4MJOA

Human liver fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate, 1-phosphohydrolase) (e.c.3.1.3.11) complexed with the allosteric inhibitor 3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Determination of protein-ligand binding constants of a cooperatively regulated tetrameric enzyme using electrospray mass spectrometry.
pubmed doi rcsb
total genus 104
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4mjoA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mjoA02
1EYKA 2VT5A 3KBZA 2Y5KA 1NUXA 1LBZA 1IMEA 1LBVA 2CZKA 4KXPA 1RDYA 1IMBA 3KC1A 1FBEA 2OWZA 1K9ZA 2F3BA 1FBFA 1YYZA 3BIHA 4H45A 1FPGA 3LV0A 5EYGA 1NV1A 1K9YA 4GWUA 1DBZA 4N81A 2BJIA 4O7IA 2WBDA 4H46A 1KZ8A 5IZ1A 1FPKA 1FPBA 5ET5A 1FRPA 2QFLA 2WEFA 1FJ6A 1QGXA 4HE1A 5I3SA 5ET7A 1FPIA 5T3JA 3IFAA 1KA1A 2JJKA 3A29A 4G61A 4GBWA 4GBVA 2PCRA 2OX3A 3BIGA 1LBXA 2FIXA 1IMDA 2F3DA 2FBPA 1CNQA 1JP4A 3QMFA 5EQ7A 5IZ3A 3RYDA 1NV3A 4MJOA 1AWBA 4I3EA 1FSAA 1Q9DA 1NV7A 5IZ3B 2P3VA 2Q74A 3RPLA 1FPDA 1INPA 1LBWA 1DCUA 3RPLB 1VDWA 4HE2A 5LDZA 1FJ9A 1FPJA 3B8BA 2QVVA 4GWXA 1FBCA 1LEVA 2FVZA 1YZ0A 1FBPA 4GX4A 1FPFA 1NV4A 2WBBA 5ET6A 3LUZA 1NUZA 1EYIA 1FTAA 1NI9A 1G0IA 4I40A 2Y5LA 5EYHA 2FIEA 1KA0A 1FBGA 2R8TA 1RDZA 1YXIA 4HXVA 1NV0A 1LBYA 1NUYA 1FPEA 1RDXA 4FBPA 2FHYA 2QVUA 5F24A 3T0JA 1IMAA 4PTKA 5J16A 1FBHA 2QVRA 4HE0A 3D1RA 4GWYA 4GWZA 4IR8A 1SPIA 1G0HA 5EQAA 5ET8A 3ROJA 4GX6A 1FBDA 1IMCA 5DW8A 1IMFA 5EQ9A 5ESYA 1DK4A 2DDKA 1D9QA 2CZHA 1NUWA 1NV2A 3FBPA 2HHMA 5A5LA 2P3NA 2CZIA 1NV5A 4GX3A 4GWWA 4QXDA 2Q8MA 1NV6A 5EQ8A 2GQ1A 1EYJA 5FBPA 4GWSA 3IFCA 4AS4A 4I3YA 4AS5A 1FPLA 3KC0A 1XI6A 1BK4A
chains in the Genus database with same CATH superfamily
3C9HA 3T93B 3V8XB 1K9ZA 4R6HA 4DXCA 4OVPA 1MDP1 1R9LA 3F11A 2ZNSA 3K6WA 3U8QA 4H46A 2Q89A 3MC2A 4HE1A 4YKKA 1IXGA 3PMVA 3UN6A 4NN3A 1SW5A 4AQ4A 2PCRA 4FAJA 1B32A 1JP4A 5I7IA 1URSA 4JBZA 3PPOA 1NV7A 2DP8A 4Z7EA 3BFTA 1AL3A 4X8RA 1XVYA 4F3PA 2HEUA 2PT2A 3IOTA 2ONKE 1FPJA 2QVVA 3T9VA 4N8YA 2DE4A 3WAEA 2WBBA 5ET6A 3I3VA 4AB6A 4JWYA 1MY0A 4PCDA 1BKAA 1QVSA 1ZIUA 3RGYA 3THIA 2VHAA 3FJMA 1UTBA 4LP2B 5I84A 1LBYA 1LCTA 5CMCA 1UTBB 2QS1A 4OVRA 2O69A 2QVRA 3HFUA 3K1NA 5TPAA 3JZJA 1NNKA 2CEYA 4MIJA 5L8DA 5TPAB 3RY3A 4NE4A 1QW0A 3MAMA 2RCBA 2XXRA 4GX3A 5DVIA 4DLDA 3TAJA 5FBPA 2F5XA 3TUSA 2W7YA 4KXPA 1MQGA 3USDA 3QUJA 1LFHA 3FVKA 4NQ8A 5F1QA 3MP8A 5K2YA 1JEVA 2M8CA 3IORA 4ZS9A 2NOOA 2UYFA 4R73A 1JVXA 1H44A 4Q30B 3IFAA 3K1PA 4H5FA 3R7XA 4G4PA 2XXUA 4TQUQ 4DZ1A 1Z7NE 2B4LA 1Q9DA 2P3VA 2VPOA 2I6EA 3RN8A 2ZXTA 4U21A 3T9HB 1GR2A 4OFOA 4F1UA 3DP6A 3DP8A 4QBAA 5CM6A 3E79A 4QFKA 3MZBA 4E0XA 5M2VA 2CMOA 4TLLB 5EYHA 2FIEA 2O68A 1KA0A 4N13A 4IO3A 4OZ9A 4UACA 1B3FA 4BLAA 2VP1A 1PB8A 4GXAA 3KOTA 2DQVA 4O3CA 4ESXA 2QS3A 2VD3A 2ZNTA 3IOWA 1DK4A 3ILTB 2OK2A 3FBPA 2XD3A 4P0GA 3E9XA 1PB7A 4YICA 4AS5A 3FJGA 1LBVA 4XKNA 4OMBA 2Y7WA 3CRBA 3VVFA 1P1NA 1FTJA 1B7HA 2H9BA 4H45A 3E78A 1FPGA 5CMBA 2QJEA 4N81A 4KYSA 1MQHA 3CHGA 3VLWA 1KZ8A 3GYYA 2PT1A 2I58A 4DCXA 3PUXE 2WEFA 4I62A 2A5TB 1JETA 2VOZA 2B4MA 4K3FA 5KZTA 4GBWA 4PAIA 3BKIB 5AA2D 2RINA 4KYEA 1WODA 2IA4A 3S4UA 2XXIA 4PE3A 5TP9B 4H6DA 2ABHA 3PV0E 3FGSA 2DS9A 2F78A 2XWVA 5H8QB 1I6BA 1VFEA 4RPNA 5IGAA 4KHZE 3LSWA 3VDFA 4YB7A 4PGPA 1EYIA 3KN7A 5I2KA 4P3LA 1FBGA 5KDTA 1TWYA 3IO6A 1JVYA 3TQWA 4ZE9A 1JQFA 4QHQA 3WAFA 5KDTB 3FJ7A 1MXVA 3PD9A 4NGUA 4H1XA 3FV2A 3IR1A 3UK4A 1FBDA 3EF7A 5DW8A 5DTBA 2FYIA 1OLAA 1Z7ME 1A54A 2CZHA 3KN8A 3B6QA 4RYAA 4MEVA 4GXSB 1WVJA 3Q28A 5EQ8A 5LOMA 1FPLA 3RPWA 5EYFA 3C33A 4N6PA 3KBZA 1N7XA 5I57A 4Q8RA 4JXIA 3CFLA 5I57B 4GWOA 3O28A 3VE1B 4YB6A 4F3SA 3C31A 4O7IA 1FPKA 4FEDA 3MP1A 4PP0A 5DEXA 2F7CA 3FVGA 3OELA 4BDQA 1RKMA 2I0CA 5DEXB 1NNPA 1CNQA 3MBPA 4NWDA 3K01A 4PETA 1SI0A 2Q74A 3O6HA 3RPLA 5ITPA 3W15C 2G29A 1FPDA 1MH3A 2AL5A 1SDXA 3RPLB 3PPRA 3PGFA 4YKPA 3L6HA 5ICQA 4EDPA 5F7VA 2RCAA 3RQTA 4IO6A 4HW8A 5ISUA 2O7UA 2UYEA 1NKXA 4R75A 2I0BA 4XIGQ 3RUMA 2AL4A 4KI0E 4P11A 3FUZA 4ZEBA 2XXXA 3T1BA 3L6GA 3E3KA 3VV5A 1T0KA 3IOUA 1ZLQA 4OXVA 3HPIA 4U4XA 2O6AA 3LSLA 3O29A 1B2HA 1GTKA 1R6ZA 4E0WA 3VFJA 2HHMA 4HS7A 3SETA 1M5CA 4JSDA 5DVFA 2Z22A 2MKZA 2V93A 2VT5A 1IXCA 1P1OA 3Q25A 3KC1A 5ICTA 5H8HA 2F34A 2QS2A 4MHFA 3DM0A 3TELA 5CMKA 5IAIA 1AMFA 4HCWA 3CG1A 4I9DA 3PPPA 4F29A 1UTHB 4GF8A 1IXHA 5ELVA 1KA1A 2Y7RA 3MW0A 4ELQA 4POWA 4RK9A 4NX1A 1EZPA 3RYDA 2XD2A 3ZS6A 1AWBA 3QUFA 1MRPA 1A99A 1USYE 2QRYA 4KCDA 4F22A 4BDNA 3RTWB 1IQ7A 1FTOA 2ZYMA 1DCUA 1US5A 1DMBA 5AA1A 1FBCA 2R6GE 1SYHA 1HSEA 2DVCA 1NUZA 3U94A 1BIYA 1JW4A 2CEXA 4OERA 2PYYA 1B0HA 5FHOA 4P8BA 2O51A 2HQ0A 2NVUB 1MPDA 2E0SA 1R1NA 5L9OA 3KEIA 3MJNA 3PUVE 4GWYA 1TXFA 2XWOA 1ELJA 4PF6A 5BWJA 1SPIA 3UA8A 2Q9TA 3SEUA 1A8EA 4EF1A 4XKPA 1MXYA 3MVXA 1POTA 4MCOA 2DDKA 1B7ZA 1IIWA 5K2XA 2Y84A 3K1MA 1OMPA 1OQHA 2V84A 1MQJA 4KCCA 1NV5A 1B7UA 4ZZAA 2I3VA 2Q8MA 2QL3A 4ZEDA 1B40A 4DI4B 1FTKA 3W9WA 1SQYA 1IMEA 3LSFB 4O8MA 2THIA 2PFYA 5CMMA 4OA4A 3BIHA 3LV0A 2F35A 4U23A 3S2VA 4ELPA 3GXAA 1QULA 2HZLA 1FRPA 4TOZA 2QFLA 2PFZA 1FTMA 4FATA 4F18A 5JEIA 3KJ7A 5CI5A 4F1VA 3LUYA 3SERA 4DE8A 4UA8A 4PBHA 3FXUA 4NF4A 5AA4A 3N5LA 2OWSA 4NF4B 2OBGA 5AA4B 4QSCA 2RF1A 4GLIA 4C0RA 5CC2A 3FZVA 4HE2A 1B52A 4P0IA 1FJ9A 4MMPA 1CE2A 3OOAA 2UVJA 1M5EA 3JV9A 3HCQA 2F7BA 4DIGA 2H4IA 1NI9A 4I40A 4QF9A 2QSXA 2X7PA 3C36A 1H43A 4IO2A 1D9YA 4TLMB 1DOTA 1NNFA 4OYVA 1FBHA 3MYUA 3KGCA 4LQ5A 4YKIA 4GWZA 3ZKLA 3CG3A 1PDAA 1IMCA 3UIFA 1IMFA 2UVGA 3UP9A 1NUWA 4R9FA 5I56A 4GWWA 4NEDA 3M3KA 2NXOA 1M5FA 3KC0A 1OIBA 4YU0A 4F3GA 1SW1A 2ZZVA 5I56B 2OZZA 2P1SA 5HPQA 4IO7A 2I48A 4YMBA 1XT8A 1BP5A 3SKPA 1MY2A 2REJA 4JVDA 5JK4A 1B4ZA 1FPBA 3KN3A 4ELOA 4L17A 4THIA 5IZ3A 4MJOA 1FSAA 4RK2A 1AOVA 5IZ3B 4G8NA 1MPCA 1JW1A 4P47A 3T66A 2WYKA 5H8FA 1MXZA 4NF0A 3MVZA 4JVIA 4OENA 4RPOA 4P56A 3LUZA 3H7MA 3GLBA 3G3KA 1NNTA 3BBRA 3CIJA 1NV0A 3FXBA 2P2AA 3MVYA 5EHMA 2QVUA 2E1SA 3IB1A 4OWDA 4U4SA 5J16A 1I69A 3I5OA 2HAVA 3P7IA 1P1WA 2F6GA 2D5WA 5EQAA 1WDNA 1USYH 2DOJA 4NTLA 4GD5A 1MG1A 4H65A 2O7IA 4P9KA 1A8FA 1D4NA 4QSDA 3N94A 4F19A 2CZIA 2ZYKA 3TTMA 5I59A 1MM6A 2Y7PA 2V3QA 4MAGA 2BJJX 3O97A 1IMBA 5I59B 3BFUA 4N4UA 2F36A 4MX6A 2GRVA 5B70A 3MUQA 3CI8A 4OQOA 1M5DA 1SVXB 2KR0A 2HXWA 1LSTA 3QYTA 5I3SA 4LONB 2JJKA 2VD2A 4G61A 1A55A 2XXWA 3R26A 2OX3A 3TDJA 3BIGA 2FBPA 4KPTA 3PUYE 1N76A 2FNCA 2Y7KA 4XXUA 3QIMA 4WEPA 4PC9A 4QSEA 3TCHA 3G3JA 1PBPA 3TMGA 4NF5A 4UABA 1B58A 3B8BA 3B50A 4GWXA 3MSTA 4NF6A 1FBPA 4KFQA 4FECA 4NF5B 4G68A 3EPEA 4NF6B 1VE4A 5A5XA 2I3WA 1MXUA 4G68B 2NWJA 3EQ1A 3IL1B 3IB2A 5A5XB 1TFAA 4M4GA 2I4CA 3EHTA 4H0WA 3K0VA 4NMYA 3GBBA 4RJZA 4X1DA 1LBBA 3PMXA 3IB0A 3DP4A 1MM7A 4GX6A 3KJTA 3EKIA 3IJXB 5ESYA 5I2NA 1XOCA 4N15A 5I2KB 3OSQA 4KYDA 5I2NB 1EYJA 1ZKBA 4GWSA 5F24A 1JW5A 1RDYA 1FBEA 1FBFA 5DT6A 4BDLA 2H99A 4FEBA 2FA7A 3VVDA 5HM4B 5H8NA 2OWTA 3U92A 4MH5A 2Z8EA 1B05A 1FJ6A 1QGXA 1GV8A 2GFEA 2DYXA 4XF5A 3CR9A 3QK6A 3LSXA 1NV3A 4EQ9A 2DSFA 4JVCA 3DELB 3OO6A 5H8SA 4PDHA 1R9QA 1LAXA 1II5A 1OVBA 3OENA 1LBWA 3FD3A 4Z0IA 1IITA 4R9GA 4EQBA 2FVZA 1S50A 1PEBA 4PQJA 1URDA 2G93A 4P1LA 3RT8A 1EZ9A 4F1YA 1G0IA 1S9TA 3OEMA 2DE2A 4OVTA 4U2RA 3UGWA 3IX1A 1S7YA 1FPEA 4FBPA 3GBAA 3K6UA 3U72A 2XXPA 4ELRA 1B5HA 3RNNA 3VXCA 2QMWA 3OSRA 3EN3A 2HCAA 1B6HA 4R74A 2X7QA 3H6TA 3K00A 2XHDA 3G3IA 1B46A 4QFPA 1B3EA 3O2AA 4X9TA 2H5YA 2XXHA 2F6PA 5ITOA 2CZKA 5FHMA 3LC8A 1US4A 4PFBA 1URGA 4H67A 3FATA 2OWZA 2XX7A 3G3GA 3M3LA 4RXLA 3PTYA 1B9JA 3ILUB 4OEVA 1SW4A 4C1TA 4LN5A 3QXMA 3FXQA 4QFOA 4M1VA 4RY1A 2ESNA 2D21A 3CFZA 3ZKKA 1YAEA 2GHBA 2B3BA 4F3BA 5EQ7A 4F39A 2DXYA 4YKJA 2QPQA 5H8HB 1Y4TA 4JWXA 3OXNA 5L9MA 4EXKA 4MNCA 3W9VA 3U93A 2YPNA 3HO7A 1UIUA 1N3WA 5KCJA 3FV1A 4WKMA 3TEPA 2DWHA 5KCJB 4R72A 1EH3A 4JDFA 1NH8A 4N07A 4BDRA 1ZTYA 2Z8DA 1RDZA 1YXIA 4HXVA 4QFLA 4DCYA 3V5AA 3TCGA 1LB8A 4R2FA 4JB7A 4NG7A 1VR5A 2OLBA 3C34A 3KZGA 3S9NC 1MY1A 4PFTA 1H76A 4O7MA 4WXJA 5AA3A 1M5BA 1SI1A 4XKRA 4OANA 4FORA 4LVQA 1N0TA 4XTCQ 2QMXA 4YB5A 2XA5A 5FHNA 1BK4A 3K4UA 5CBSA 5DYHA 1PB9A 4F2QA 2VPNA 1HSJA 3OD7A 3HSTA 3G3FA 3N6TA 3ISPA 1A40A 3R6UA 5HBCA 3KOSA 1N04A 4X1BA 1FPIA 5T3JA 1DPEA 1D9VA 3A09A 4O3BA 4GRKA 3CVGA 4GQOA 1Y4CA 4G8MA 3O9PA 4C1UA 4ZE8A 3A3CA 3O6GA 4R2BA 3M3FA 4OVJA 4PFIA 3T9UA 2LAOA 1D3KA 4R6KA 3TCFA 3NOHA 3OMBA 3MVWA 4PE5B 2R8TA 4I1DA 2Z8FA 1ANFA 5JTYA 1B1XA 1NUYA 2HXRA 1DPPA 2UVIA 5JTYB 2RKMA 3D1RA 3ODBA 1QUIA 4H8JA 4PAKA 2AYSA 4AB5A 2VGQA 4PGNA 1O64A 5FTHA 2V3UA 1FQCA 3MZ1A 4OVQA 1ZU0A 5DVJA 5A5LA 3FASA 5IM2A 2GQ1A 1LFIA 4ZZEA 4I3YA 4DXBA 3ROJA 2I4BA 3OO8A 2XWKA 2Y5KA 2CZLA 2O1MA 1LBZA 3GZGA 2F3BA 4G2ZA 1NL5A 2PX1A 3C4MA 4EQ7A 1YYZA 4ONYA 1POY1 3PMWA 3MQ9A 3VVEA 2ZZXA 1K9YA 1MQDA 2O84X 4P1EA 2HPGA 2H98A 4KQPA 3T96B 3VLUA 1MDQA 2HFBA 3KFMA 2XXTA 1H3DA 3TPAA 2H25A 3PU5A 4LUBA 2YJPA 1RYXA 2PVUA 2ZMBA 2DVZA 3H3GA 4GIZA 4YMAA 1LAHE 1ZBMA 3A3UA 3T22A 1FQFA 4OETA 3H03A 3D4GA 4GX4A 1PBQA 1QJMA 2UVHA 2HAUA 3H6VA 1PC3A 4DXUA 1FQBA 2V4CA 1FTAA 2ZZWA 4PF8A 1IZ1A 3K6XA 1P1QA 3C32A 2PBWA 5AE4A 1LAGE 3KBRA 3Q27A 4H5GA 1MQIA 5FTIA 4H8IA 4QRZA 1XHYA 1B3HA 3S9LC 5I5PA 2ZYOA 1SYIA 1P99A 1G0HA 5H8FB 1B5IA 1J1NA 3KSJA 4IO5A 1D9QA 3B7DA 4N6KA 1NV2A 3K2DA 1L5TA 5CRYA 3TYHA 2DWJA 2ZYNA 4QXDA 1XC1A 3IFCA 5EHSA 1XI6A 4U1ZA 3RTFB 4PDDA 1NMUA 2GH9A 4EUOA 4PFWA 4PBQA 2Q8JA 1FCKA 1DBZA 1MH4A 1VFDA 5IZ1A 3O66A 4R6YA 2Z23A 1LAFE 1FW0A 1BLFA 1ZJLA 4U22A 4LZ8A 4NAPA 1Y3PA 2IEEA 1SD3A 1YPNA 1LBXA 3M8UA 2B65A 4OEUA 1MY4A 2RC9A 2ONRA 4KD5A 3V89B 4LZ7A 2Q2CA 4ND9A 3Q26A 1QUKA 2ONSA 2QS4A 3MPLA 4IO4A 1F9BA 4F31B 4Q5TA 1FQEA 4LATA 3TQLA 5LDZA 3OO9A 3N26A 1CB6A 4LA9A 2XXYA 4G8HA 4DDDA 4MBPA 3LR1A 2X26A 1XS5A 3C35A 4YZZA 2Y5LA 3PUWE 4IY5A 3U65A 4OHNA 1QUJA 3RLFE 4PTKA 3OEKA 1DTGA 3K6VA 4MNIA 3ONMA 2AIXA 4OVSA 1SBPA 2A5TA 4IB2A 3H6UA 3I6VA 2OCUA 2P3NA 2R71A 2YLNA 2RC8A 3IAZA 4POXA 5IZZA 3MZ9A 1O63A 2B3FA 2WYPA 4FE8A 3SEXA 1DSNA 4LZ5A 1N3XA 5TP9A 5IKBA 2ALUA 2OPDA 3SEWA 5LTCA 5H8QA 4GWUA 3HHFA 3KSXA 3CFXA 3HHGA 3QAXA 3VLVA 3IO4A 4G68C 1I6AA 4OESA 4N6DA 4ESWA 3A29A 3ECRA 1H45A 4I8CA 4MNPA 1OLCA 3TTNA 2F3DA 4QFNA 3IK6B 4I3EA 1RYOA 5CBRA 3EHUA 3TTRA 1KWHA 2REGA 3SDFA 3S9EA 4XKQA 5H8NB 4ZEKA 1VDWA 3S9MC 1LEVA 1YZ0A 3KG2A 1MXXA 1IEJA 4BDOA 2WKYA 3CSGA 4MLVA 3T9XB 3PPQA 3Q29A 4G77A 4GL8A 3SEVA 3HN0A 2DWIA 1GVCA 2FHYA 1JNFA 4PFUA 3MPKA 3T0JA 2F8DA 3RT6B 1Y1ZA 1YTVA 3H06B 4NF8A 3TZAA 3U1OA 4GFRA 3AXFA 1OQGA 1Y9UA 2F7AA 4NF8B 3FXRA 1B5JA 4XFEA 3SESA 3G3HA 4IGRA 3E4RA 4DI3D 5I58A 3QSLA 2WX9A 1NV6A 4AS4A 3PPNA 5I58B 2HZKA 1QKAA 1EYKA 3TFLA 1TFDA 1NUXA 1A7LA 1ATGA 5EYGA 4ZEIA 2KQZA 1IUDA 3VXBA 4XEQA 1JEUA 4PAFA 5J1DA 5ET5A 4RA1A 4LQ2A 3FVNA 2DXRA 3FVOA 3FIRA 2ZNUA 2FIXA 1IMDA 3QMFA 2XX9A 1Y3NA 4YAHX 4F2OA 1P1UA 3JYRA 4OTEA 4ECFA 1LGBC 4OFJA 4IGTA 1BTJA 2NUVA 2I49A 1UIVA 3MWBA 3H6WA 4MF3A 3EHSA 1HSLA 5BUUA 4EXLA 1EU8A 1UQWA 1LB9A 4ISUA 3DLNA 4Q0CA 4N91A 4X48A 1FPFA 1NV4A 2Y7IA 2V3TA 4WEDA 3TKDA 3N6UA 4U1OA 3ZSFA 4PFYA 2XWIA 4MLQA 1AH5A 1AIVA 1GGGA 1Q35A 4GOTA 1ZMGA 1YCJA 1I6QA 1IMAA 1VSOA 4PFRA 4HE0A 2D3IA 5L9SA 4BDMA 1NH7A 4MFIA 4NWCA 4IR8A 3TTKA 2ANJA 2Q2AA 5ET8A 2L5VA 1MXWA 1FTLA 3SZPA 4OFLA 1UTHA 5EQ9A 2O1LA 2P0SA 4GL0A 1TT1A 2R9JA 3V83A 1LBCA 4FJPA 2KLFA 4O3AA 2RC7A 5AA2A 4FIMA 4HCYA 2UXAA 1NFTA 1QKBA 1Q1KA 1EZOA 5AA2B 1DTZA 1B1HA 3PUZE 4HTGA 4KR5A 1NV1A 1LLSA 2BJIA 1LCFA 1FQAA 2WBDA 2XXKA 3HV1A 3B6WA 3H4ZA 5ET7A 1B51A 4N17A 1FQDA 1LFGA 4GBVA 4RNSA 3PD8A 3TODA 2OJTA 2OPEA 3O6IA 1MY3A 1XVXA 3CSBA 1O7TA 3UORA 2PMSA 1N84A 5B7DA 1B3GA 1MPBA 4IY6A 3MP6A 4O94A 1INPA 1OVTA 3D4CA 1B4HA 2Q88A 4JSOA 2DE3A 2V25A 4EF2A 3SEYA 2XXVA 3E13X 4GVOA 2A5SA 3LBSA 1B3LA 1RDXA 5TU0A 4ZECA 1SW2A 1Y20A 4NHBA 1Y3QA 2DWAA 3K02A 2XXQA 2XX8A 1B0LA 4X04A 1N7WA 3B6TA 3IOVA 2F97A 1Y1MA 2GHAA 4N8GA 3G7WA 3IJOB 1IXIA 4ZEFA 3TTLA 4ZDMA 4JWOA 1MS7A 3OO7A
chains in the Genus database with same CATH topology
2MKZA 2VT5A 4PDDA 1RDYA 3KC1A 1FBEA 1K9ZA 4MHFA 1FBFA 4OVPA 4PBQA 4HCWA 1DBZA 4H46A 5IZ1A 1FJ6A 1QGXA 4HE1A 1KA1A 4NAPA 4NN3A 2PCRA 4XF5A 4NX1A 1LBXA 1JP4A 3RYDA 5I7IA 1NV3A 1AWBA 4JVCA 1NV7A 4PDHA 4X8RA 1LBWA 1DCUA 5LDZA 1FPJA 2QVVA 1FBCA 2FVZA 4N8YA 2DE4A 2WBBA 5ET6A 1NUZA 4P1LA 4YZZA 4PCDA 1G0IA 2Y5LA 2CEXA 2DE2A 4OVTA 4P8BA 1LBYA 3U65A 1FPEA 4FBPA 4PTKA 4OVRA 2QVRA 3HFUA 4MNIA 4GWYA 2XWOA 2CEYA 4PF6A 1SPIA 4MIJA 2Q9TA 4OVSA 4MCOA 2DDKA 2P3NA 1NV5A 4GX3A 2Q8MA 4X9TA 5FBPA 2F5XA 4DI4B 5IZZA 3W9WA 2WYPA 2CZKA 1IMEA 4KXPA 4PFBA 2OWZA 4O8MA 2PFYA 3PTYA 4OA4A 3BIHA 3LV0A 4NQ8A 5LTCA 4GWUA 4LN5A 2HZLA 1FRPA 2QFLA 2PFZA 4M1VA 4F18A 4N6DA 3IFAA 3A29A 4F1VA 4MNPA 2F3DA 4PBHA 5EQ7A 2B4LA 4I3EA 1Q9DA 2QPQA 2P3VA 2VPOA 4MNCA 3W9VA 4F1UA 1VDWA 4QBAA 4HE2A 1FJ9A 4MMPA 1LEVA 1YZ0A 5CM6A 3E79A 1NI9A 4I40A 5EYHA 2FIEA 1KA0A 1RDZA 1YXIA 4HXVA 2FHYA 3T0JA 4NG7A 1FBHA 3MYUA 4GWZA 4O7MA 1IMCA 1IMFA 1DK4A 4XFEA 4OANA 1NUWA 4DI3D 3FBPA 4YICA 4GWWA 2WX9A 1NV6A 4AS5A 4AS4A 2XA5A 3KC0A 2HZKA 1BK4A 2ZZVA 1EYKA 1NUXA 1LBVA 2VPNA 4JVDA 4H45A 3E78A 1FPGA 5EYGA 2KQZA 3ISPA 4N81A 5JK4A 4XEQA 3CHGA 1KZ8A 3GYYA 4PAFA 5J1DA 5ET5A 1FPBA 2WEFA 2B4MA 1FPIA 5T3JA 4GBWA 4PAIA 2FIXA 5IZ3A 1IMDA 3QMFA 4MJOA 1FSAA 5IZ3B 4PE3A 4P47A 4PFIA 2WYKA 2XWVA 5IGAA 4NF0A 4JVIA 3NOHA 4N91A 1FPFA 1NV4A 4P56A 3LUZA 4PGPA 1EYIA 4P3LA 1FBGA 2R8TA 2XWIA 1NV0A 3FXBA 1NUYA 2HXRA 2QVUA 1IMAA 5J16A 4PFRA 4HE0A 3D1RA 4NGUA 4IR8A 4PAKA 5EQAA 5ET8A 2L5VA 1FBDA 3SZPA 5DW8A 5EQ9A 4PGNA 2CZHA 4P9KA 4MEVA 4F19A 4OVQA 5A5LA 2CZIA 5IM2A 5EQ8A 2GQ1A 4I3YA 1FPLA 3ROJA 2XWKA 3KBZA 2Y5KA 2V3QA 4MAGA 1LBZA 4HCYA 1IMBA 4N4UA 2F3BA 4MX6A 1YYZA 2ZZXA 1NV1A 1K9YA 4P1EA 2HPGA 2BJIA 4O7IA 2WBDA 1FPKA 2KR0A 2XXKA 5I3SA 5ET7A 4N17A 2JJKA 4G61A 4GBVA 2OX3A 3BIGA 2FBPA 1CNQA 4PETA 2Q74A 3RPLA 2DVZA 4PC9A 1FPDA 4O94A 1INPA 4UABA 3RPLB 3B8BA 3B50A 4GWXA 3MSTA 1FBPA 4GX4A 2DE3A 2V4CA 1FTAA 2ZZWA 4PF8A 1RDXA 3T1BA 4NHBA 5I5PA 1G0HA 4GX6A 4X04A 3EKIA 5ESYA 1D9QA 4N8GA 4N6KA 1NV2A 4N15A 2HHMA 4QXDA 1EYJA 4GWSA 3IFCA 5F24A 1XI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYK A;  2VT5 A;  3KBZ A;  2Y5K A;  1NUX A;  1LBZ A;  1IME A;  1LBV A;  2CZK A;  4KXP A;  1RDY A;  1IMB A;  3KC1 A;  1FBE A;  2OWZ A;  1K9Z A;  2F3B A;  1FBF A;  1YYZ A;  3BIH A;  4H45 A;  1FPG A;  3LV0 A;  5EYG A;  1NV1 A;  1K9Y A;  4GWU A;  1DBZ A;  4N81 A;  2BJI A;  4O7I A;  2WBD A;  4H46 A;  1KZ8 A;  5IZ1 A;  1FPK A;  1FPB A;  5ET5 A;  1FRP A;  2QFL A;  2WEF A;  1FJ6 A;  1QGX A;  4HE1 A;  5I3S A;  5ET7 A;  1FPI A;  5T3J A;  3IFA A;  1KA1 A;  2JJK A;  3A29 A;  4G61 A;  4GBW A;  4GBV A;  2PCR A;  2OX3 A;  3BIG A;  1LBX A;  2FIX A;  1IMD A;  2F3D A;  2FBP A;  1CNQ A;  1JP4 A;  3QMF A;  5EQ7 A;  5IZ3 A;  3RYD A;  1NV3 A;  4MJO A;  1AWB A;  4I3E A;  1FSA A;  1Q9D A;  1NV7 A;  5IZ3 B;  2P3V A;  2Q74 A;  3RPL A;  1FPD A;  1INP A;  1LBW A;  1DCU A;  3RPL B;  1VDW A;  4HE2 A;  5LDZ A;  1FJ9 A;  1FPJ A;  3B8B A;  2QVV A;  4GWX A;  1FBC A;  1LEV A;  2FVZ A;  1YZ0 A;  1FBP A;  4GX4 A;  1FPF A;  1NV4 A;  2WBB A;  5ET6 A;  3LUZ A;  1NUZ A;  1EYI A;  1FTA A;  1NI9 A;  1G0I A;  4I40 A;  2Y5L A;  5EYH A;  2FIE A;  1KA0 A;  1FBG A;  2R8T A;  1RDZ A;  1YXI A;  4HXV A;  1NV0 A;  1LBY A;  1NUY A;  1FPE A;  1RDX A;  4FBP A;  2FHY A;  2QVU A;  5F24 A;  3T0J A;  1IMA A;  4PTK A;  5J16 A;  1FBH A;  2QVR A;  4HE0 A;  3D1R A;  4GWY A;  4GWZ A;  4IR8 A;  1SPI A;  1G0H A;  5EQA A;  5ET8 A;  3ROJ A;  4GX6 A;  1FBD A;  1IMC A;  5DW8 A;  1IMF A;  5EQ9 A;  5ESY A;  1DK4 A;  2DDK A;  1D9Q A;  2CZH A;  1NUW A;  1NV2 A;  3FBP A;  2HHM A;  5A5L A;  2P3N A;  2CZI A;  1NV5 A;  4GX3 A;  4GWW A;  4QXD A;  2Q8M A;  1NV6 A;  5EQ8 A;  2GQ1 A;  1EYJ A;  5FBP A;  4GWS A;  3IFC A;  4AS4 A;  4I3Y A;  4AS5 A;  1FPL A;  3KC0 A;  1XI6 A;  1BK4 A; 
#chains in the Genus database with same CATH topology
 3C9H A;  3T93 B;  3V8X B;  1K9Z A;  4R6H A;  4DXC A;  4OVP A;  1MDP 1;  1R9L A;  3F11 A;  2ZNS A;  3K6W A;  3U8Q A;  4H46 A;  2Q89 A;  3MC2 A;  4HE1 A;  4YKK A;  1IXG A;  3PMV A;  3UN6 A;  4NN3 A;  1SW5 A;  4AQ4 A;  2PCR A;  4FAJ A;  1B32 A;  1JP4 A;  5I7I A;  1URS A;  4JBZ A;  3PPO A;  1NV7 A;  2DP8 A;  4Z7E A;  3BFT A;  1AL3 A;  4X8R A;  1XVY A;  4F3P A;  2HEU A;  2PT2 A;  3IOT A;  2ONK E;  1FPJ A;  2QVV A;  3T9V A;  4N8Y A;  2DE4 A;  3WAE A;  2WBB A;  5ET6 A;  3I3V A;  4AB6 A;  4JWY A;  1MY0 A;  4PCD A;  1BKA A;  1QVS A;  1ZIU A;  3RGY A;  3THI A;  2VHA A;  3FJM A;  1UTB A;  4LP2 B;  5I84 A;  1LBY A;  1LCT A;  5CMC A;  1UTB B;  2QS1 A;  4OVR A;  2O69 A;  2QVR A;  3HFU A;  3K1N A;  5TPA A;  3JZJ A;  1NNK A;  2CEY A;  4MIJ A;  5L8D A;  5TPA B;  3RY3 A;  4NE4 A;  1QW0 A;  3MAM A;  2RCB A;  2XXR A;  4GX3 A;  5DVI A;  4DLD A;  3TAJ A;  5FBP A;  2F5X A;  3TUS A;  2W7Y A;  4KXP A;  1MQG A;  3USD A;  3QUJ A;  1LFH A;  3FVK A;  4NQ8 A;  5F1Q A;  3MP8 A;  5K2Y A;  1JEV A;  2M8C A;  3IOR A;  4ZS9 A;  2NOO A;  2UYF A;  4R73 A;  1JVX A;  1H44 A;  4Q30 B;  3IFA A;  3K1P A;  4H5F A;  3R7X A;  4G4P A;  2XXU A;  4TQU Q;  4DZ1 A;  1Z7N E;  2B4L A;  1Q9D A;  2P3V A;  2VPO A;  2I6E A;  3RN8 A;  2ZXT A;  4U21 A;  3T9H B;  1GR2 A;  4OFO A;  4F1U A;  3DP6 A;  3DP8 A;  4QBA A;  5CM6 A;  3E79 A;  4QFK A;  3MZB A;  4E0X A;  5M2V A;  2CMO A;  4TLL B;  5EYH A;  2FIE A;  2O68 A;  1KA0 A;  4N13 A;  4IO3 A;  4OZ9 A;  4UAC A;  1B3F A;  4BLA A;  2VP1 A;  1PB8 A;  4GXA A;  3KOT A;  2DQV A;  4O3C A;  4ESX A;  2QS3 A;  2VD3 A;  2ZNT A;  3IOW A;  1DK4 A;  3ILT B;  2OK2 A;  3FBP A;  2XD3 A;  4P0G A;  3E9X A;  1PB7 A;  4YIC A;  4AS5 A;  3FJG A;  1LBV A;  4XKN A;  4OMB A;  2Y7W A;  3CRB A;  3VVF A;  1P1N A;  1FTJ A;  1B7H A;  2H9B A;  4H45 A;  3E78 A;  1FPG A;  5CMB A;  2QJE A;  4N81 A;  4KYS A;  1MQH A;  3CHG A;  3VLW A;  1KZ8 A;  3GYY A;  2PT1 A;  2I58 A;  4DCX A;  3PUX E;  2WEF A;  4I62 A;  2A5T B;  1JET A;  2VOZ A;  2B4M A;  4K3F A;  5KZT A;  4GBW A;  4PAI A;  3BKI B;  5AA2 D;  2RIN A;  4KYE A;  1WOD A;  2IA4 A;  3S4U A;  2XXI A;  4PE3 A;  5TP9 B;  4H6D A;  2ABH A;  3PV0 E;  3FGS A;  2DS9 A;  2F78 A;  2XWV A;  5H8Q B;  1I6B A;  1VFE A;  4RPN A;  5IGA A;  4KHZ E;  3LSW A;  3VDF A;  4YB7 A;  4PGP A;  1EYI A;  3KN7 A;  5I2K A;  4P3L A;  1FBG A;  5KDT A;  1TWY A;  3IO6 A;  1JVY A;  3TQW A;  4ZE9 A;  1JQF A;  4QHQ A;  3WAF A;  5KDT B;  3FJ7 A;  1MXV A;  3PD9 A;  4NGU A;  4H1X A;  3FV2 A;  3IR1 A;  3UK4 A;  1FBD A;  3EF7 A;  5DW8 A;  5DTB A;  2FYI A;  1OLA A;  1Z7M E;  1A54 A;  2CZH A;  3KN8 A;  3B6Q A;  4RYA A;  4MEV A;  4GXS B;  1WVJ A;  3Q28 A;  5EQ8 A;  5LOM A;  1FPL A;  3RPW A;  5EYF A;  3C33 A;  4N6P A;  3KBZ A;  1N7X A;  5I57 A;  4Q8R A;  4JXI A;  3CFL A;  5I57 B;  4GWO A;  3O28 A;  3VE1 B;  4YB6 A;  4F3S A;  3C31 A;  4O7I A;  1FPK A;  4FED A;  3MP1 A;  4PP0 A;  5DEX A;  2F7C A;  3FVG A;  3OEL A;  4BDQ A;  1RKM A;  2I0C A;  5DEX B;  1NNP A;  1CNQ A;  3MBP A;  4NWD A;  3K01 A;  4PET A;  1SI0 A;  2Q74 A;  3O6H A;  3RPL A;  5ITP A;  3W15 C;  2G29 A;  1FPD A;  1MH3 A;  2AL5 A;  1SDX A;  3RPL B;  3PPR A;  3PGF A;  4YKP A;  3L6H A;  5ICQ A;  4EDP A;  5F7V A;  2RCA A;  3RQT A;  4IO6 A;  4HW8 A;  5ISU A;  2O7U A;  2UYE A;  1NKX A;  4R75 A;  2I0B A;  4XIG Q;  3RUM A;  2AL4 A;  4KI0 E;  4P11 A;  3FUZ A;  4ZEB A;  2XXX A;  3T1B A;  3L6G A;  3E3K A;  3VV5 A;  1T0K A;  3IOU A;  1ZLQ A;  4OXV A;  3HPI A;  4U4X A;  2O6A A;  3LSL A;  3O29 A;  1B2H A;  1GTK A;  1R6Z A;  4E0W A;  3VFJ A;  2HHM A;  4HS7 A;  3SET A;  1M5C A;  4JSD A;  5DVF A;  2Z22 A;  2MKZ A;  2V93 A;  2VT5 A;  1IXC A;  1P1O A;  3Q25 A;  3KC1 A;  5ICT A;  5H8H A;  2F34 A;  2QS2 A;  4MHF A;  3DM0 A;  3TEL A;  5CMK A;  5IAI A;  1AMF A;  4HCW A;  3CG1 A;  4I9D A;  3PPP A;  4F29 A;  1UTH B;  4GF8 A;  1IXH A;  5ELV A;  1KA1 A;  2Y7R A;  3MW0 A;  4ELQ A;  4POW A;  4RK9 A;  4NX1 A;  1EZP A;  3RYD A;  2XD2 A;  3ZS6 A;  1AWB A;  3QUF A;  1MRP A;  1A99 A;  1USY E;  2QRY A;  4KCD A;  4F22 A;  4BDN A;  3RTW B;  1IQ7 A;  1FTO A;  2ZYM A;  1DCU A;  1US5 A;  1DMB A;  5AA1 A;  1FBC A;  2R6G E;  1SYH A;  1HSE A;  2DVC A;  1NUZ A;  3U94 A;  1BIY A;  1JW4 A;  2CEX A;  4OER A;  2PYY A;  1B0H A;  5FHO A;  4P8B A;  2O51 A;  2HQ0 A;  2NVU B;  1MPD A;  2E0S A;  1R1N A;  5L9O A;  3KEI A;  3MJN A;  3PUV E;  4GWY A;  1TXF A;  2XWO A;  1ELJ A;  4PF6 A;  5BWJ A;  1SPI A;  3UA8 A;  2Q9T A;  3SEU A;  1A8E A;  4EF1 A;  4XKP A;  1MXY A;  3MVX A;  1POT A;  4MCO A;  2DDK A;  1B7Z A;  1IIW A;  5K2X A;  2Y84 A;  3K1M A;  1OMP A;  1OQH A;  2V84 A;  1MQJ A;  4KCC A;  1NV5 A;  1B7U A;  4ZZA A;  2I3V A;  2Q8M A;  2QL3 A;  4ZED A;  1B40 A;  4DI4 B;  1FTK A;  3W9W A;  1SQY A;  1IME A;  3LSF B;  4O8M A;  2THI A;  2PFY A;  5CMM A;  4OA4 A;  3BIH A;  3LV0 A;  2F35 A;  4U23 A;  3S2V A;  4ELP A;  3GXA A;  1QUL A;  2HZL A;  1FRP A;  4TOZ A;  2QFL A;  2PFZ A;  1FTM A;  4FAT A;  4F18 A;  5JEI A;  3KJ7 A;  5CI5 A;  4F1V A;  3LUY A;  3SER A;  4DE8 A;  4UA8 A;  4PBH A;  3FXU A;  4NF4 A;  5AA4 A;  3N5L A;  2OWS A;  4NF4 B;  2OBG A;  5AA4 B;  4QSC A;  2RF1 A;  4GLI A;  4C0R A;  5CC2 A;  3FZV A;  4HE2 A;  1B52 A;  4P0I A;  1FJ9 A;  4MMP A;  1CE2 A;  3OOA A;  2UVJ A;  1M5E A;  3JV9 A;  3HCQ A;  2F7B A;  4DIG A;  2H4I A;  1NI9 A;  4I40 A;  4QF9 A;  2QSX A;  2X7P A;  3C36 A;  1H43 A;  4IO2 A;  1D9Y A;  4TLM B;  1DOT A;  1NNF A;  4OYV A;  1FBH A;  3MYU A;  3KGC A;  4LQ5 A;  4YKI A;  4GWZ A;  3ZKL A;  3CG3 A;  1PDA A;  1IMC A;  3UIF A;  1IMF A;  2UVG A;  3UP9 A;  1NUW A;  4R9F A;  5I56 A;  4GWW A;  4NED A;  3M3K A;  2NXO A;  1M5F A;  3KC0 A;  1OIB A;  4YU0 A;  4F3G A;  1SW1 A;  2ZZV A;  5I56 B;  2OZZ A;  2P1S A;  5HPQ A;  4IO7 A;  2I48 A;  4YMB A;  1XT8 A;  1BP5 A;  3SKP A;  1MY2 A;  2REJ A;  4JVD A;  5JK4 A;  1B4Z A;  1FPB A;  3KN3 A;  4ELO A;  4L17 A;  4THI A;  5IZ3 A;  4MJO A;  1FSA A;  4RK2 A;  1AOV A;  5IZ3 B;  4G8N A;  1MPC A;  1JW1 A;  4P47 A;  3T66 A;  2WYK A;  5H8F A;  1MXZ A;  4NF0 A;  3MVZ A;  4JVI A;  4OEN A;  4RPO A;  4P56 A;  3LUZ A;  3H7M A;  3GLB A;  3G3K A;  1NNT A;  3BBR A;  3CIJ A;  1NV0 A;  3FXB A;  2P2A A;  3MVY A;  5EHM A;  2QVU A;  2E1S A;  3IB1 A;  4OWD A;  4U4S A;  5J16 A;  1I69 A;  3I5O A;  2HAV A;  3P7I A;  1P1W A;  2F6G A;  2D5W A;  5EQA A;  1WDN A;  1USY H;  2DOJ A;  4NTL A;  4GD5 A;  1MG1 A;  4H65 A;  2O7I A;  4P9K A;  1A8F A;  1D4N A;  4QSD A;  3N94 A;  4F19 A;  2CZI A;  2ZYK A;  3TTM A;  5I59 A;  1MM6 A;  2Y7P A;  2V3Q A;  4MAG A;  2BJJ X;  3O97 A;  1IMB A;  5I59 B;  3BFU A;  4N4U A;  2F36 A;  4MX6 A;  2GRV A;  5B70 A;  3MUQ A;  3CI8 A;  4OQO A;  1M5D A;  1SVX B;  2KR0 A;  2HXW A;  1LST A;  3QYT A;  5I3S A;  4LON B;  2JJK A;  2VD2 A;  4G61 A;  1A55 A;  2XXW A;  3R26 A;  2OX3 A;  3TDJ A;  3BIG A;  2FBP A;  4KPT A;  3PUY E;  1N76 A;  2FNC A;  2Y7K A;  4XXU A;  3QIM A;  4WEP A;  4PC9 A;  4QSE A;  3TCH A;  3G3J A;  1PBP A;  3TMG A;  4NF5 A;  4UAB A;  1B58 A;  3B8B A;  3B50 A;  4GWX A;  3MST A;  4NF6 A;  1FBP A;  4KFQ A;  4FEC A;  4NF5 B;  4G68 A;  3EPE A;  4NF6 B;  1VE4 A;  5A5X A;  2I3W A;  1MXU A;  4G68 B;  2NWJ A;  3EQ1 A;  3IL1 B;  3IB2 A;  5A5X B;  1TFA A;  4M4G A;  2I4C A;  3EHT A;  4H0W A;  3K0V A;  4NMY A;  3GBB A;  4RJZ A;  4X1D A;  1LBB A;  3PMX A;  3IB0 A;  3DP4 A;  1MM7 A;  4GX6 A;  3KJT A;  3EKI A;  3IJX B;  5ESY A;  5I2N A;  1XOC A;  4N15 A;  5I2K B;  3OSQ A;  4KYD A;  5I2N B;  1EYJ A;  1ZKB A;  4GWS A;  5F24 A;  1JW5 A;  1RDY A;  1FBE A;  1FBF A;  5DT6 A;  4BDL A;  2H99 A;  4FEB A;  2FA7 A;  3VVD A;  5HM4 B;  5H8N A;  2OWT A;  3U92 A;  4MH5 A;  2Z8E A;  1B05 A;  1FJ6 A;  1QGX A;  1GV8 A;  2GFE A;  2DYX A;  4XF5 A;  3CR9 A;  3QK6 A;  3LSX A;  1NV3 A;  4EQ9 A;  2DSF A;  4JVC A;  3DEL B;  3OO6 A;  5H8S A;  4PDH A;  1R9Q A;  1LAX A;  1II5 A;  1OVB A;  3OEN A;  1LBW A;  3FD3 A;  4Z0I A;  1IIT A;  4R9G A;  4EQB A;  2FVZ A;  1S50 A;  1PEB A;  4PQJ A;  1URD A;  2G93 A;  4P1L A;  3RT8 A;  1EZ9 A;  4F1Y A;  1G0I A;  1S9T A;  3OEM A;  2DE2 A;  4OVT A;  4U2R A;  3UGW A;  3IX1 A;  1S7Y A;  1FPE A;  4FBP A;  3GBA A;  3K6U A;  3U72 A;  2XXP A;  4ELR A;  1B5H A;  3RNN A;  3VXC A;  2QMW A;  3OSR A;  3EN3 A;  2HCA A;  1B6H A;  4R74 A;  2X7Q A;  3H6T A;  3K00 A;  2XHD A;  3G3I A;  1B46 A;  4QFP A;  1B3E A;  3O2A A;  4X9T A;  2H5Y A;  2XXH A;  2F6P A;  5ITO A;  2CZK A;  5FHM A;  3LC8 A;  1US4 A;  4PFB A;  1URG A;  4H67 A;  3FAT A;  2OWZ A;  2XX7 A;  3G3G A;  3M3L A;  4RXL A;  3PTY A;  1B9J A;  3ILU B;  4OEV A;  1SW4 A;  4C1T A;  4LN5 A;  3QXM A;  3FXQ A;  4QFO A;  4M1V A;  4RY1 A;  2ESN A;  2D21 A;  3CFZ A;  3ZKK A;  1YAE A;  2GHB A;  2B3B A;  4F3B A;  5EQ7 A;  4F39 A;  2DXY A;  4YKJ A;  2QPQ A;  5H8H B;  1Y4T A;  4JWX A;  3OXN A;  5L9M A;  4EXK A;  4MNC A;  3W9V A;  3U93 A;  2YPN A;  3HO7 A;  1UIU A;  1N3W A;  5KCJ A;  3FV1 A;  4WKM A;  3TEP A;  2DWH A;  5KCJ B;  4R72 A;  1EH3 A;  4JDF A;  1NH8 A;  4N07 A;  4BDR A;  1ZTY A;  2Z8D A;  1RDZ A;  1YXI A;  4HXV A;  4QFL A;  4DCY A;  3V5A A;  3TCG A;  1LB8 A;  4R2F A;  4JB7 A;  4NG7 A;  1VR5 A;  2OLB A;  3C34 A;  3KZG A;  3S9N C;  1MY1 A;  4PFT A;  1H76 A;  4O7M A;  4WXJ A;  5AA3 A;  1M5B A;  1SI1 A;  4XKR A;  4OAN A;  4FOR A;  4LVQ A;  1N0T A;  4XTC Q;  2QMX A;  4YB5 A;  2XA5 A;  5FHN A;  1BK4 A;  3K4U A;  5CBS A;  5DYH A;  1PB9 A;  4F2Q A;  2VPN A;  1HSJ A;  3OD7 A;  3HST A;  3G3F A;  3N6T A;  3ISP A;  1A40 A;  3R6U A;  5HBC A;  3KOS A;  1N04 A;  4X1B A;  1FPI A;  5T3J A;  1DPE A;  1D9V A;  3A09 A;  4O3B A;  4GRK A;  3CVG A;  4GQO A;  1Y4C A;  4G8M A;  3O9P A;  4C1U A;  4ZE8 A;  3A3C A;  3O6G A;  4R2B A;  3M3F A;  4OVJ A;  4PFI A;  3T9U A;  2LAO A;  1D3K A;  4R6K A;  3TCF A;  3NOH A;  3OMB A;  3MVW A;  4PE5 B;  2R8T A;  4I1D A;  2Z8F A;  1ANF A;  5JTY A;  1B1X A;  1NUY A;  2HXR A;  1DPP A;  2UVI A;  5JTY B;  2RKM A;  3D1R A;  3ODB A;  1QUI A;  4H8J A;  4PAK A;  2AYS A;  4AB5 A;  2VGQ A;  4PGN A;  1O64 A;  5FTH A;  2V3U A;  1FQC A;  3MZ1 A;  4OVQ A;  1ZU0 A;  5DVJ A;  5A5L A;  3FAS A;  5IM2 A;  2GQ1 A;  1LFI A;  4ZZE A;  4I3Y A;  4DXB A;  3ROJ A;  2I4B A;  3OO8 A;  2XWK A;  2Y5K A;  2CZL A;  2O1M A;  1LBZ A;  3GZG A;  2F3B A;  4G2Z A;  1NL5 A;  2PX1 A;  3C4M A;  4EQ7 A;  1YYZ A;  4ONY A;  1POY 1;  3PMW A;  3MQ9 A;  3VVE A;  2ZZX A;  1K9Y A;  1MQD A;  2O84 X;  4P1E A;  2HPG A;  2H98 A;  4KQP A;  3T96 B;  3VLU A;  1MDQ A;  2HFB A;  3KFM A;  2XXT A;  1H3D A;  3TPA A;  2H25 A;  3PU5 A;  4LUB A;  2YJP A;  1RYX A;  2PVU A;  2ZMB A;  2DVZ A;  3H3G A;  4GIZ A;  4YMA A;  1LAH E;  1ZBM A;  3A3U A;  3T22 A;  1FQF A;  4OET A;  3H03 A;  3D4G A;  4GX4 A;  1PBQ A;  1QJM A;  2UVH A;  2HAU A;  3H6V A;  1PC3 A;  4DXU A;  1FQB A;  2V4C A;  1FTA A;  2ZZW A;  4PF8 A;  1IZ1 A;  3K6X A;  1P1Q A;  3C32 A;  2PBW A;  5AE4 A;  1LAG E;  3KBR A;  3Q27 A;  4H5G A;  1MQI A;  5FTI A;  4H8I A;  4QRZ A;  1XHY A;  1B3H A;  3S9L C;  5I5P A;  2ZYO A;  1SYI A;  1P99 A;  1G0H A;  5H8F B;  1B5I A;  1J1N A;  3KSJ A;  4IO5 A;  1D9Q A;  3B7D A;  4N6K A;  1NV2 A;  3K2D A;  1L5T A;  5CRY A;  3TYH A;  2DWJ A;  2ZYN A;  4QXD A;  1XC1 A;  3IFC A;  5EHS A;  1XI6 A;  4U1Z A;  3RTF B;  4PDD A;  1NMU A;  2GH9 A;  4EUO A;  4PFW A;  4PBQ A;  2Q8J A;  1FCK A;  1DBZ A;  1MH4 A;  1VFD A;  5IZ1 A;  3O66 A;  4R6Y A;  2Z23 A;  1LAF E;  1FW0 A;  1BLF A;  1ZJL A;  4U22 A;  4LZ8 A;  4NAP A;  1Y3P A;  2IEE A;  1SD3 A;  1YPN A;  1LBX A;  3M8U A;  2B65 A;  4OEU A;  1MY4 A;  2RC9 A;  2ONR A;  4KD5 A;  3V89 B;  4LZ7 A;  2Q2C A;  4ND9 A;  3Q26 A;  1QUK A;  2ONS A;  2QS4 A;  3MPL A;  4IO4 A;  1F9B A;  4F31 B;  4Q5T A;  1FQE A;  4LAT A;  3TQL A;  5LDZ A;  3OO9 A;  3N26 A;  1CB6 A;  4LA9 A;  2XXY A;  4G8H A;  4DDD A;  4MBP A;  3LR1 A;  2X26 A;  1XS5 A;  3C35 A;  4YZZ A;  2Y5L A;  3PUW E;  4IY5 A;  3U65 A;  4OHN A;  1QUJ A;  3RLF E;  4PTK A;  3OEK A;  1DTG A;  3K6V A;  4MNI A;  3ONM A;  2AIX A;  4OVS A;  1SBP A;  2A5T A;  4IB2 A;  3H6U A;  3I6V A;  2OCU A;  2P3N A;  2R71 A;  2YLN A;  2RC8 A;  3IAZ A;  4POX A;  5IZZ A;  3MZ9 A;  1O63 A;  2B3F A;  2WYP A;  4FE8 A;  3SEX A;  1DSN A;  4LZ5 A;  1N3X A;  5TP9 A;  5IKB A;  2ALU A;  2OPD A;  3SEW A;  5LTC A;  5H8Q A;  4GWU A;  3HHF A;  3KSX A;  3CFX A;  3HHG A;  3QAX A;  3VLV A;  3IO4 A;  4G68 C;  1I6A A;  4OES A;  4N6D A;  4ESW A;  3A29 A;  3ECR A;  1H45 A;  4I8C A;  4MNP A;  1OLC A;  3TTN A;  2F3D A;  4QFN A;  3IK6 B;  4I3E A;  1RYO A;  5CBR A;  3EHU A;  3TTR A;  1KWH A;  2REG A;  3SDF A;  3S9E A;  4XKQ A;  5H8N B;  4ZEK A;  1VDW A;  3S9M C;  1LEV A;  1YZ0 A;  3KG2 A;  1MXX A;  1IEJ A;  4BDO A;  2WKY A;  3CSG A;  4MLV A;  3T9X B;  3PPQ A;  3Q29 A;  4G77 A;  4GL8 A;  3SEV A;  3HN0 A;  2DWI A;  1GVC A;  2FHY A;  1JNF A;  4PFU A;  3MPK A;  3T0J A;  2F8D A;  3RT6 B;  1Y1Z A;  1YTV A;  3H06 B;  4NF8 A;  3TZA A;  3U1O A;  4GFR A;  3AXF A;  1OQG A;  1Y9U A;  2F7A A;  4NF8 B;  3FXR A;  1B5J A;  4XFE A;  3SES A;  3G3H A;  4IGR A;  3E4R A;  4DI3 D;  5I58 A;  3QSL A;  2WX9 A;  1NV6 A;  4AS4 A;  3PPN A;  5I58 B;  2HZK A;  1QKA A;  1EYK A;  3TFL A;  1TFD A;  1NUX A;  1A7L A;  1ATG A;  5EYG A;  4ZEI A;  2KQZ A;  1IUD A;  3VXB A;  4XEQ A;  1JEU A;  4PAF A;  5J1D A;  5ET5 A;  4RA1 A;  4LQ2 A;  3FVN A;  2DXR A;  3FVO A;  3FIR A;  2ZNU A;  2FIX A;  1IMD A;  3QMF A;  2XX9 A;  1Y3N A;  4YAH X;  4F2O A;  1P1U A;  3JYR A;  4OTE A;  4ECF A;  1LGB C;  4OFJ A;  4IGT A;  1BTJ A;  2NUV A;  2I49 A;  1UIV A;  3MWB A;  3H6W A;  4MF3 A;  3EHS A;  1HSL A;  5BUU A;  4EXL A;  1EU8 A;  1UQW A;  1LB9 A;  4ISU A;  3DLN A;  4Q0C A;  4N91 A;  4X48 A;  1FPF A;  1NV4 A;  2Y7I A;  2V3T A;  4WED A;  3TKD A;  3N6U A;  4U1O A;  3ZSF A;  4PFY A;  2XWI A;  4MLQ A;  1AH5 A;  1AIV A;  1GGG A;  1Q35 A;  4GOT A;  1ZMG A;  1YCJ A;  1I6Q A;  1IMA A;  1VSO A;  4PFR A;  4HE0 A;  2D3I A;  5L9S A;  4BDM A;  1NH7 A;  4MFI A;  4NWC A;  4IR8 A;  3TTK A;  2ANJ A;  2Q2A A;  5ET8 A;  2L5V A;  1MXW A;  1FTL A;  3SZP A;  4OFL A;  1UTH A;  5EQ9 A;  2O1L A;  2P0S A;  4GL0 A;  1TT1 A;  2R9J A;  3V83 A;  1LBC A;  4FJP A;  2KLF A;  4O3A A;  2RC7 A;  5AA2 A;  4FIM A;  4HCY A;  2UXA A;  1NFT A;  1QKB A;  1Q1K A;  1EZO A;  5AA2 B;  1DTZ A;  1B1H A;  3PUZ E;  4HTG A;  4KR5 A;  1NV1 A;  1LLS A;  2BJI A;  1LCF A;  1FQA A;  2WBD A;  2XXK A;  3HV1 A;  3B6W A;  3H4Z A;  5ET7 A;  1B51 A;  4N17 A;  1FQD A;  1LFG A;  4GBV A;  4RNS A;  3PD8 A;  3TOD A;  2OJT A;  2OPE A;  3O6I A;  1MY3 A;  1XVX A;  3CSB A;  1O7T A;  3UOR A;  2PMS A;  1N84 A;  5B7D A;  1B3G A;  1MPB A;  4IY6 A;  3MP6 A;  4O94 A;  1INP A;  1OVT A;  3D4C A;  1B4H A;  2Q88 A;  4JSO A;  2DE3 A;  2V25 A;  4EF2 A;  3SEY A;  2XXV A;  3E13 X;  4GVO A;  2A5S A;  3LBS A;  1B3L A;  1RDX A;  5TU0 A;  4ZEC A;  1SW2 A;  1Y20 A;  4NHB A;  1Y3Q A;  2DWA A;  3K02 A;  2XXQ A;  2XX8 A;  1B0L A;  4X04 A;  1N7W A;  3B6T A;  3IOV A;  2F97 A;  1Y1M A;  2GHA A;  4N8G A;  3G7W A;  3IJO B;  1IXI A;  4ZEF A;  3TTL A;  4ZDM A;  4JWO A;  1MS7 A;  3OO7 A; 
#chains in the Genus database with same CATH homology
 2MKZ A;  2VT5 A;  4PDD A;  1RDY A;  3KC1 A;  1FBE A;  1K9Z A;  4MHF A;  1FBF A;  4OVP A;  4PBQ A;  4HCW A;  1DBZ A;  4H46 A;  5IZ1 A;  1FJ6 A;  1QGX A;  4HE1 A;  1KA1 A;  4NAP A;  4NN3 A;  2PCR A;  4XF5 A;  4NX1 A;  1LBX A;  1JP4 A;  3RYD A;  5I7I A;  1NV3 A;  1AWB A;  4JVC A;  1NV7 A;  4PDH A;  4X8R A;  1LBW A;  1DCU A;  5LDZ A;  1FPJ A;  2QVV A;  1FBC A;  2FVZ A;  4N8Y A;  2DE4 A;  2WBB A;  5ET6 A;  1NUZ A;  4P1L A;  4YZZ A;  4PCD A;  1G0I A;  2Y5L A;  2CEX A;  2DE2 A;  4OVT A;  4P8B A;  1LBY A;  3U65 A;  1FPE A;  4FBP A;  4PTK A;  4OVR A;  2QVR A;  3HFU A;  4MNI A;  4GWY A;  2XWO A;  2CEY A;  4PF6 A;  1SPI A;  4MIJ A;  2Q9T A;  4OVS A;  4MCO A;  2DDK A;  2P3N A;  1NV5 A;  4GX3 A;  2Q8M A;  4X9T A;  5FBP A;  2F5X A;  4DI4 B;  5IZZ A;  3W9W A;  2WYP A;  2CZK A;  1IME A;  4KXP A;  4PFB A;  2OWZ A;  4O8M A;  2PFY A;  3PTY A;  4OA4 A;  3BIH A;  3LV0 A;  4NQ8 A;  5LTC A;  4GWU A;  4LN5 A;  2HZL A;  1FRP A;  2QFL A;  2PFZ A;  4M1V A;  4F18 A;  4N6D A;  3IFA A;  3A29 A;  4F1V A;  4MNP A;  2F3D A;  4PBH A;  5EQ7 A;  2B4L A;  4I3E A;  1Q9D A;  2QPQ A;  2P3V A;  2VPO A;  4MNC A;  3W9V A;  4F1U A;  1VDW A;  4QBA A;  4HE2 A;  1FJ9 A;  4MMP A;  1LEV A;  1YZ0 A;  5CM6 A;  3E79 A;  1NI9 A;  4I40 A;  5EYH A;  2FIE A;  1KA0 A;  1RDZ A;  1YXI A;  4HXV A;  2FHY A;  3T0J A;  4NG7 A;  1FBH A;  3MYU A;  4GWZ A;  4O7M A;  1IMC A;  1IMF A;  1DK4 A;  4XFE A;  4OAN A;  1NUW A;  4DI3 D;  3FBP A;  4YIC A;  4GWW A;  2WX9 A;  1NV6 A;  4AS5 A;  4AS4 A;  2XA5 A;  3KC0 A;  2HZK A;  1BK4 A;  2ZZV A;  1EYK A;  1NUX A;  1LBV A;  2VPN A;  4JVD A;  4H45 A;  3E78 A;  1FPG A;  5EYG A;  2KQZ A;  3ISP A;  4N81 A;  5JK4 A;  4XEQ A;  3CHG A;  1KZ8 A;  3GYY A;  4PAF A;  5J1D A;  5ET5 A;  1FPB A;  2WEF A;  2B4M A;  1FPI A;  5T3J A;  4GBW A;  4PAI A;  2FIX A;  5IZ3 A;  1IMD A;  3QMF A;  4MJO A;  1FSA A;  5IZ3 B;  4PE3 A;  4P47 A;  4PFI A;  2WYK A;  2XWV A;  5IGA A;  4NF0 A;  4JVI A;  3NOH A;  4N91 A;  1FPF A;  1NV4 A;  4P56 A;  3LUZ A;  4PGP A;  1EYI A;  4P3L A;  1FBG A;  2R8T A;  2XWI A;  1NV0 A;  3FXB A;  1NUY A;  2HXR A;  2QVU A;  1IMA A;  5J16 A;  4PFR A;  4HE0 A;  3D1R A;  4NGU A;  4IR8 A;  4PAK A;  5EQA A;  5ET8 A;  2L5V A;  1FBD A;  3SZP A;  5DW8 A;  5EQ9 A;  4PGN A;  2CZH A;  4P9K A;  4MEV A;  4F19 A;  4OVQ A;  5A5L A;  2CZI A;  5IM2 A;  5EQ8 A;  2GQ1 A;  4I3Y A;  1FPL A;  3ROJ A;  2XWK A;  3KBZ A;  2Y5K A;  2V3Q A;  4MAG A;  1LBZ A;  4HCY A;  1IMB A;  4N4U A;  2F3B A;  4MX6 A;  1YYZ A;  2ZZX A;  1NV1 A;  1K9Y A;  4P1E A;  2HPG A;  2BJI A;  4O7I A;  2WBD A;  1FPK A;  2KR0 A;  2XXK A;  5I3S A;  5ET7 A;  4N17 A;  2JJK A;  4G61 A;  4GBV A;  2OX3 A;  3BIG A;  2FBP A;  1CNQ A;  4PET A;  2Q74 A;  3RPL A;  2DVZ A;  4PC9 A;  1FPD A;  4O94 A;  1INP A;  4UAB A;  3RPL B;  3B8B A;  3B50 A;  4GWX A;  3MST A;  1FBP A;  4GX4 A;  2DE3 A;  2V4C A;  1FTA A;  2ZZW A;  4PF8 A;  1RDX A;  3T1B A;  4NHB A;  5I5P A;  1G0H A;  4GX6 A;  4X04 A;  3EKI A;  5ESY A;  1D9Q A;  4N8G A;  4N6K A;  1NV2 A;  4N15 A;  2HHM A;  4QXD A;  1EYJ A;  4GWS A;  3IFC A;  5F24 A;  1XI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...