKB A;  4O3A A;  2QJE A;  4GBV A;  4GWY A;  2F6G A;  3TFL A;  3K6V A;  1CB6 A;  1MXW A;  3K1P A;  1YPN A;  3FVG A;  3FV2 A;  1S7Y A;  2H4I A;  4NF6 B;  4NF5 B;  3L6G A;  1LEV A;  1NNT A;  1OMP A;  2HFB A;  3B6T A;  4PET A;  3IFC A;  3N5L A;  5KDT A;  1B3H A;  3A09 A;  3FJG A;  5F7V A;  1NUX A;  3PMX A;  4MMP A;  1MXV A;  4H8J A;  3TMG A;  1PB7 A;  1ATG A;  3VV5 A;  3SET A;  1NL5 A;  1MM6 A;  2I6E A;  3D4C A;  3O29 A;  3G3H A;  3QUF A;  4GLI A;  2HPG A;  4OVQ A;  1A8E A;  1JQF A;  4X1D A;  2AL4 A;  4P47 A;  3UP9 A;  2VPO A;  4U23 A;  4I3E A;  5AA2 A;  4TLL B;  3FXU A;  3VVF A;  1FTM A;  3QYT A;  4ZEC A;  4HCW A;  3U92 A;  2ZZV A;  1RDX A;  4I40 A;  4LAT A;  1VDW A;  4H46 A;  2RCA A;  1KA0 A;  4F3S A;  2B3B A;  2Z8E A;  4QFP A;  4MNI A;  1FQF A;  4XKP A;  3FXQ A;  3VXC A;  2B4M A;  3JZJ A;  3VE1 B;  5EYG A;  3IX1 A;  2DQV A;  4AS4 A;  5ICQ A;  2VPN A;  2VD3 A;  4OEU A;  5FTI A;  3GBA A;  3GLB A;  4MAG A;  3TTM A;  4OEV A;  2ONR A;  1NUY A;  4GWX A;  1FPK A;  4YKJ A;  3KZG A;  4KCD A;  1NV6 A;  1B3L A;  4IGT A;  1MH3 A;  2PFZ A;  3TCH A;  2WBB A;  4F18 A;  4I3Y A;  5H8F A;  2RF1 A;  2XA5 A;  1BKA A;  3IOR A;  1R6Z A;  2XX9 A;  3MVZ A;  4GFR A;  3RT8 A;  2DYX A;  5DT6 A;  1I6B A;  3MP6 A;  1LBX A;  2DE4 A;  5CC2 A;  3O6H A;  2QMX A;  4MLV A;  2L5V A;  3EHT A;  5I3S A;  3FIR A;  1OQG A;  4I8C A;  4TLM B;  3S9E A;  1N04 A;  3OEL A;  3PUW E;  3W15 C;  1DTG A;  1LAH E;  2QPQ A;  2XD2 A;  2OX3 A;  1YYZ A;  1FBD A;  4XXU A;  4PFU A;  1PDA A;  2GQ1 A;  4EF2 A;  4PAI A;  4ELP A;  1LGB C;  5DVI A;  4GWO A;  2XWK A;  2RIN A;  3TTL A;  1NNF A;  2DE2 A;  4AQ4 A;  1FTL A;  3C9H A;  1H45 A;  4PGP A;  3IFA A;  4MJO A;  4PF6 A;  4ELQ A;  4H5F A;  2Y7R A;  1IXG A;  5I2N B;  1D9Y A;  3ECR A;  1O64 A;  3HHF A;  2P1S A;  1EZ9 A;  1MY3 A;  4RXL A;  3U65 A;  5EHM A;  4GRK A;  4ND9 A;  2AL5 A;  3FGS A;  3T0J A;  3R7X A;  2REJ A;  1UTB A;  1A40 A;  4OVT A;  4ECF A;  2OCU A;  1D4N A;  4N4U A;  5DVF A;  1B32 A;  3RN8 A;  3PU5 A;  2THI A;  3M3L A;  3S9L C;  3EHU A;  1Y3P A;  4P0G A;  1MPC A;  4N13 A;  1FPI A;  2AYS A;  2DXR A;  5FBP A;  4HE2 A;  4EQB A;  1SBP A;  4EXL A;  3KC0 A;  1RYX A;  1NFT A;  3EKI A;  2H99 A;  2OBG A;  1SD3 A;  3QXM A;  2R8T A;  1FPD A;  2V3U A;  4N17 A;  5H8Q B;  1MQJ A;  1YTV A;  2QSX A;  1SYI A;  3FVN A;  1AWB A;  2F3B A;  1QVS A;  2G93 A;  1LBW A;  3RPL B;  2F36 A;  3MZ9 A;  5I56 B;  1QUJ A;  4OHN A;  4R2B A;  3MVY A;  1VSO A;  4EXK A;  3Q27 A;  4GWZ A;  4O3B A;  2DS9 A;  4XEQ A;  3FAT A;  2GFE A;  3T9X B;  1FRP A;  3OO6 A;  1MY0 A;  4YMA A;  4QSE A;  1INP A;  4ZZE A;  2P3V A;  2CEX A;  2XXY A;  3R26 A;  5TU0 A;  2PMS A;  4F1U A;  1NV0 A;  5AA3 A;  2OK2 A;  1XOC A;  3TKD A;  4NF8 A;  2QVV A;  3T93 B;  1N3W A;  3D4G A;  4NF0 A;  1IQ7 A;  4POW A;  4O8M A;  2O68 A;  5AA1 A;  1US5 A;  4JDF A;  2PFY A;  5TPA B;  1EU8 A;  4FEB A;  3LBS A;  1MRP A;  3OEK A;  3CI8 A;  3EQ1 A;  4IGR A;  4PBH A;  3NOH A;  3O9P A;  1K9Y A;  3IB1 A;  1P1U A;  4U4X A;  3VLV A;  2DWA A;  1EZO A;  5L8D A;  5I59 B;  4L17 A;  4XIG Q;  5A5L A;  4FOR A;  4PQJ A;  1UTH A;  2Q8J A;  2B4L A;  4MFI A;  1B46 A;  3ODB A;  1MXX A;  3FVK A;  4PFI A;  3DP8 A;  1XHY A;  3H7M A;  2O1L A;  3FD3 A;  3SEX A;  4R74 A;  3RPW A;  2PT2 A;  4FEC A;  1FBH A;  2XHD A;  3B6Q A;  4OMB A;  1DMB A;  2F7B A;  3SZP A;  2Y5K A;  2ZZW A;  4OET A;  4OTE A;  2OWT A;  5A5X B;  3MYU A;  4I9D A;  3KSJ A;  4X04 A;  3ZKL A;  3PUY E;  3E79 A;  1XC1 A;  1B3F A;  2QFL A;  3CIJ A;  1BP5 A;  1XT8 A;  4UAC A;  3AXF A;  4PAK A;  1FQB A;  4NHB A;  1MQD A;  4ELR A;  4F22 A;  3OO9 A;  3HN0 A;  2Y84 A;  3MPK A;  4R6K A;  1XS5 A;  4EF1 A;  2ZYK A;  4QF9 A;  1N76 A;  4ZED A;  4YB6 A;  3OOA A;  3S4U A;  2XX8 A;  2P0S A;  3PPQ A;  4F3G A;  1OLA A;  1B2H A;  2VP1 A;  4H65 A;  4GWS A;  2O84 X;  5HBC A;  4KCC A;  5DEX A;  3K6W A;  1A54 A;  1O7T A;  3DP6 A;  4G68 B;  3MWB A;  2B65 A;  4FE8 A;  4MBP A;  1BLF A;  3C35 A;  1JP4 A;  2FHY A;  1JVY A;  1P99 A;  1Z7M E;  3K00 A;  4IY5 A;  1Y9U A;  3C36 A;  3K4U A;  2XXT A;  1SVX B;  1FPE A;  1MH4 A;  3BBR A;  2XWV A;  3TAJ A;  1PEB A;  2HHM A;  3UOR A;  3TYH A;  4YU0 A;  4OA4 A;  3ZKK A;  4QBA A;  3G3K A;  1JVX A;  4BDQ A;  4OEN A;  1AOV A;  5I2K B;  4P8B A;  1PBP A;  4NF4 A;  1M5C A;  4JBZ A;  4GD5 A;  1IMC A;  3K0V A;  4F19 A;  4O7M A;  3MQ9 A;  1FPF A;  4IR8 A;  1IMD A;  4JB7 A;  1G0H A;  1LAF E;  1MXU A;  2QS1 A;  1NI9 A;  4BLA A;  3O2A A;  4F2O A;  5ET6 A;  4U2R A;  3MC2 A;  1LFI A;  3VVD A;  2DDK A;  2VGQ A;  3KSX A;  5H8N B;  1B51 A;  3TEL A;  3ONM A;  4JXI A;  2KLF A;  3K6X A;  1ANF A;  4DE8 A;  4DCX A;  3Q29 A;  4JWY A;  3O66 A;  2ANJ A;  3TQL A;  4U4S A;  5CBR A;  1D3K A;  1ELJ A;  4ZEF A;  1H3D A;  5CM6 A;  1Z7N E;  5EQA A;  5ICT A;  2DOJ A;  2HAV A;  1VE4 A;  4GL8 A;  4U1O A;  3PD8 A;  4EQ7 A;  3VVE A;  4IO6 A;  3LR1 A;  2E1S A;  1L5T A;  3FVO A;  1FBF A;  1B05 A;  3T1B A;  5B70 A;  4Q30 B;  2I4C A;  3BIH A;  3H4Z A;  4H1X A;  2Q8M A;  4M1V A;  3USD A;  5KCJ A;  2F35 A;  3H03 A;  1TXF A;  1FBC A;  3OSQ A;  3KN7 A;  1GVC A;  1MS7 A;  3G7W A;  2UXA A;  4RY1 A;  2PBW A;  3O6I A;  4NE4 A;  5IAI A;  3D1R A;  5JTY B;  1IMA A;  3BFU A;  4U22 A;  1MG1 A;  2XXX A;  1SPI A;  4PFW A;  3A3U A;  2ZNT A;  3LV0 A;  3CFX A;  3CHG A;  3TZA A;  3MPL A;  4OFL A;  4XKQ A;  1FTA A;  2HQ0 A;  5K2Y A;  4R9F A;  1MPD A;  1ZTY A;  1ZMG A;  3N6T A;  3UA8 A;  3VDF A;  4XKN A;  1NH8 A;  2OLB A;  3IO6 A;  5CMC A;  1FBG A;  2X7P A;  4R6H A;  3IAZ A;  1KZ8 A;  5ET5 A;  1MY4 A;  3F11 A;  1NV1 A;  4E0X A;  1Y4T A;  4IY6 A;  4PE5 B;  1QUK A;  2CZH A;  4GVO A;  3LC8 A;  2V93 A;  4PP0 A;  1IME A;  4BDO A;  1N3X A;  4P3L A;  4GF8 A;  2P3N A;  2F5X A;  4QFN A;  5A5X A;  2KQZ A;  5L9O A;  4MCO A;  3VFJ A;  4F1Y A;  3JV9 A;  3JYR A;  4ZS9 A;  4DXC A;  1XVX A;  2FYI A;  4Q8R A;  4XF5 A;  3UN6 A;  2GHB A;  3IJO B;  2XXI A;  1POT A;  4R6Y A;  1N7W A;  4QSD A;  2I49 A;  2BJJ X;  5K2X A;  1FPG A;  2Q74 A;  1LAX A;  1NV7 A;  2ABH A;  4Z7E A;  4HW8 A;  4PCD A;  3E3K A;  4O7I A;  3IB2 A;  1ZBM A;  1IXI A;  4X8R A;  1FTJ A;  2OWZ A;  3PPP A;  1FPJ A;  4N81 A;  5TP9 B;  3U72 A;  1Y3Q A;  3K1M A;  2B3F A;  4G68 A;  1USY H;  3RTF B;  4U21 A;  4G77 A;  3BIG A;  2F78 A;  3MP8 A;  2Q2C A;  5J16 A;  2QS3 A;  1AMF A;  4GX4 A;  4OAN A;  3Q26 A;  2FIE A;  4GL0 A;  3MBP A;  4OVS A;  5IKB A;  1Y20 A;  1R9L A;  3UK4 A;  2DWH A;  4P11 A;  2D5W A;  2F3D A;  3RY3 A;  2XXH A;  1NV2 A;  1B7Z A;  2MKZ A;  2PVU A;  3RQT A;  3FXR A;  4DI3 D;  1LBC A;  1UIU A;  3IJX B;  1CE2 A;  4N6K A;  5JEI A;  1FJ9 A;  2RC8 A;  4C1T A;  3C32 A;  4ISU A;  1AIV A;  4Q0C A;  3FV1 A;  1IIT A;  3C33 A;  1JW4 A;  4HE1 A;  5CI5 A;  2XWI A;  2ESN A;  2QMW A;  2W7Y A;  3HCQ A;  3HFU A;  1NV3 A;  4H45 A;  1OLC A;  2UVH A;  4E0W A;  4YB7 A;  2XD3 A;  1PBQ A;  3O6G A;  1II5 A;  4RJZ A;  2DVZ A;  4FIM A;  3PMW A;  2VD2 A;  4THI A;  1B1H A;  1R9Q A;  1FBP A;  2Y7K A;  3HO7 A;  1USY E;  1H76 A;  4IO5 A;  2XXV A;  3LSX A;  3KFM A;  4JSD A;  5IZ3 B;  2VOZ A;  1DOT A;  1A8F A;  4ESX A;  1Y4C A;  3LUY A;  3PTY A;  1NV4 A;  3VLW A;  5EQ8 A;  3PMV A;  1HSE A;  3THI A;  4ZDM A;  1FQE A;  1ZU0 A;  2HXR A;  2D3I A;  2O7I A;  4MX6 A;  1S9T A;  5ELV A;  3MZ1 A;  5BUU A;  3P7I A;  3N26 A;  3C34 A;  3SKP A;  3IOU A;  3CSB A;  4AS5 A;  1B40 A;  2NXO A;  3A29 A;  4NF6 A;  4NF5 A;  1M5E A;  4MH5 A;  1URS A;  1FTK A;  3LSW A;  4G8N A;  5CMB A;  4XTC Q;  3WAE A;  4G8H A;  2DWJ A;  4RA1 A;  4GQO A;  2A5T B;  4NMY A;  1PB8 A;  1LCF A;  1QW0 A;  5FHO A;  1NMU A;  4POX A;  3B8B A;  2Y5L A;  2OPD A;  4R9G A;  2DSF A;  4P1L A;  1MDQ A;  3H6W A;  4I62 A;  1UIV A;  1SQY A;  3MVX A;  2F8D A;  1Q35 A;  1B7H A;  4N8G A;  4GX3 A;  1B52 A;  1HSJ A;  3PUZ E;  1JNF A;  2UYF A;  3TEP A;  4QXD A;  3DP4 A;  4NWC A;  1IXC A;  1LFH A;  1B3G A;  4IO4 A;  3RYD A;  2WKY A;  4C0R A;  1QUI A;  1LST A;  2V3T A;  3V89 B;  4LQ5 A;  4EDP A;  3B7D A;  2QRY A;  3GZG A;  3O97 A;  1GTK A;  1EH3 A;  5DYH A;  3I5O A;  5CBS A;  3TOD A;  3S9N C;  4N15 A;  4ESW A;  1F9B A;  2XXR A;  2O51 A;  3A3C A;  2QVU A;  1BK4 A;  2XXK A;  2PT1 A;  3G3I A;  2ALU A;  5I84 A;  1FQD A;  2FNC A;  4UAB A;  2YJP A;  3M3K A;  3GXA A;  4PBQ A;  4QHQ A;  4FBP A;  4WEP A;  1OQH A;  2I0C A;  2X7Q A;  2RC7 A;  5AA2 B;  4LZ5 A;  2Z23 A;  3GYY A;  3FAS A;  2I3V A;  3CVG A;  3GBB A;  4OFO A;  2PCR A;  3IOT A;  4PDH A;  5L9S A;  2PYY A;  3KJ7 A;  4F3B A;  4NWD A;  3OO8 A;  3PPN A;  1LLS A;  4YZZ A;  4XKR A;  2QS4 A;  4BDR A;  4LN5 A;  3T22 A;  4GXS B;  1P1O A;  3IR1 A;  1XVY A;  3Q28 A;  1EYK A;  1MQG A;  1R1N A;  3LSF B;  3FJM A;  4LZ7 A;  4R2F A;  3RTW B;  4PAF A;  2Q89 A;  2LAO A;  2FBP A;  4R73 A;  2ZYO A;  4OVP A;  2XXW A;  4KPT A;  3MZB A;  2R9J A;  4QRZ A;  5HPQ A;  4OFJ A;  4MF3 A;  5IZZ A;  4N07 A;  3QMF A;  3V8X B;  3UGW A;  2XXU A;  4UA8 A;  3SEV A;  2XXQ A;  5H8F B;  4KHZ E;  4NN3 A;  1FPB A;  3SES A;  1EYI A;  1YAE A;  3E13 X;  5IGA A;  1I6A A;  4R72 A;  2HZK A;  5I2N A;  5ITP A;  1IIW A;  3SEY A;  3FXB A;  3DM0 A;  4AB6 A;  3OMB A;  3C4M A;  3KN3 A;  4RNS A;  4FED A;  3EHS A;  4NTL A;  4GXA A;  3CG1 A;  4PGN A;  1QKA A;  2NOO A;  4BDM A;  1YZ0 A;  4GWW A;  1IXH A;  1RDY A;  4OZ9 A;  1SW2 A;  1P1N A;  3TCG A;  1FSA A;  1N7X A;  4MIJ A;  2HXW A;  5JK4 A;  5L9M A;  3K1N A;  4JVD A;  4G68 C;  1Q9D A;  3SDF A;  3FJ7 A;  4IO7 A;  2QL3 A;  1PB9 A;  4ZEI A;  3QAX A;  1LCT A;  3I6V A;  1MXZ A;  3OD7 A;  5H8Q A;  2NWJ A;  1QGX A;  4HE0 A;  5FHM A;  5I7I A;  5KZT A;  3EN3 A;  3RGY A;  3K6U A;  4H8I A;  3Q25 A;  3S2V A;  4NAP A;  4WKM A;  3KG2 A;  4YKK A;  4KD5 A;  1KA1 A;  2A5S A;  2DVC A;  1A7L A;  5M2V A;  3EPE A;  3RPL A;  1RDZ A;  5AE4 A;  2DP8 A;  2I0B A;  2F6P A;  1UTB B;  5I56 A;  2XWO A;  4NX1 A;  2VHA A;  2I58 A;  2OZZ A;  3OO7 A;  4GOT A;  5CMK A;  1DCU A;  4MHF A;  1M5D A;  1TT1 A;  1ZKB A;  5I58 B;  2H98 A;  3TDJ A;  4QFO A;  3OXN A;  2AIX A;  3N6U A;  2RCB A;  2VT5 A;  3E78 A;  1VR5 A;  2CMO A;  2E0S A;  3CRB A;  4G4P A;  5EHS A;  1UQW A;  2DXY A;  1Y3N A;  3IB0 A;  1RYO A;  1M5F A;  4H5G A;  3KEI A;  5F24 A;  3QK6 A;  1FQA A;  2O7U A;  1TWY A;  1BIY A; 
#chains in the Genus database with same CATH homology
 3MST A;  5J16 A;  1LBZ A;  1IMB A;  4GX4 A;  5EQ9 A;  1FRP A;  4OAN A;  2FIE A;  4O94 A;  4GWU A;  5EYH A;  4OVS A;  4YIC A;  2F3D A;  1INP A;  2V4C A;  1NV2 A;  2MKZ A;  2P3V A;  2Q9T A;  5ET7 A;  2CEX A;  4F1U A;  4DI3 D;  1NV0 A;  2QVV A;  4N6K A;  4P56 A;  1FJ9 A;  4NF0 A;  4O8M A;  2JJK A;  2PFY A;  4HE1 A;  2XWI A;  1D9Q A;  4JVC A;  5EQ7 A;  3HFU A;  5IZ3 A;  1NV3 A;  4H45 A;  4PBH A;  3NOH A;  1K9Y A;  2WYP A;  4N8Y A;  3KC1 A;  2DVZ A;  5J1D A;  1LBV A;  5A5L A;  1FBP A;  2B4L A;  4JVI A;  1FPL A;  5I5P A;  4PFI A;  1DBZ A;  2V3Q A;  2DE3 A;  1DK4 A;  5IZ3 B;  3PTY A;  1NV4 A;  1FBH A;  4OVR A;  5EQ8 A;  2WX9 A;  4PF8 A;  2Y5K A;  2ZZW A;  3SZP A;  2HZL A;  1FBE A;  3MYU A;  2BJI A;  2HXR A;  4MX6 A;  4X04 A;  3E79 A;  4DI4 B;  2QFL A;  2WYK A;  4PAK A;  4P9K A;  4NHB A;  4AS5 A;  3A29 A;  2WBD A;  5LDZ A;  2CEY A;  3W9V A;  4XFE A;  4PTK A;  2FIX A;  5DW8 A;  3B50 A;  1K9Z A;  4GBV A;  4NGU A;  4GWY A;  3B8B A;  2Y5L A;  4F1V A;  4P1L A;  4GWS A;  1LEV A;  4MNP A;  4N8G A;  4GX3 A;  4PE3 A;  4PET A;  3IFC A;  1NUX A;  4QXD A;  2FVZ A;  4MMP A;  1JP4 A;  2FHY A;  2QVR A;  5LTC A;  3RYD A;  1FPE A;  2HPG A;  2XWV A;  4OVQ A;  4PC9 A;  2HHM A;  4P47 A;  2VPO A;  4OA4 A;  4I3E A;  4QBA A;  4N15 A;  4HCW A;  2ZZV A;  2QVU A;  4P8B A;  1BK4 A;  1RDX A;  2XXK A;  4I40 A;  4HXV A;  1VDW A;  4H46 A;  1IMC A;  4F19 A;  4O7M A;  4UAB A;  1FPF A;  4IR8 A;  1IMD A;  4PBQ A;  3LUZ A;  1G0H A;  1KA0 A;  4FBP A;  1NI9 A;  4MNI A;  5ET6 A;  2B4M A;  1FJ6 A;  4MEV A;  2DDK A;  3GYY A;  5EYG A;  2ZZX A;  4AS4 A;  2VPN A;  2PCR A;  4PDH A;  1EYJ A;  4MAG A;  5T3J A;  1NUY A;  4GWX A;  1FPK A;  4YZZ A;  4PFR A;  5ESY A;  1NV6 A;  4MNC A;  4LN5 A;  5CM6 A;  2PFZ A;  5EQA A;  2WBB A;  1EYK A;  4F18 A;  4I3Y A;  2XA5 A;  4PAF A;  1FBF A;  3T1B A;  1G0I A;  2FBP A;  1NUZ A;  4OVP A;  3FBP A;  3BIH A;  2Q8M A;  4M1V A;  4X9T A;  1LBX A;  1FBC A;  5IZZ A;  2DE4 A;  3QMF A;  2L5V A;  5I3S A;  4NN3 A;  1FPB A;  3D1R A;  1IMA A;  1EYI A;  4PDD A;  5IGA A;  3ISP A;  2QPQ A;  1NV5 A;  2OX3 A;  1YYZ A;  2HZK A;  1FBD A;  2CZI A;  4GBW A;  2GQ1 A;  1SPI A;  4NG7 A;  4PAI A;  3FXB A;  2XWK A;  1IMF A;  3LV0 A;  3CHG A;  1FTA A;  5ET8 A;  2DE2 A;  4PGP A;  3IFA A;  4N91 A;  4MJO A;  4PF6 A;  2CZK A;  4PGN A;  1YXI A;  1YZ0 A;  4GWW A;  1FBG A;  1RDY A;  4GX6 A;  1FSA A;  4MIJ A;  1KZ8 A;  5ET5 A;  3U65 A;  5JK4 A;  1NV1 A;  2CZH A;  4JVD A;  3T0J A;  1Q9D A;  1NUW A;  4OVT A;  1IME A;  4N4U A;  4P3L A;  4KXP A;  2P3N A;  1QGX A;  1XI6 A;  4HE0 A;  2F5X A;  2KQZ A;  4MCO A;  3ROJ A;  5I7I A;  4NAP A;  1FPI A;  5FBP A;  4HE2 A;  1LBY A;  1KA1 A;  3KC0 A;  4XF5 A;  4P1E A;  3EKI A;  3RPL A;  1RDZ A;  4N6D A;  2R8T A;  1FPD A;  2XWO A;  4NX1 A;  4NQ8 A;  3W9W A;  4N17 A;  1CNQ A;  1FPG A;  2Q74 A;  1DCU A;  4MHF A;  1NV7 A;  5IM2 A;  4PCD A;  4O7I A;  4X8R A;  2KR0 A;  1AWB A;  2F3B A;  2OWZ A;  1LBW A;  2VT5 A;  1FPJ A;  3RPL B;  3E78 A;  4N81 A;  2WEF A;  5IZ1 A;  3KBZ A;  4HCY A;  4PFB A;  5F24 A;  4GWZ A;  4XEQ A;  3BIG A;  4G61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...