4MJOA

Human liver fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate, 1-phosphohydrolase) (e.c.3.1.3.11) complexed with the allosteric inhibitor 3
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Determination of protein-ligand binding constants of a cooperatively regulated tetrameric enzyme using electrospray mass spectrometry.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 104
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4mjoA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mjoA02
5F24A 4AS5A 2PCRA 3RPLA 1KA0A 5EQAA 2QVUA 4QXDA 1FBPA 1NV1A 2JJKA 3LV0A 1NV3A 4I40A 1FBFA 2R8TA 4GWSA 5IZ1A 4PTKA 1NUXA 2DDKA 2GQ1A 1SPIA 4HE0A 1G0IA 1RDZA 1Q9DA 1DBZA 1FBCA 1NV7A 5ESYA 1FPLA 1IMAA 3B8BA 1FJ6A 2QVRA 1LBXA 1LBZA 1FBDA 1FRPA 3IFCA 1JP4A 2Y5LA 2Y5KA 3RYDA 3FBPA 1NI9A 2FBPA 5EQ7A 1IMEA 2F3BA 1FBEA 5FBPA 1FBGA 2Q74A 4GBWA 1FPBA 1IMBA 1EYJA 5EQ8A 3KC1A 4GWUA 4HE1A 3KBZA 4GWXA 2CZKA 1NV0A 5IZ3B 1IMDA 4GX4A 4N81A 1FPIA 1INPA 2VT5A 2FIXA 4KXPA 1FPDA 2FIEA 3A29A 2CZHA 3KC0A 5EYGA 1D9QA 3QMFA 1EYIA 1NV2A 1VDWA 5IZ3A 2QVVA 5T3JA 3IFAA 1NUZA 1FPJA 1LBYA 1LEVA 4HXVA 1LBVA 5LDZA 1DCUA 2CZIA 1RDXA 2QFLA 5ET8A 1NV6A 1KZ8A 1FPKA 4IR8A 2OWZA 1G0HA 3LUZA 1FPEA 2FVZA 5I3SA 1EYKA 5ET5A 1NV5A 1FSAA 1YZ0A 4I3EA 4G61A 4GBVA 1FJ9A 4H45A 2P3VA 4I3YA 1FTAA 1YYZA 1BK4A 1IMFA 1NV4A 1QGXA 2WBBA 1K9YA 1AWBA 4O7IA 5EYHA 4AS4A 4HE2A 1XI6A 5ET6A 5J16A 4GWWA 5EQ9A 1NUWA 4MJOA 2WBDA 3BIHA 3D1RA 2OX3A 4GWYA 5ET7A 1NUYA 1KA1A 2HHMA 1K9ZA 4FBPA 2P3NA 1LBWA 3T0JA 4GX3A 5A5LA 1DK4A 1YXIA 1IMCA 2WEFA 4H46A 1CNQA 3RPLB 3BIGA 5DW8A 1RDYA 4GX6A 2BJIA 3ROJA 2F3DA 1FBHA 2Q8MA 1FPFA 4GWZA 2FHYA 1FPGA
chains in the Genus database with same CATH superfamily
3OMBA 5EQAA 3HHFA 4PFBA 1NV1A 3LV0A 5H8HB 4GWSA 4OVPA 1FTKA 2DXRA 4PQJA 1RDZA 1SDXA 2HZKA 2PFYA 4OFOA 2ONRA 4KYEA 2Q8JA 5I7IA 2Y5LA 4RNSA 1H44A 4NWDA 5LTCA 1Q1KA 5DYHA 1LAGE 5EHMA 4MIJA 4JVIA 3W9VA 2Z23A 4F18A 4X48A 2Q88A 2QS2A 3FIRA 1IXHA 4X9TA 3O6GA 3UIFA 4QHQA 5H8HA 5CBSA 4TOZA 1FQFA 4MMPA 1H76A 3B6WA 2VPNA 5JEIA 1FTJA 1LGBC 3K6XA 4JVDA 1NH8A 1NV4A 2WBBA 1URSA 3PUXE 3GBAA 3OXNA 4Q5TA 2H5YA 2D3IA 4N6KA 4GWYA 5ET7A 2XX8A 4O7MA 4MX6A 4WKMA 4U4SA 4H5FA 1LB9A 2FYIA 4G77A 1FBHA 1NNTA 1GV8A 3LSWA 3IJOB 3QSLA 3K6UA 5FHMA 2PCRA 4FE8A 1JW5A 4PF8A 3ODBA 1FBPA 2I3WA 1MG1A 1LB8A 2YPNA 1GR2A 1T0KA 1XOCA 2REGA 1NV7A 5ESYA 1MXZA 3B8BA 5AA4B 3SZPA 1LBXA 3N5LA 3IFCA 2O7IA 1MQIA 2ZXTA 1WDNA 2VHAA 4OHNA 4BDRA 4MLQA 4NTLA 4ZE9A 3PPOA 4YB7A 4QBAA 4R74A 5IM2A 3SKPA 4N07A 4ELOA 4N17A 1POTA 4O3AA 3KOTA 4FEBA 3IB1A 1ZLQA 4X04A 1US5A 1LBVA 4QSCA 4WEPA 4EF2A 4RPOA 3UK4A 2E0SA 1NV5A 4GXAA 1MXWA 3RUMA 2OWSA 1Q35A 2PMSA 4LUBA 4OQOA 4AS4A 1OLAA 3I5OA 2F6PA 4GWWA 4GRKA 3SDFA 2F78A 3MQ9A 4ZDMA 3G3GA 2XXWA 2ALUA 4MF3A 4LP2B 3O97A 1RYOA 4OYVA 2Q8MA 1A99A 5M2VA 5TU0A 1B2HA 4ZEDA 3GLBA 4RYAA 1ZIUA 3OO6A 1R9LA 1XS5A 4PBHA 3QIMA 2GQ1A 1PB7A 3OD7A 4PETA 2VGQA 1B5IA 1FTOA 2QS1A 5HBCA 1B9JA 4DXUA 1P1NA 2Y5KA 1NI9A 5EQ7A 3T96B 3IB2A 3SEWA 2Q74A 1Y1MA 1S7YA 2I48A 5H8QA 1RKMA 4Q30B 4NHBA 1B7HA 3IX1A 3DP4A 2Y7PA 3EKIA 2F6GA 2H25A 3JV9A 1NMUA 4ZECA 1NV2A 1IXCA 4LN5A 2OPEA 3OSRA 2PVUA 2I0CA 4K3FA 5CMKA 1DCUA 4NF8A 4PFIA 4PAKA 1FPKA 2AYSA 4IR8A 2OWZA 3LUZA 1FPEA 5I3SA 4I3YA 3Q29A 1FTAA 4IO7A 1Y4CA 3FZVA 1ZTYA 4O7IA 1N76A 4M1VA 1M5BA 4JBZA 4MNIA 4PDHA 4U21A 4F1VA 5CRYA 4GX3A 5KCJB 3IK6B 5F1QA 2DSFA 4F29A 3S9MC 3MVXA 4OFLA 3CI8A 4U23A 4PGPA 1YCJA 1DPPA 1LLSA 4IO4A 4XKPA 1B3LA 4WEDA 1IXGA 2JJKA 2BJJX 3VV5A 1N04A 4KCCA 3MZ9A 1MXVA 3K1PA 2XXQA 4ZEIA 3O28A 4HE0A 2ZYMA 2ZZVA 3MPLA 2RF1A 3LC8A 3HPIA 4U2RA 3TTRA 1P99A 3S9NC 4N8YA 4JWXA 1IMEA 5KCJA 1AH5A 2YLNA 4NN3A 3Q28A 3G3FA 4PF6A 3TQLA 4XFEA 4EXLA 1Z7NE 2XXRA 1BLFA 3NOHA 3PPQA 4F1YA 3FVOA 1FQCA 4NF6A 2A5SA 1OQGA 1Y3QA 4YB5A 5K2XA 4FJPA 3S9LC 3IFAA 3D4CA 1FQDA 1LBYA 2F8DA 1QJMA 4ELRA 1MS7A 1NV6A 4RY1A 1US4A 3OO9A 4NF5B 1B3EA 5H8FB 4P3LA 1IEJA 1DTGA 2V3TA 1FSAA 2QPQA 4G61A 4PC9A 1B7ZA 2P3VA 2XXKA 3M3FA 2NUVA 4GXSB 1FQBA 3RLFE 3BIHA 3N94A 4MFIA 3C4MA 3VXCA 3PD8A 1IUDA 2DOJA 4FBPA 1SYIA 1TFAA 3IAZA 1DK4A 1B5JA 1IMCA 1JVXA 2F3DA 5I57B 4NF5A 3RTFB 2QMXA 2FHYA 2XX7A 3T22A 4RJZA 1SVXB 1NNPA 4YMBA 1JQFA 1ZMGA 2XXXA 3VVDA 4NWCA 1BIYA 5IZZA 2QVUA 2DWAA 2Y7RA 1QUIA 4P1LA 3UORA 1B46A 1NH7A 2HEUA 3MZBA 3OEKA 1Q9DA 3H03A 3I6VA 4YZZA 3E3KA 2ZYKA 4ELQA 1FRPA 2A5TB 3FJ7A 3PUYE 4Q8RA 3MZ1A 4YKPA 4OEVA 3O9PA 3QUFA 4Q0CA 2OPDA 1XHYA 5I57A 1QVSA 3U92A 4GX4A 2X26A 2L5VA 3TTKA 3TODA 4OESA 1MH3A 5EYGA 1D9QA 4F1UA 1EYIA 5IZ3A 2V3QA 4OMBA 2OZZA 3LSLA 4NF4B 4QFLA 1NUZA 1FPJA 1URDA 4HXVA 1XVXA 4GVOA 1Y3PA 3RNNA 4R73A 1QW0A 3H6TA 4GBVA 1EZ9A 2DWJA 4NX1A 5I2NB 1BK4A 4O94A 4N4UA 3SERA 5TPAA 1H45A 5CM6A 2ABHA 3FXRA 2GHAA 2Y7KA 2H9BA 2CZLA 2IA4A 2GRVA 1TFDA 4C1UA 1K9ZA 4H6DA 2Y84A 5J1DA 3A3CA 5A5LA 2I4CA 4R75A 4HCWA 4KFQA 4OVJA 1EU8A 2F35A 4G8HA 1NL5A 4KPTA 3G3HA 2KLFA 3RN8A 3RQTA 3FXUA 3CFXA 3PUVE 3ZKKA 4YKKA 2VP1A 1FTLA 3A3UA 3HN0A 1FTMA 3N26A 2Y7WA 3OOAA 4KYDA 3FJGA 4PCDA 1N7WA 3RYDA 1IITA 4UACA 4QRZA 4P9KA 4GBWA 1B51A 1LFHA 1NNKA 3QYTA 3OO8A 3PPRA 4GIZA 1MPDA 1PB9A 3VE1B 2FIXA 2UVJA 4EXKA 4X8RA 3MP6A 4PFWA 1ATGA 1LCFA 1WODA 1HSEA 4F3GA 4IB2A 3R6UA 4IO3A 2RC9A 1RDXA 2ZZWA 4NF0A 3B50A 3FV1A 3M8UA 3DP8A 3IOUA 1LFIA 5ITPA 1OVTA 3K6VA 1URGA 4AQ4A 1AL3A 1N7XA 4I3EA 4BDMA 1QGXA 1YTVA 2V25A 1PB8A 4ELPA 1USYE 3EF7A 1B40A 4X1BA 4IO2A 2H99A 1IXIA 4N15A 1B05A 3U72A 4DCYA 4ZZEA 1LFGA 2XA5A 3K2DA 3KSJA 2F36A 4P56A 1ZBMA 2XWIA 4MLVA 1LAHE 2I4BA 1N84A 2KR0A 4R9GA 4I8CA 1USYH 2X7QA 2R6GE 2DQVA 1SI0A 3IR1A 1MQDA 4QXDA 3O66A 4MAGA 5DTBA 3C35A 1VFDA 4FATA 3TCFA 3FVKA 3T9HB 2RCBA 2HAVA 1MPBA 4JDFA 4PBQA 2UVGA 5FBPA 5KZTA 1H43A 1FPBA 2E1SA 3C36A 4XKRA 3KGCA 2VPOA 2XXUA 3H06B 4DDDA 3O6HA 3FVNA 4RPNA 4OZ9A 4DIGA 3V83A 3QMFA 2FA7A 1Y20A 4GWOA 2WYKA 4PGNA 4EQ9A 4F2OA 2I6EA 2Z8DA 1TWYA 1B0HA 4NQ8A 4P8BA 3R7XA 2UVHA 1MY2A 1XC1A 1BKAA 2O1MA 3K00A 2ZNSA 1VFEA 1IMFA 2HZLA 3TFLA 3T9UA 5EYHA 3CG1A 1MM7A 4MJOA 3O6IA 1CE2A 4ISUA 1NUYA 1KA1A 1BP5A 4DE8A 3M3KA 4H46A 3SEXA 4OVRA 1O7TA 1MDP1 2Q89A 3FD3A 2NWJA 3FXBA 3N6TA 1B3FA 3PMWA 2AIXA 1NV3A 5HPQA 1PC3A 5CI5A 4PTKA 2DDKA 3MYUA 1Y4TA 4NEDA 5H8QB 4XKNA 1LBBA 3MVYA 3TCHA 3T1BA 3KN7A 4E0WA 1I69A 4BDQA 4I1DA 3TYHA 1EZPA 4OEUA 3K4UA 5FHNA 2Z8FA 3HO7A 5L8DA 1EH3A 3DP6A 1FPDA 2O51A 1KWHA 2F5XA 1NFTA 3LUYA 4NF8B 2O84X 4F3PA 4HW8A 3SETA 1SBPA 4JSDA 1MY3A 1H3DA 2R9JA 1SW1A 4ECFA 5AA2D 5LOMA 2Z22A 3K1MA 3B6TA 1YZ0A 4ZZAA 3VLVA 2V84A 3UN6A 4IY6A 4QSEA 1R9QA 4F2QA 1LAXA 2HXWA 2RCAA 3G3KA 3WAFA 3OEMA 4KQPA 2B4LA 2DVZA 5TP9B 1NUWA 2HFBA 3OSQA 3V89B 4DLDA 1I6QA 2AL4A 2DWHA 4U22A 4EQBA 3BBRA 1MXXA 3CSBA 1CNQA 2FNCA 1RDYA 3FXQA 4G68C 2KQZA 3TKDA 3L6HA 2WX9A 3H3GA 2PX1A 3EPEA 2IEEA 2GH9A 1A7LA 2D5WA 5BUUA 3ZS6A 4MBPA 3GBBA 4GLIA 4KD5A 4NAPA 4ZEBA 2VOZA 2XXHA 3B6QA 1QKAA 3TAJA 3Q26A 3O2AA 2DE2A 3H6VA 4G68A 1MQGA 5TP9A 3IOVA 4XEQA 4QFOA 3KN8A 1FBEA 2RC8A 2XWOA 4NF6B 1CB6A 2LAOA 2DP8A 3VDFA 4GWXA 3SEVA 5I2KA 4N81A 3E78A 4RK9A 2OLBA 3PV0E 1EZOA 4R6KA 4TLLB 2REJA 2NXOA 4QFNA 3TQWA 5LDZA 2I49A 1OMPA 3KJ7A 5ET8A 2OJTA 1HSJA 3S2VA 1PEBA 3GXAA 5ISUA 3TCGA 2OWTA 4YKIA 3TEPA 2UXAA 1MY1A 3TTLA 1O63A 4O3BA 3BFUA 4P1EA 3RY3A 4L17A 3VFJA 4H1XA 4BLAA 4JVCA 4U1ZA 1PBQA 4QF9A 3MP1A 4G8NA 3BIGA 4OFJA 2BJIA 5EHSA 2NOOA 3CR9A 3ILTB 4AB6A 5CMMA 4R2BA 2HCAA 5AE4A 1YPNA 3RPLA 5ITOA 1FW0A 5IKBA 4I40A 3SEYA 1NUXA 5IAIA 3C34A 3FV2A 3QXMA 1G0IA 2RINA 3C31A 1XT8A 2XXIA 3RGYA 1DMBA 1SYHA 4MNPA 5A5XB 1HSLA 3LSXA 5CC2A 1YAEA 5IZ3B 1IZ1A 4QFKA 4QSDA 3PU5A 2F7BA 2VT5A 2THIA 2CZHA 3KC0A 4YICA 4R72A 4C1TA 2QVVA 4E0XA 2OBGA 4HTGA 3PUWE 3VXBA 5I56A 2F7CA 5ELVA 1D4NA 1G0HA 1TT1A 3MAMA 4H8IA 5KDTB 5TPAB 1GGGA 5A5XA 2X7PA 4OA4A 4KHZE 4NMYA 2ZNUA 2DE3A 2GHBA 2XXPA 1XI6A 4PFRA 3DLNA 4PAFA 1OLCA 2O1LA 3T9VA 4M4GA 4DI4B 4F19A 5DEXB 1B3HA 2UYEA 4ZS9A 1B7UA 2I3VA 3EQ1A 1OQHA 2QMWA 3GZGA 3ONMA 4PP0A 5KDTA 4RA1A 3B7DA 5DT6A 1LSTA 3G3JA 1KA0A 3PPPA 3K01A 4F22A 4MCOA 4MNCA 1AIVA 4G4PA 4OENA 1JNFA 4G2ZA 5B70A 2F34A 2H98A 1DBZA 1NKXA 4DI3D 3P7IA 1M5FA 1B4HA 1LBCA 5DEXA 2ZNTA 4LONB 1M5EA 2FBPA 3A09A 1Y1ZA 2RC7A 4O3CA 3UP9A 1ZJLA 3KC1A 4BDNA 3KBZA 3THIA 4LQ2A 2WYPA 2F97A 1AOVA 3QK6A 4POXA 1FPIA 4OWDA 1VE4A 2FIEA 4N13A 4PFTA 2H4IA 2R71A 5CMCA 3IO4A 4PE5B 5FHOA 2CZIA 3TZAA 1MRPA 1D9VA 3BKIB 1KZ8A 1LAFE 3MUQA 3DM0A 3JYRA 2CEXA 4GL0A 3HFUA 1P1UA 4GOTA 5F7VA 5I59A 5HM4B 1VSOA 1N3XA 4H0WA 3TMGA 3VVEA 1MXYA 4TQUQ 4H65A 2CMOA 4OERA 4ESWA 2GFEA 1UTHB 4LVQA 2Q2AA 4FIMA 2ZYOA 3Q25A 4ND9A 1YXIA 2WEFA 1A54A 5DW8A 2Y7IA 3RTWB 2DWIA 1FPFA 4IGRA 1JEVA 5DVIA 3BFTA 4FECA 1MM6A 2M8CA 5FTIA 1NNFA 4EDPA 2R8TA 2XWVA 4KCDA 1B0LA 4GQOA 3ZSFA 2G29A 1UTHA 1FJ6A 1FBDA 3S4UA 2F3BA 2DVCA 1FBGA 2HXRA 3H7MA 2W7YA 3N6UA 4F3BA 2F7AA 4JWOA 3C33A 3OENA 3W9WA 4FORA 3KOSA 4LZ7A 4OETA 4DXCA 1LCTA 4R2FA 1OVBA 3KFMA 3DELB 1DTZA 4OXVA 3M3LA 4XKQA 3MPKA 1SI1A 3K0VA 4YU0A 3PUZE 2P1SA 3CFZA 3Q27A 2DE4A 1EYKA 2V93A 3E79A 2DS9A 5AA3A 4LA9A 3IL1B 1PBPA 3EHUA 4HE2A 5J16A 3C32A 1B32A 2OCUA 3D1RA 2OX3A 4YB6A 1DOTA 2DXYA 1S9TA 3KSXA 2HHMA 1LBWA 3T0JA 1B3GA 4N6PA 3MJNA 4FEDA 3W15C 3KG2A 3U8QA 1PDAA 3FJMA 1F9BA 4GF8A 4R6YA 2I58A 2Q2CA 5F24A 3MSTA 3SEUA 5IGAA 2V4CA 1FBFA 4I9DA 5IZ1A 2I0BA 1SPIA 2QSXA 1IMAA 3T66A 4RK2A 1L5TA 3KJTA 4R6HA 1M5CA 1P1OA 3U93A 5AA4A 3CIJA 5CMBA 3TELA 4GWUA 3HHGA 1JVYA 2XD2A 2CZKA 1MY0A 3E13X 4POWA 2QRYA 4IGTA 5AA1A 4X1DA 4U1OA 3O29A 4ZEFA 4GD5A 4IY5A 3IOTA 3TPAA 1QKBA 2HPGA 5EYFA 1LEVA 3PD9A 2ONSA 2QFLA 2XXTA 3I3VA 4U4XA 4JWYA 1B58A 3E4RA 2ONKE 5ET5A 3MVZA 1UIVA 3GYYA 2OK2A 1JW4A 2D21A 2PYYA 1K9YA 4H67A 4RXLA 4WXJA 5B7DA 3VVFA 5K2YA 1MXUA 2PFZA 1B6HA 4OVTA 1B4ZA 3FASA 4Z0IA 2ANJA 3H6UA 3ILUB 2VD2A 4JB7A 2MKZA 2UYFA 4NGUA 2QJEA 4QFPA 4JXIA 1FPGA 4G68B 4ZEKA 3PMXA 1MQJA 2UVIA 4PFUA 1WVJA 3LSFB 1ANFA 4MEVA 2PT1A 4OANA 4LZ8A 3IORA 4NG7A 1A55A 2P2AA 4LZ5A 1FBCA 2DYXA 3FGSA 4Z7EA 3ISPA 4YMAA 2QVRA 1GVCA 2P0SA 3FBPA 5I2KB 3CRBA 1I6BA 3U65A 3KEIA 3IB0A 1A8EA 1QULA 1R6ZA 1NV0A 3H6WA 2Z8EA 1UQWA 4P0IA 1INPA 2XX9A 4N8GA 4GFRA 5T3JA 4DXBA 3MWBA 4G8MA 4MHFA 4P11A 4R9FA 4DZ1A 2QS3A 1A40A 2ZMBA 2FVZA 5L9OA 4GL8A 3PPNA 3MBPA 3TUSA 3G7WA 5H8NB 3HV1A 4I62A 5ET6A 3OELA 3E9XA 4ESXA 4XIGQ 2WBDA 1JETA 3PGFA 4BDLA 3MVWA 5FTHA 1DSNA 3U94A 1MQHA 3PMVA 4OVSA 4MH5A 2G93A 3QUJA 3RPLB 4GX6A 3T9XB 2CEYA 5AA2B 1IQ7A 1SW2A 3FATA 1B1HA 3KZGA 1Y9UA 4F31B 3QAXA 1RYXA 1ZU0A 2AL5A 1VR5A 5H8NA 3IOWA 1OIBA 4IO5A 3D4GA 4IO6A 4P47A 4PDDA 3RT6B 3K02A 4NE4A 3U1OA 2B4MA 1I6AA 5L9MA 5L9SA 3MW0A 1ZKBA 1JP4A 2HAUA 4HCYA 5H8SA 2QS4A 4KR5A 3WAEA 3HCQA 1FCKA 2O7UA 1EYJA 5EQ8A 3RPWA 5AA2A 1UIUA 4HE1A 4XF5A 4EQ7A 1IMDA 4N91A 1AMFA 1N3WA 5BWJA 3A29A 3IO6A 4FAJA 5I56B 2QL3A 3MC2A 1P1QA 5I5PA 1B1XA 4F3SA 1ELJA 3HSTA 4O8MA 3MP8A 2Q9TA 1UTBB 4P0GA 3EHTA 1J1NA 2WKYA 1Z7ME 4N6DA 1D9YA 1SW5A 4PE3A 3V8XB 1YYZA 2VD3A 4EUOA 1N0TA 5ICQA 4LATA 2PT2A 5H8FA 3JZJA 4KYSA 3L6GA 1GTKA 1JW1A 5EQ9A 1Y3NA 3AXFA 3LBSA 1D3KA 3V5AA 1A8FA 3F11A 4PAIA 4THIA 3H4ZA 3LR1A 4OVQA 4H5GA 2NVUB 1MDQA 3FVGA 1UTBA 1BTJA 4GWZA 4H8JA 2B65A 4UABA 3T93B 4AS5A 3TTMA 1II5A 2V3UA 4YAHX 1XVYA 4PFYA 3CVGA 1R1NA 1QUJA 2O68A 1B52A 3FUZA 2ESNA 1MH4A 2RKMA 4DCXA 1IIWA 3VLUA 1FPLA 4AB5A 2ZZXA 5JTYB 3K6WA 1LBZA 5DVFA 4JSOA 4TLMB 5I58B 3VLWA 4EF1A 1IMBA 2A5TA 4ONYA 5ICTA 3CFLA 3CHGA 1SD3A 4KXPA 4BDOA 1SW4A 3UA8A 3K1NA 3RT8A 2XHDA 1B5HA 1SQYA 4UA8A 3USDA 4XXUA 2XD3A 3ZKLA 1VDWA 1DPEA 3EN3A 2B3BA 1P1WA 5DVJA 1S50A 3OO7A 4YKJA 2O6AA 1MPCA 4HS7A 3TDJA 5JTYA 5I59B 3SESA 4F39A 4NF4A 2XXYA 5I58A 2PBWA 3IJXB 1TXFA 1FJ9A 3ECRA 3C9HA 3PTYA 1FQEA 4H45A 3EHSA 1QUKA 4LQ5A 3TTNA 1AWBA 2YJPA 1M5DA 4KI0E 3R26A 5I2NA 2HQ0A 1MY4A 3CG3A 5JK4A 3CSGA 2ZYNA 2XXVA 3S9EA 4OTEA 1POY1 4C0RA 2B3FA 2O69A 2P3NA 2XWKA 3G3IA 5I84A 1JEUA 3ROJA 3KN3A 5CBRA 4ZE8A 3UGWA 1FQAA 3KBRA 1O64A 4XTCQ
chains in the Genus database with same CATH topology
5F24A 3MSTA 5IGAA 4NAPA 5EQAA 5IZZA 4PFBA 2QVUA 1NV1A 3LV0A 2V4CA 4P1LA 1FBFA 4GWSA 4OVPA 5IZ1A 2DE2A 1SPIA 1RDZA 1Q9DA 2HZKA 2PFYA 1IMAA 4YZZA 5I7IA 4XEQA 1FRPA 2Y5LA 5LTCA 1FBEA 2XWOA 4GWUA 4GWXA 2CZKA 4MIJA 4GX4A 4N81A 4JVIA 3W9VA 2L5VA 4F18A 3E78A 5EYGA 1D9QA 4X9TA 4F1UA 1EYIA 5IZ3A 2V3QA 1NUZA 2HPGA 1FPJA 1LEVA 4HXVA 5LDZA 2QFLA 5ET8A 4MMPA 2VPNA 5ET5A 4JVDA 4GBVA 3GYYA 4NX1A 1NV4A 1BK4A 4O94A 2WBBA 1K9YA 4N4UA 5CM6A 4P1EA 4N6KA 4GWYA 5ET7A 2PFZA 4OVTA 4O7MA 4MX6A 1K9ZA 4JVCA 5J1DA 5A5LA 3BIGA 4HCWA 2BJIA 1FBHA 2MKZA 4NGUA 1FPGA 2PCRA 3RPLA 4PF8A 1FBPA 4I40A 4MEVA 1NUXA 4OANA 1G0IA 4NG7A 1FBCA 1NV7A 5ESYA 3ISPA 3B8BA 2QVRA 3SZPA 1LBXA 3IFCA 4PCDA 3RYDA 3FBPA 4MNPA 4P9KA 4GBWA 3U65A 4QBAA 1NV0A 5IZ3B 5IM2A 1INPA 2VT5A 2FIXA 4N17A 2CZHA 3KC0A 4YICA 4N8GA 4X8RA 2QVVA 5T3JA 4MHFA 4X04A 1LBVA 2ZZWA 1RDXA 4NF0A 3B50A 1G0HA 2FVZA 1NV5A 4OA4A 4I3EA 1QGXA 2DE3A 4AS4A 1XI6A 5ET6A 4PFRA 4GWWA 4PAFA 2WBDA 4N15A 4DI4B 4F19A 2XA5A 4OVSA 3RPLB 4GX6A 4P56A 2CEYA 2XWIA 2Q8MA 2KR0A 1KA0A 4QXDA 4MAGA 4MCOA 4MNCA 4PBHA 4PDDA 2GQ1A 4P47A 4PETA 1DBZA 2B4MA 4DI3D 1JP4A 4HCYA 2Y5KA 4PBQA 1NI9A 2FBPA 5EQ7A 5FBPA 2Q74A 1FPBA 1EYJA 5EQ8A 4NHBA 3KC1A 4HE1A 3KBZA 4XF5A 2WYPA 1IMDA 4N91A 3EKIA 2VPOA 1FPIA 2FIEA 3A29A 3QMFA 1NV2A 4LN5A 5I5PA 2WYKA 4PGNA 1DCUA 4O8MA 2CZIA 4PFIA 4PAKA 1KZ8A 1FPKA 4NQ8A 4IR8A 2OWZA 4P8BA 3LUZA 1FPEA 2Q9TA 5I3SA 2CEXA 3HFUA 4N6DA 4I3YA 4PE3A 1FTAA 1YYZA 1IMFA 2HZLA 4O7IA 5EYHA 4M1VA 4MNIA 4PDHA 5EQ9A 4MJOA 4F1VA 1NUYA 1KA1A 4PAIA 4GX3A 1YXIA 4OVQA 2WEFA 4H46A 5DW8A 1FPFA 4GWZA 4OVRA 4UABA 4PGPA 4AS5A 3FXBA 2JJKA 1NV3A 2R8TA 2XWVA 4PTKA 2DDKA 4HE0A 3MYUA 2ZZVA 1FPLA 2ZZXA 1FJ6A 1LBZA 1FBDA 4N8YA 3T1BA 1IMEA 2F3BA 1FBGA 2HXRA 4NN3A 1IMBA 4PF6A 4XFEA 3NOHA 3W9WA 3CHGA 4KXPA 1FPDA 2F5XA 1VDWA 3IFAA 1LBYA 1NV6A 2DE4A 4P3LA 1EYKA 1FSAA 3E79A 1YZ0A 2QPQA 4G61A 1FJ9A 4PC9A 3PTYA 4H45A 2P3VA 2XXKA 1AWBA 4HE2A 5J16A 2DVZA 2B4LA 1NUWA 5JK4A 3BIHA 3D1RA 2OX3A 2HHMA 4FBPA 2P3NA 1LBWA 3T0JA 2XWKA 1DK4A 1IMCA 1CNQA 1RDYA 2KQZA 3ROJA 2F3DA 2WX9A 2FHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F24 A;  4AS5 A;  2PCR A;  3RPL A;  1KA0 A;  5EQA A;  2QVU A;  4QXD A;  1FBP A;  1NV1 A;  2JJK A;  3LV0 A;  1NV3 A;  4I40 A;  1FBF A;  2R8T A;  4GWS A;  5IZ1 A;  4PTK A;  1NUX A;  2DDK A;  2GQ1 A;  1SPI A;  4HE0 A;  1G0I A;  1RDZ A;  1Q9D A;  1DBZ A;  1FBC A;  1NV7 A;  5ESY A;  1FPL A;  1IMA A;  3B8B A;  1FJ6 A;  2QVR A;  1LBX A;  1LBZ A;  1FBD A;  1FRP A;  3IFC A;  1JP4 A;  2Y5L A;  2Y5K A;  3RYD A;  3FBP A;  1NI9 A;  2FBP A;  5EQ7 A;  1IME A;  2F3B A;  1FBE A;  5FBP A;  1FBG A;  2Q74 A;  4GBW A;  1FPB A;  1IMB A;  1EYJ A;  5EQ8 A;  3KC1 A;  4GWU A;  4HE1 A;  3KBZ A;  4GWX A;  2CZK A;  1NV0 A;  5IZ3 B;  1IMD A;  4GX4 A;  4N81 A;  1FPI A;  1INP A;  2VT5 A;  2FIX A;  4KXP A;  1FPD A;  2FIE A;  3A29 A;  2CZH A;  3KC0 A;  5EYG A;  1D9Q A;  3QMF A;  1EYI A;  1NV2 A;  1VDW A;  5IZ3 A;  2QVV A;  5T3J A;  3IFA A;  1NUZ A;  1FPJ A;  1LBY A;  1LEV A;  4HXV A;  1LBV A;  5LDZ A;  1DCU A;  2CZI A;  1RDX A;  2QFL A;  5ET8 A;  1NV6 A;  1KZ8 A;  1FPK A;  4IR8 A;  2OWZ A;  1G0H A;  3LUZ A;  1FPE A;  2FVZ A;  5I3S A;  1EYK A;  5ET5 A;  1NV5 A;  1FSA A;  1YZ0 A;  4I3E A;  4G61 A;  4GBV A;  1FJ9 A;  4H45 A;  2P3V A;  4I3Y A;  1FTA A;  1YYZ A;  1BK4 A;  1IMF A;  1NV4 A;  1QGX A;  2WBB A;  1K9Y A;  1AWB A;  4O7I A;  5EYH A;  4AS4 A;  4HE2 A;  1XI6 A;  5ET6 A;  5J16 A;  4GWW A;  5EQ9 A;  1NUW A;  4MJO A;  2WBD A;  3BIH A;  3D1R A;  2OX3 A;  4GWY A;  5ET7 A;  1NUY A;  1KA1 A;  2HHM A;  1K9Z A;  4FBP A;  2P3N A;  1LBW A;  3T0J A;  4GX3 A;  5A5L A;  1DK4 A;  1YXI A;  1IMC A;  2WEF A;  4H46 A;  1CNQ A;  3RPL B;  3BIG A;  5DW8 A;  1RDY A;  4GX6 A;  2BJI A;  3ROJ A;  2F3D A;  1FBH A;  2Q8M A;  1FPF A;  4GWZ A;  2FHY A;  1FPG A; 
#chains in the Genus database with same CATH topology
 3OMB A;  5EQA A;  3HHF A;  4PFB A;  1NV1 A;  3LV0 A;  5H8H B;  4GWS A;  4OVP A;  1FTK A;  2DXR A;  4PQJ A;  1RDZ A;  1SDX A;  2HZK A;  2PFY A;  4OFO A;  2ONR A;  4KYE A;  2Q8J A;  5I7I A;  2Y5L A;  4RNS A;  1H44 A;  4NWD A;  5LTC A;  1Q1K A;  5DYH A;  1LAG E;  5EHM A;  4MIJ A;  4JVI A;  3W9V A;  2Z23 A;  4F18 A;  4X48 A;  2Q88 A;  2QS2 A;  3FIR A;  1IXH A;  4X9T A;  3O6G A;  3UIF A;  4QHQ A;  5H8H A;  5CBS A;  4TOZ A;  1FQF A;  4MMP A;  1H76 A;  3B6W A;  2VPN A;  5JEI A;  1FTJ A;  1LGB C;  3K6X A;  4JVD A;  1NH8 A;  1NV4 A;  2WBB A;  1URS A;  3PUX E;  3GBA A;  3OXN A;  4Q5T A;  2H5Y A;  2D3I A;  4N6K A;  4GWY A;  5ET7 A;  2XX8 A;  4O7M A;  4MX6 A;  4WKM A;  4U4S A;  4H5F A;  1LB9 A;  2FYI A;  4G77 A;  1FBH A;  1NNT A;  1GV8 A;  3LSW A;  3IJO B;  3QSL A;  3K6U A;  5FHM A;  2PCR A;  4FE8 A;  1JW5 A;  4PF8 A;  3ODB A;  1FBP A;  2I3W A;  1MG1 A;  1LB8 A;  2YPN A;  1GR2 A;  1T0K A;  1XOC A;  2REG A;  1NV7 A;  5ESY A;  1MXZ A;  3B8B A;  5AA4 B;  3SZP A;  1LBX A;  3N5L A;  3IFC A;  2O7I A;  1MQI A;  2ZXT A;  1WDN A;  2VHA A;  4OHN A;  4BDR A;  4MLQ A;  4NTL A;  4ZE9 A;  3PPO A;  4YB7 A;  4QBA A;  4R74 A;  5IM2 A;  3SKP A;  4N07 A;  4ELO A;  4N17 A;  1POT A;  4O3A A;  3KOT A;  4FEB A;  3IB1 A;  1ZLQ A;  4X04 A;  1US5 A;  1LBV A;  4QSC A;  4WEP A;  4EF2 A;  4RPO A;  3UK4 A;  2E0S A;  1NV5 A;  4GXA A;  1MXW A;  3RUM A;  2OWS A;  1Q35 A;  2PMS A;  4LUB A;  4OQO A;  4AS4 A;  1OLA A;  3I5O A;  2F6P A;  4GWW A;  4GRK A;  3SDF A;  2F78 A;  3MQ9 A;  4ZDM A;  3G3G A;  2XXW A;  2ALU A;  4MF3 A;  4LP2 B;  3O97 A;  1RYO A;  4OYV A;  2Q8M A;  1A99 A;  5M2V A;  5TU0 A;  1B2H A;  4ZED A;  3GLB A;  4RYA A;  1ZIU A;  3OO6 A;  1R9L A;  1XS5 A;  4PBH A;  3QIM A;  2GQ1 A;  1PB7 A;  3OD7 A;  4PET A;  2VGQ A;  1B5I A;  1FTO A;  2QS1 A;  5HBC A;  1B9J A;  4DXU A;  1P1N A;  2Y5K A;  1NI9 A;  5EQ7 A;  3T96 B;  3IB2 A;  3SEW A;  2Q74 A;  1Y1M A;  1S7Y A;  2I48 A;  5H8Q A;  1RKM A;  4Q30 B;  4NHB A;  1B7H A;  3IX1 A;  3DP4 A;  2Y7P A;  3EKI A;  2F6G A;  2H25 A;  3JV9 A;  1NMU A;  4ZEC A;  1NV2 A;  1IXC A;  4LN5 A;  2OPE A;  3OSR A;  2PVU A;  2I0C A;  4K3F A;  5CMK A;  1DCU A;  4NF8 A;  4PFI A;  4PAK A;  1FPK A;  2AYS A;  4IR8 A;  2OWZ A;  3LUZ A;  1FPE A;  5I3S A;  4I3Y A;  3Q29 A;  1FTA A;  4IO7 A;  1Y4C A;  3FZV A;  1ZTY A;  4O7I A;  1N76 A;  4M1V A;  1M5B A;  4JBZ A;  4MNI A;  4PDH A;  4U21 A;  4F1V A;  5CRY A;  4GX3 A;  5KCJ B;  3IK6 B;  5F1Q A;  2DSF A;  4F29 A;  3S9M C;  3MVX A;  4OFL A;  3CI8 A;  4U23 A;  4PGP A;  1YCJ A;  1DPP A;  1LLS A;  4IO4 A;  4XKP A;  1B3L A;  4WED A;  1IXG A;  2JJK A;  2BJJ X;  3VV5 A;  1N04 A;  4KCC A;  3MZ9 A;  1MXV A;  3K1P A;  2XXQ A;  4ZEI A;  3O28 A;  4HE0 A;  2ZYM A;  2ZZV A;  3MPL A;  2RF1 A;  3LC8 A;  3HPI A;  4U2R A;  3TTR A;  1P99 A;  3S9N C;  4N8Y A;  4JWX A;  1IME A;  5KCJ A;  1AH5 A;  2YLN A;  4NN3 A;  3Q28 A;  3G3F A;  4PF6 A;  3TQL A;  4XFE A;  4EXL A;  1Z7N E;  2XXR A;  1BLF A;  3NOH A;  3PPQ A;  4F1Y A;  3FVO A;  1FQC A;  4NF6 A;  2A5S A;  1OQG A;  1Y3Q A;  4YB5 A;  5K2X A;  4FJP A;  3S9L C;  3IFA A;  3D4C A;  1FQD A;  1LBY A;  2F8D A;  1QJM A;  4ELR A;  1MS7 A;  1NV6 A;  4RY1 A;  1US4 A;  3OO9 A;  4NF5 B;  1B3E A;  5H8F B;  4P3L A;  1IEJ A;  1DTG A;  2V3T A;  1FSA A;  2QPQ A;  4G61 A;  4PC9 A;  1B7Z A;  2P3V A;  2XXK A;  3M3F A;  2NUV A;  4GXS B;  1FQB A;  3RLF E;  3BIH A;  3N94 A;  4MFI A;  3C4M A;  3VXC A;  3PD8 A;  1IUD A;  2DOJ A;  4FBP A;  1SYI A;  1TFA A;  3IAZ A;  1DK4 A;  1B5J A;  1IMC A;  1JVX A;  2F3D A;  5I57 B;  4NF5 A;  3RTF B;  2QMX A;  2FHY A;  2XX7 A;  3T22 A;  4RJZ A;  1SVX B;  1NNP A;  4YMB A;  1JQF A;  1ZMG A;  2XXX A;  3VVD A;  4NWC A;  1BIY A;  5IZZ A;  2QVU A;  2DWA A;  2Y7R A;  1QUI A;  4P1L A;  3UOR A;  1B46 A;  1NH7 A;  2HEU A;  3MZB A;  3OEK A;  1Q9D A;  3H03 A;  3I6V A;  4YZZ A;  3E3K A;  2ZYK A;  4ELQ A;  1FRP A;  2A5T B;  3FJ7 A;  3PUY E;  4Q8R A;  3MZ1 A;  4YKP A;  4OEV A;  3O9P A;  3QUF A;  4Q0C A;  2OPD A;  1XHY A;  5I57 A;  1QVS A;  3U92 A;  4GX4 A;  2X26 A;  2L5V A;  3TTK A;  3TOD A;  4OES A;  1MH3 A;  5EYG A;  1D9Q A;  4F1U A;  1EYI A;  5IZ3 A;  2V3Q A;  4OMB A;  2OZZ A;  3LSL A;  4NF4 B;  4QFL A;  1NUZ A;  1FPJ A;  1URD A;  4HXV A;  1XVX A;  4GVO A;  1Y3P A;  3RNN A;  4R73 A;  1QW0 A;  3H6T A;  4GBV A;  1EZ9 A;  2DWJ A;  4NX1 A;  5I2N B;  1BK4 A;  4O94 A;  4N4U A;  3SER A;  5TPA A;  1H45 A;  5CM6 A;  2ABH A;  3FXR A;  2GHA A;  2Y7K A;  2H9B A;  2CZL A;  2IA4 A;  2GRV A;  1TFD A;  4C1U A;  1K9Z A;  4H6D A;  2Y84 A;  5J1D A;  3A3C A;  5A5L A;  2I4C A;  4R75 A;  4HCW A;  4KFQ A;  4OVJ A;  1EU8 A;  2F35 A;  4G8H A;  1NL5 A;  4KPT A;  3G3H A;  2KLF A;  3RN8 A;  3RQT A;  3FXU A;  3CFX A;  3PUV E;  3ZKK A;  4YKK A;  2VP1 A;  1FTL A;  3A3U A;  3HN0 A;  1FTM A;  3N26 A;  2Y7W A;  3OOA A;  4KYD A;  3FJG A;  4PCD A;  1N7W A;  3RYD A;  1IIT A;  4UAC A;  4QRZ A;  4P9K A;  4GBW A;  1B51 A;  1LFH A;  1NNK A;  3QYT A;  3OO8 A;  3PPR A;  4GIZ A;  1MPD A;  1PB9 A;  3VE1 B;  2FIX A;  2UVJ A;  4EXK A;  4X8R A;  3MP6 A;  4PFW A;  1ATG A;  1LCF A;  1WOD A;  1HSE A;  4F3G A;  4IB2 A;  3R6U A;  4IO3 A;  2RC9 A;  1RDX A;  2ZZW A;  4NF0 A;  3B50 A;  3FV1 A;  3M8U A;  3DP8 A;  3IOU A;  1LFI A;  5ITP A;  1OVT A;  3K6V A;  1URG A;  4AQ4 A;  1AL3 A;  1N7X A;  4I3E A;  4BDM A;  1QGX A;  1YTV A;  2V25 A;  1PB8 A;  4ELP A;  1USY E;  3EF7 A;  1B40 A;  4X1B A;  4IO2 A;  2H99 A;  1IXI A;  4N15 A;  1B05 A;  3U72 A;  4DCY A;  4ZZE A;  1LFG A;  2XA5 A;  3K2D A;  3KSJ A;  2F36 A;  4P56 A;  1ZBM A;  2XWI A;  4MLV A;  1LAH E;  2I4B A;  1N84 A;  2KR0 A;  4R9G A;  4I8C A;  1USY H;  2X7Q A;  2R6G E;  2DQV A;  1SI0 A;  3IR1 A;  1MQD A;  4QXD A;  3O66 A;  4MAG A;  5DTB A;  3C35 A;  1VFD A;  4FAT A;  3TCF A;  3FVK A;  3T9H B;  2RCB A;  2HAV A;  1MPB A;  4JDF A;  4PBQ A;  2UVG A;  5FBP A;  5KZT A;  1H43 A;  1FPB A;  2E1S A;  3C36 A;  4XKR A;  3KGC A;  2VPO A;  2XXU A;  3H06 B;  4DDD A;  3O6H A;  3FVN A;  4RPN A;  4OZ9 A;  4DIG A;  3V83 A;  3QMF A;  2FA7 A;  1Y20 A;  4GWO A;  2WYK A;  4PGN A;  4EQ9 A;  4F2O A;  2I6E A;  2Z8D A;  1TWY A;  1B0H A;  4NQ8 A;  4P8B A;  3R7X A;  2UVH A;  1MY2 A;  1XC1 A;  1BKA A;  2O1M A;  3K00 A;  2ZNS A;  1VFE A;  1IMF A;  2HZL A;  3TFL A;  3T9U A;  5EYH A;  3CG1 A;  1MM7 A;  4MJO A;  3O6I A;  1CE2 A;  4ISU A;  1NUY A;  1KA1 A;  1BP5 A;  4DE8 A;  3M3K A;  4H46 A;  3SEX A;  4OVR A;  1O7T A;  1MDP 1;  2Q89 A;  3FD3 A;  2NWJ A;  3FXB A;  3N6T A;  1B3F A;  3PMW A;  2AIX A;  1NV3 A;  5HPQ A;  1PC3 A;  5CI5 A;  4PTK A;  2DDK A;  3MYU A;  1Y4T A;  4NED A;  5H8Q B;  4XKN A;  1LBB A;  3MVY A;  3TCH A;  3T1B A;  3KN7 A;  4E0W A;  1I69 A;  4BDQ A;  4I1D A;  3TYH A;  1EZP A;  4OEU A;  3K4U A;  5FHN A;  2Z8F A;  3HO7 A;  5L8D A;  1EH3 A;  3DP6 A;  1FPD A;  2O51 A;  1KWH A;  2F5X A;  1NFT A;  3LUY A;  4NF8 B;  2O84 X;  4F3P A;  4HW8 A;  3SET A;  1SBP A;  4JSD A;  1MY3 A;  1H3D A;  2R9J A;  1SW1 A;  4ECF A;  5AA2 D;  5LOM A;  2Z22 A;  3K1M A;  3B6T A;  1YZ0 A;  4ZZA A;  3VLV A;  2V84 A;  3UN6 A;  4IY6 A;  4QSE A;  1R9Q A;  4F2Q A;  1LAX A;  2HXW A;  2RCA A;  3G3K A;  3WAF A;  3OEM A;  4KQP A;  2B4L A;  2DVZ A;  5TP9 B;  1NUW A;  2HFB A;  3OSQ A;  3V89 B;  4DLD A;  1I6Q A;  2AL4 A;  2DWH A;  4U22 A;  4EQB A;  3BBR A;  1MXX A;  3CSB A;  1CNQ A;  2FNC A;  1RDY A;  3FXQ A;  4G68 C;  2KQZ A;  3TKD A;  3L6H A;  2WX9 A;  3H3G A;  2PX1 A;  3EPE A;  2IEE A;  2GH9 A;  1A7L A;  2D5W A;  5BUU A;  3ZS6 A;  4MBP A;  3GBB A;  4GLI A;  4KD5 A;  4NAP A;  4ZEB A;  2VOZ A;  2XXH A;  3B6Q A;  1QKA A;  3TAJ A;  3Q26 A;  3O2A A;  2DE2 A;  3H6V A;  4G68 A;  1MQG A;  5TP9 A;  3IOV A;  4XEQ A;  4QFO A;  3KN8 A;  1FBE A;  2RC8 A;  2XWO A;  4NF6 B;  1CB6 A;  2LAO A;  2DP8 A;  3VDF A;  4GWX A;  3SEV A;  5I2K A;  4N81 A;  3E78 A;  4RK9 A;  2OLB A;  3PV0 E;  1EZO A;  4R6K A;  4TLL B;  2REJ A;  2NXO A;  4QFN A;  3TQW A;  5LDZ A;  2I49 A;  1OMP A;  3KJ7 A;  5ET8 A;  2OJT A;  1HSJ A;  3S2V A;  1PEB A;  3GXA A;  5ISU A;  3TCG A;  2OWT A;  4YKI A;  3TEP A;  2UXA A;  1MY1 A;  3TTL A;  1O63 A;  4O3B A;  3BFU A;  4P1E A;  3RY3 A;  4L17 A;  3VFJ A;  4H1X A;  4BLA A;  4JVC A;  4U1Z A;  1PBQ A;  4QF9 A;  3MP1 A;  4G8N A;  3BIG A;  4OFJ A;  2BJI A;  5EHS A;  2NOO A;  3CR9 A;  3ILT B;  4AB6 A;  5CMM A;  4R2B A;  2HCA A;  5AE4 A;  1YPN A;  3RPL A;  5ITO A;  1FW0 A;  5IKB A;  4I40 A;  3SEY A;  1NUX A;  5IAI A;  3C34 A;  3FV2 A;  3QXM A;  1G0I A;  2RIN A;  3C31 A;  1XT8 A;  2XXI A;  3RGY A;  1DMB A;  1SYH A;  4MNP A;  5A5X B;  1HSL A;  3LSX A;  5CC2 A;  1YAE A;  5IZ3 B;  1IZ1 A;  4QFK A;  4QSD A;  3PU5 A;  2F7B A;  2VT5 A;  2THI A;  2CZH A;  3KC0 A;  4YIC A;  4R72 A;  4C1T A;  2QVV A;  4E0X A;  2OBG A;  4HTG A;  3PUW E;  3VXB A;  5I56 A;  2F7C A;  5ELV A;  1D4N A;  1G0H A;  1TT1 A;  3MAM A;  4H8I A;  5KDT B;  5TPA B;  1GGG A;  5A5X A;  2X7P A;  4OA4 A;  4KHZ E;  4NMY A;  2ZNU A;  2DE3 A;  2GHB A;  2XXP A;  1XI6 A;  4PFR A;  3DLN A;  4PAF A;  1OLC A;  2O1L A;  3T9V A;  4M4G A;  4DI4 B;  4F19 A;  5DEX B;  1B3H A;  2UYE A;  4ZS9 A;  1B7U A;  2I3V A;  3EQ1 A;  1OQH A;  2QMW A;  3GZG A;  3ONM A;  4PP0 A;  5KDT A;  4RA1 A;  3B7D A;  5DT6 A;  1LST A;  3G3J A;  1KA0 A;  3PPP A;  3K01 A;  4F22 A;  4MCO A;  4MNC A;  1AIV A;  4G4P A;  4OEN A;  1JNF A;  4G2Z A;  5B70 A;  2F34 A;  2H98 A;  1DBZ A;  1NKX A;  4DI3 D;  3P7I A;  1M5F A;  1B4H A;  1LBC A;  5DEX A;  2ZNT A;  4LON B;  1M5E A;  2FBP A;  3A09 A;  1Y1Z A;  2RC7 A;  4O3C A;  3UP9 A;  1ZJL A;  3KC1 A;  4BDN A;  3KBZ A;  3THI A;  4LQ2 A;  2WYP A;  2F97 A;  1AOV A;  3QK6 A;  4POX A;  1FPI A;  4OWD A;  1VE4 A;  2FIE A;  4N13 A;  4PFT A;  2H4I A;  2R71 A;  5CMC A;  3IO4 A;  4PE5 B;  5FHO A;  2CZI A;  3TZA A;  1MRP A;  1D9V A;  3BKI B;  1KZ8 A;  1LAF E;  3MUQ A;  3DM0 A;  3JYR A;  2CEX A;  4GL0 A;  3HFU A;  1P1U A;  4GOT A;  5F7V A;  5I59 A;  5HM4 B;  1VSO A;  1N3X A;  4H0W A;  3TMG A;  3VVE A;  1MXY A;  4TQU Q;  4H65 A;  2CMO A;  4OER A;  4ESW A;  2GFE A;  1UTH B;  4LVQ A;  2Q2A A;  4FIM A;  2ZYO A;  3Q25 A;  4ND9 A;  1YXI A;  2WEF A;  1A54 A;  5DW8 A;  2Y7I A;  3RTW B;  2DWI A;  1FPF A;  4IGR A;  1JEV A;  5DVI A;  3BFT A;  4FEC A;  1MM6 A;  2M8C A;  5FTI A;  1NNF A;  4EDP A;  2R8T A;  2XWV A;  4KCD A;  1B0L A;  4GQO A;  3ZSF A;  2G29 A;  1UTH A;  1FJ6 A;  1FBD A;  3S4U A;  2F3B A;  2DVC A;  1FBG A;  2HXR A;  3H7M A;  2W7Y A;  3N6U A;  4F3B A;  2F7A A;  4JWO A;  3C33 A;  3OEN A;  3W9W A;  4FOR A;  3KOS A;  4LZ7 A;  4OET A;  4DXC A;  1LCT A;  4R2F A;  1OVB A;  3KFM A;  3DEL B;  1DTZ A;  4OXV A;  3M3L A;  4XKQ A;  3MPK A;  1SI1 A;  3K0V A;  4YU0 A;  3PUZ E;  2P1S A;  3CFZ A;  3Q27 A;  2DE4 A;  1EYK A;  2V93 A;  3E79 A;  2DS9 A;  5AA3 A;  4LA9 A;  3IL1 B;  1PBP A;  3EHU A;  4HE2 A;  5J16 A;  3C32 A;  1B32 A;  2OCU A;  3D1R A;  2OX3 A;  4YB6 A;  1DOT A;  2DXY A;  1S9T A;  3KSX A;  2HHM A;  1LBW A;  3T0J A;  1B3G A;  4N6P A;  3MJN A;  4FED A;  3W15 C;  3KG2 A;  3U8Q A;  1PDA A;  3FJM A;  1F9B A;  4GF8 A;  4R6Y A;  2I58 A;  2Q2C A;  5F24 A;  3MST A;  3SEU A;  5IGA A;  2V4C A;  1FBF A;  4I9D A;  5IZ1 A;  2I0B A;  1SPI A;  2QSX A;  1IMA A;  3T66 A;  4RK2 A;  1L5T A;  3KJT A;  4R6H A;  1M5C A;  1P1O A;  3U93 A;  5AA4 A;  3CIJ A;  5CMB A;  3TEL A;  4GWU A;  3HHG A;  1JVY A;  2XD2 A;  2CZK A;  1MY0 A;  3E13 X;  4POW A;  2QRY A;  4IGT A;  5AA1 A;  4X1D A;  4U1O A;  3O29 A;  4ZEF A;  4GD5 A;  4IY5 A;  3IOT A;  3TPA A;  1QKB A;  2HPG A;  5EYF A;  1LEV A;  3PD9 A;  2ONS A;  2QFL A;  2XXT A;  3I3V A;  4U4X A;  4JWY A;  1B58 A;  3E4R A;  2ONK E;  5ET5 A;  3MVZ A;  1UIV A;  3GYY A;  2OK2 A;  1JW4 A;  2D21 A;  2PYY A;  1K9Y A;  4H67 A;  4RXL A;  4WXJ A;  5B7D A;  3VVF A;  5K2Y A;  1MXU A;  2PFZ A;  1B6H A;  4OVT A;  1B4Z A;  3FAS A;  4Z0I A;  2ANJ A;  3H6U A;  3ILU B;  2VD2 A;  4JB7 A;  2MKZ A;  2UYF A;  4NGU A;  2QJE A;  4QFP A;  4JXI A;  1FPG A;  4G68 B;  4ZEK A;  3PMX A;  1MQJ A;  2UVI A;  4PFU A;  1WVJ A;  3LSF B;  1ANF A;  4MEV A;  2PT1 A;  4OAN A;  4LZ8 A;  3IOR A;  4NG7 A;  1A55 A;  2P2A A;  4LZ5 A;  1FBC A;  2DYX A;  3FGS A;  4Z7E A;  3ISP A;  4YMA A;  2QVR A;  1GVC A;  2P0S A;  3FBP A;  5I2K B;  3CRB A;  1I6B A;  3U65 A;  3KEI A;  3IB0 A;  1A8E A;  1QUL A;  1R6Z A;  1NV0 A;  3H6W A;  2Z8E A;  1UQW A;  4P0I A;  1INP A;  2XX9 A;  4N8G A;  4GFR A;  5T3J A;  4DXB A;  3MWB A;  4G8M A;  4MHF A;  4P11 A;  4R9F A;  4DZ1 A;  2QS3 A;  1A40 A;  2ZMB A;  2FVZ A;  5L9O A;  4GL8 A;  3PPN A;  3MBP A;  3TUS A;  3G7W A;  5H8N B;  3HV1 A;  4I62 A;  5ET6 A;  3OEL A;  3E9X A;  4ESX A;  4XIG Q;  2WBD A;  1JET A;  3PGF A;  4BDL A;  3MVW A;  5FTH A;  1DSN A;  3U94 A;  1MQH A;  3PMV A;  4OVS A;  4MH5 A;  2G93 A;  3QUJ A;  3RPL B;  4GX6 A;  3T9X B;  2CEY A;  5AA2 B;  1IQ7 A;  1SW2 A;  3FAT A;  1B1H A;  3KZG A;  1Y9U A;  4F31 B;  3QAX A;  1RYX A;  1ZU0 A;  2AL5 A;  1VR5 A;  5H8N A;  3IOW A;  1OIB A;  4IO5 A;  3D4G A;  4IO6 A;  4P47 A;  4PDD A;  3RT6 B;  3K02 A;  4NE4 A;  3U1O A;  2B4M A;  1I6A A;  5L9M A;  5L9S A;  3MW0 A;  1ZKB A;  1JP4 A;  2HAU A;  4HCY A;  5H8S A;  2QS4 A;  4KR5 A;  3WAE A;  3HCQ A;  1FCK A;  2O7U A;  1EYJ A;  5EQ8 A;  3RPW A;  5AA2 A;  1UIU A;  4HE1 A;  4XF5 A;  4EQ7 A;  1IMD A;  4N91 A;  1AMF A;  1N3W A;  5BWJ A;  3A29 A;  3IO6 A;  4FAJ A;  5I56 B;  2QL3 A;  3MC2 A;  1P1Q A;  5I5P A;  1B1X A;  4F3S A;  1ELJ A;  3HST A;  4O8M A;  3MP8 A;  2Q9T A;  1UTB B;  4P0G A;  3EHT A;  1J1N A;  2WKY A;  1Z7M E;  4N6D A;  1D9Y A;  1SW5 A;  4PE3 A;  3V8X B;  1YYZ A;  2VD3 A;  4EUO A;  1N0T A;  5ICQ A;  4LAT A;  2PT2 A;  5H8F A;  3JZJ A;  4KYS A;  3L6G A;  1GTK A;  1JW1 A;  5EQ9 A;  1Y3N A;  3AXF A;  3LBS A;  1D3K A;  3V5A A;  1A8F A;  3F11 A;  4PAI A;  4THI A;  3H4Z A;  3LR1 A;  4OVQ A;  4H5G A;  2NVU B;  1MDQ A;  3FVG A;  1UTB A;  1BTJ A;  4GWZ A;  4H8J A;  2B65 A;  4UAB A;  3T93 B;  4AS5 A;  3TTM A;  1II5 A;  2V3U A;  4YAH X;  1XVY A;  4PFY A;  3CVG A;  1R1N A;  1QUJ A;  2O68 A;  1B52 A;  3FUZ A;  2ESN A;  1MH4 A;  2RKM A;  4DCX A;  1IIW A;  3VLU A;  1FPL A;  4AB5 A;  2ZZX A;  5JTY B;  3K6W A;  1LBZ A;  5DVF A;  4JSO A;  4TLM B;  5I58 B;  3VLW A;  4EF1 A;  1IMB A;  2A5T A;  4ONY A;  5ICT A;  3CFL A;  3CHG A;  1SD3 A;  4KXP A;  4BDO A;  1SW4 A;  3UA8 A;  3K1N A;  3RT8 A;  2XHD A;  1B5H A;  1SQY A;  4UA8 A;  3USD A;  4XXU A;  2XD3 A;  3ZKL A;  1VDW A;  1DPE A;  3EN3 A;  2B3B A;  1P1W A;  5DVJ A;  1S50 A;  3OO7 A;  4YKJ A;  2O6A A;  1MPC A;  4HS7 A;  3TDJ A;  5JTY A;  5I59 B;  3SES A;  4F39 A;  4NF4 A;  2XXY A;  5I58 A;  2PBW A;  3IJX B;  1TXF A;  1FJ9 A;  3ECR A;  3C9H A;  3PTY A;  1FQE A;  4H45 A;  3EHS A;  1QUK A;  4LQ5 A;  3TTN A;  1AWB A;  2YJP A;  1M5D A;  4KI0 E;  3R26 A;  5I2N A;  2HQ0 A;  1MY4 A;  3CG3 A;  5JK4 A;  3CSG A;  2ZYN A;  2XXV A;  3S9E A;  4OTE A;  1POY 1;  4C0R A;  2B3F A;  2O69 A;  2P3N A;  2XWK A;  3G3I A;  5I84 A;  1JEU A;  3ROJ A;  3KN3 A;  5CBR A;  4ZE8 A;  3UGW A;  1FQA A;  3KBR A;  1O64 A;  4XTC Q; 
#chains in the Genus database with same CATH homology
 5F24 A;  3MST A;  5IGA A;  4NAP A;  5EQA A;  5IZZ A;  4PFB A;  2QVU A;  1NV1 A;  3LV0 A;  2V4C A;  4P1L A;  1FBF A;  4GWS A;  4OVP A;  5IZ1 A;  2DE2 A;  1SPI A;  1RDZ A;  1Q9D A;  2HZK A;  2PFY A;  1IMA A;  4YZZ A;  5I7I A;  4XEQ A;  1FRP A;  2Y5L A;  5LTC A;  1FBE A;  2XWO A;  4GWU A;  4GWX A;  2CZK A;  4MIJ A;  4GX4 A;  4N81 A;  4JVI A;  3W9V A;  2L5V A;  4F18 A;  3E78 A;  5EYG A;  1D9Q A;  4X9T A;  4F1U A;  1EYI A;  5IZ3 A;  2V3Q A;  1NUZ A;  2HPG A;  1FPJ A;  1LEV A;  4HXV A;  5LDZ A;  2QFL A;  5ET8 A;  4MMP A;  2VPN A;  5ET5 A;  4JVD A;  4GBV A;  3GYY A;  4NX1 A;  1NV4 A;  1BK4 A;  4O94 A;  2WBB A;  1K9Y A;  4N4U A;  5CM6 A;  4P1E A;  4N6K A;  4GWY A;  5ET7 A;  2PFZ A;  4OVT A;  4O7M A;  4MX6 A;  1K9Z A;  4JVC A;  5J1D A;  5A5L A;  3BIG A;  4HCW A;  2BJI A;  1FBH A;  2MKZ A;  4NGU A;  1FPG A;  2PCR A;  3RPL A;  4PF8 A;  1FBP A;  4I40 A;  4MEV A;  1NUX A;  4OAN A;  1G0I A;  4NG7 A;  1FBC A;  1NV7 A;  5ESY A;  3ISP A;  3B8B A;  2QVR A;  3SZP A;  1LBX A;  3IFC A;  4PCD A;  3RYD A;  3FBP A;  4MNP A;  4P9K A;  4GBW A;  3U65 A;  4QBA A;  1NV0 A;  5IZ3 B;  5IM2 A;  1INP A;  2VT5 A;  2FIX A;  4N17 A;  2CZH A;  3KC0 A;  4YIC A;  4N8G A;  4X8R A;  2QVV A;  5T3J A;  4MHF A;  4X04 A;  1LBV A;  2ZZW A;  1RDX A;  4NF0 A;  3B50 A;  1G0H A;  2FVZ A;  1NV5 A;  4OA4 A;  4I3E A;  1QGX A;  2DE3 A;  4AS4 A;  1XI6 A;  5ET6 A;  4PFR A;  4GWW A;  4PAF A;  2WBD A;  4N15 A;  4DI4 B;  4F19 A;  2XA5 A;  4OVS A;  3RPL B;  4GX6 A;  4P56 A;  2CEY A;  2XWI A;  2Q8M A;  2KR0 A;  1KA0 A;  4QXD A;  4MAG A;  4MCO A;  4MNC A;  4PBH A;  4PDD A;  2GQ1 A;  4P47 A;  4PET A;  1DBZ A;  2B4M A;  4DI3 D;  1JP4 A;  4HCY A;  2Y5K A;  4PBQ A;  1NI9 A;  2FBP A;  5EQ7 A;  5FBP A;  2Q74 A;  1FPB A;  1EYJ A;  5EQ8 A;  4NHB A;  3KC1 A;  4HE1 A;  3KBZ A;  4XF5 A;  2WYP A;  1IMD A;  4N91 A;  3EKI A;  2VPO A;  1FPI A;  2FIE A;  3A29 A;  3QMF A;  1NV2 A;  4LN5 A;  5I5P A;  2WYK A;  4PGN A;  1DCU A;  4O8M A;  2CZI A;  4PFI A;  4PAK A;  1KZ8 A;  1FPK A;  4NQ8 A;  4IR8 A;  2OWZ A;  4P8B A;  3LUZ A;  1FPE A;  2Q9T A;  5I3S A;  2CEX A;  3HFU A;  4N6D A;  4I3Y A;  4PE3 A;  1FTA A;  1YYZ A;  1IMF A;  2HZL A;  4O7I A;  5EYH A;  4M1V A;  4MNI A;  4PDH A;  5EQ9 A;  4MJO A;  4F1V A;  1NUY A;  1KA1 A;  4PAI A;  4GX3 A;  1YXI A;  4OVQ A;  2WEF A;  4H46 A;  5DW8 A;  1FPF A;  4GWZ A;  4OVR A;  4UAB A;  4PGP A;  4AS5 A;  3FXB A;  2JJK A;  1NV3 A;  2R8T A;  2XWV A;  4PTK A;  2DDK A;  4HE0 A;  3MYU A;  2ZZV A;  1FPL A;  2ZZX A;  1FJ6 A;  1LBZ A;  1FBD A;  4N8Y A;  3T1B A;  1IME A;  2F3B A;  1FBG A;  2HXR A;  4NN3 A;  1IMB A;  4PF6 A;  4XFE A;  3NOH A;  3W9W A;  3CHG A;  4KXP A;  1FPD A;  2F5X A;  1VDW A;  3IFA A;  1LBY A;  1NV6 A;  2DE4 A;  4P3L A;  1EYK A;  1FSA A;  3E79 A;  1YZ0 A;  2QPQ A;  4G61 A;  1FJ9 A;  4PC9 A;  3PTY A;  4H45 A;  2P3V A;  2XXK A;  1AWB A;  4HE2 A;  5J16 A;  2DVZ A;  2B4L A;  1NUW A;  5JK4 A;  3BIH A;  3D1R A;  2OX3 A;  2HHM A;  4FBP A;  2P3N A;  1LBW A;  3T0J A;  2XWK A;  1DK4 A;  1IMC A;  1CNQ A;  1RDY A;  2KQZ A;  3ROJ A;  2F3D A;  2WX9 A;  2FHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...