4O7IA

Structural and functional characterization of 3'(2'),5'-bisphosphate nucleotidase1 from entamoeba histolytica
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
317
structure length
317
Chain Sequence
MSFDKELALALEIVQVSCKITTSVAEHTLTDQTQIKNDKSPVTVGDYSVQAYVNKKIHETFPEDQIVAEEDTKTIPEDIFAKVCKHVQIYSDMKDDEIRKSIDLGNSTGGKGRHWVLDPIDGTLGFLRREQYAVCLAFMIDGDIKVGVLGCPNFEGGLIVAAQKGCGAKMFSVNDIKNGKDIHVSTTPKTSDMCFCESVEVSHTDQSRSKTITERLQVTKPPVRMDSQCKYMAIASGRADVYLRLPRNLSYQEKIWDHAAGYLIVKEAGGKVTDIYGNDLDFSLGRTLCNNHGIVASNGILHEETVNVVKDVLSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase, putative
publication title Structural elucidation of a dual-activity PAP phosphatase-1 from Entamoeba histolytica capable of hydrolysing both 3'-phosphoadenosine 5'-phosphate and inositol 1,4-bisphosphate
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 117
structure length 317
sequence length 317
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4o7iA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o7iA02
2DDKA 5ET6A 1FTAA 1FPJA 1NUZA 4GX3A 5EQ7A 2JJKA 4GX4A 1YZ0A 1FPGA 3IFCA 1Q9DA 4AS5A 2Q8MA 4KXPA 1NV5A 1NUXA 1NV2A 1NV3A 1FPKA 2F3BA 3B8BA 5ET5A 1NV6A 1VDWA 1FBCA 4IR8A 2F3DA 5T3JA 3LV0A 1FBHA 1FBEA 2GQ1A 2QFLA 4H46A 1IMDA 1LBVA 5F24A 1K9YA 1YXIA 2FIXA 1CNQA 3BIHA 4O7IA 5EQ8A 5ET8A 2WEFA 1IMEA 3QMFA 4I3YA 5ESYA 2FBPA 1FJ9A 1FPDA 4GWWA 1IMBA 2QVUA 1RDYA 5EYHA 1YYZA 1FBPA 4GBWA 2P3VA 4N81A 1KA1A 2P3NA 2QVRA 2QVVA 4GWZA 4GWXA 1IMAA 5J16A 4HXVA 1KA0A 1NV0A 3D1RA 5EQAA 1NV1A 5I3SA 1BK4A 4H45A 2FVZA 5EQ9A 1G0HA 1NI9A 1JP4A 2CZIA 1DK4A 2OWZA 1FSAA 1FPIA 4FBPA 1SPIA 4HE2A 1G0IA 4HE0A 4GWSA 1NV7A 4GWUA 1FBFA 1RDZA 3RPLA 5ET7A 3KC1A 1AWBA 3FBPA 1D9QA 5EYGA 3RPLB 5FBPA 2FHYA 1FJ6A 2OX3A 4I3EA 3KBZA 3LUZA 1FBGA 1FPEA 1LEVA 1EYIA 1NUWA 4GWYA 2BJIA 2WBBA 4MJOA 5DW8A 3RYDA 1KZ8A 1FBDA 2HHMA 3ROJA 1LBZA 1IMCA 5IZ1A 4PTKA 2CZHA 1NV4A 1FPBA 5IZ3B 1EYJA 2Q74A 3T0JA 1FPFA 1QGXA 2R8TA 1FRPA 3BIGA 1DBZA 1LBYA 3IFAA 1LBXA 1IMFA 4HE1A 1INPA 4AS4A 3KC0A 1LBWA 4G61A 4GBVA 3A29A 1RDXA 2WBDA 5LDZA 2CZKA 2Y5KA 2VT5A 1DCUA 4GX6A 1K9ZA 2FIEA 1NUYA 4QXDA 5A5LA 1EYKA 4I40A 2Y5LA 5IZ3A 2PCRA 1XI6A 1FPLA
chains in the Genus database with same CATH superfamily
3KFMA 4GX3A 2JJKA 5HM4B 1WDNA 1NUXA 4QFKA 1EZPA 3D4GA 4LZ8A 3MUQA 1N0TA 5EYFA 3A3UA 2OWSA 4MLVA 1UTBB 1OVTA 2DVCA 4EUOA 5KDTB 2Y7PA 4OVSA 2UVJA 4IY5A 3C9HA 5I57A 2FVZA 2A5TA 3E9XA 4HE2A 3VVEA 4F39A 3HO7A 1LAGE 2XXIA 3N5LA 3FXQA 1SI0A 3MQ9A 3UN6A 4X1BA 4P9KA 4X04A 4N6PA 4R73A 1B5JA 3FZVA 4FAJA 1GR2A 2O1LA 5ICQA 1KZ8A 4QBAA 1FBDA 5HPQA 2QSXA 3PPOA 3G3KA 3O28A 3MC2A 5TPAB 3EQ1A 4XKNA 1LBXA 1T0KA 4PP0A 4FJPA 4G4PA 3ONMA 3MSTA 5I58B 4I8CA 2OK2A 4DDDA 1Y3NA 2ZZXA 1J1NA 5IAIA 4IO3A 3LBSA 2O7UA 2G29A 2Q2AA 1R9QA 4U4SA 3TPAA 4AB5A 3HV1A 1MY3A 4O94A 3FVOA 2B4MA 1FQEA 4F3BA 2ZYOA 2GHBA 3MP6A 2F78A 1NV3A 5EHMA 4YMBA 3SEWA 1VDWA 3C4MA 2GQ1A 4PDHA 1H76A 2VD2A 3HPIA 2DWAA 1MPBA 3LUYA 2AIXA 4GWWA 1N76A 3FV2A 5J1DA 2B4LA 5H8FA 1B40A 1PBQA 2Z8FA 1F9BA 4XF5A 3U72A 5L9MA 3K4UA 4LQ5A 2ALUA 2YLNA 4NF8A 5I57B 1LB9A 4XXUA 1QUKA 1PB8A 3JV9A 3KC1A 4NHBA 3K6WA 3VVDA 2O84X 1MY1A 4POXA 1NFTA 2OX3A 1FQBA 1M5FA 4WEPA 4ELRA 2XXUA 1BP5A 5I5PA 2XD3A 4G2ZA 3V5AA 3B6WA 3TCHA 1ANFA 2A5SA 5IZ1A 3K6VA 3QUFA 3IJOB 4OQOA 3RY3A 3FVGA 4OVPA 3H6VA 4MNIA 4MMPA 1HSJA 2ANJA 1NL5A 1INPA 2XX8A 2NUVA 3AXFA 4PFWA 4JWXA 2F7AA 2HAUA 4HS7A 4PFIA 3QXMA 3FJMA 3FBPA 1PDAA 4DIGA 2Y7IA 2R6GE 4PAFA 2DE3A 1LCFA 2XD2A 4PE5B 4YKPA 1FTOA 4KPTA 1XVXA 3Q29A 5EQ8A 4ONYA 1OMPA 3C35A 3MWBA 4OERA 1SI1A 4N6DA 3V8XB 1DTZA 5IM2A 1JW1A 5H8QA 2HAVA 4ZE9A 4E0XA 3U1OA 4N81A 3FVNA 5TP9A 4BDQA 1NV0A 5H8FB 1BK4A 1RYXA 2OWZA 1SPIA 4GWSA 4DXCA 4NF8B 5ET7A 2WKYA 2OCUA 3MP8A 3C34A 5FBPA 3LSFB 2AL4A 3USDA 3FIRA 4PQJA 2DE2A 3M3FA 4QFNA 3MPKA 3HN0A 4OFOA 2BJIA 1IIWA 4PF6A 5CBSA 3K1NA 3V89B 1FPBA 1YAEA 4HE1A 1P1NA 2VHAA 3CFXA 3MVZA 5LDZA 1H45A 3MVWA 1LGBC 2DXYA 2VD3A 2D5WA 4OEUA 1MQIA 3FVKA 4MLQA 3T9UA 3FUZA 4EXLA 5ITPA 2DVZA 3UORA 2H5YA 1FPKA 3G3GA 1B5IA 2CEYA 1ZKBA 5T3JA 1MY2A 3DM0A 1FQCA 3GYYA 2PVUA 4PCDA 3DP8A 4P1EA 2XXTA 3QK6A 4O7IA 5ET8A 2WEFA 2QL3A 2FBPA 4IO2A 3PD8A 3K6UA 3T93B 2M8CA 2PT1A 3E79A 3IOUA 3CSBA 1LBBA 2ZMBA 1P1OA 5BUUA 3TCFA 4FECA 3SEUA 1NV1A 5TP9B 5EQ9A 3RT8A 4FBPA 4NG7A 3H03A 1IXCA 1TXFA 5CBRA 1NV7A 4GWUA 3PMXA 5ELVA 4QFLA 3FXRA 3TZAA 1MQGA 3T9VA 5JEIA 3T22A 5DVIA 2Y7RA 1FPEA 1EYIA 2F97A 3U65A 3PUYE 3OO8A 1R1NA 3PTYA 3VE1B 3TQWA 4IY6A 2QS2A 2F5XA 5IZ3B 1QGXA 3SETA 4IO4A 1DBZA 3N94A 3N6UA 3P7IA 2XXWA 3TCGA 4GBVA 2I0BA 4U22A 2DQVA 2ZNUA 2NOOA 4G68A 3VLWA 1N7WA 2HFBA 3THIA 4OVTA 1H44A 2UVGA 5F1QA 1DPPA 2RCAA 4FIMA 2Z8DA 4PF8A 4JWYA 4GRKA 1NH8A 4NQ8A 1RYOA 2YPNA 1LBCA 4OFLA 2X7QA 3CFLA 1SYHA 4QRZA 4IO7A 1EZOA 1MY0A 4OESA 1B46A 2IA4A 2O68A 5H8SA 4I3YA 5ISUA 4RK2A 3SDFA 1IMBA 1SW2A 2XWIA 2DWHA 4GWXA 4YAHX 1II5A 3R7XA 4ZE8A 3H6WA 4PGPA 4NF0A 4P0GA 3O97A 1G0HA 2RKMA 3K1MA 2DWIA 2V25A 1JW4A 1B1XA 4OXVA 1P1WA 3SKPA 2OPDA 2OLBA 4N8YA 1XVYA 2REJA 2ONKE 1DPEA 4OWDA 3ECRA 3TMGA 4P56A 2WBBA 5DW8A 4U1ZA 5LTCA 1D3KA 2XWKA 1IEJA 4Q8RA 4N13A 3OEKA 2RC7A 3B50A 4JVIA 4RA1A 1MM6A 3PUXE 3TDJA 4XTCQ 3Q27A 3KZGA 1AOVA 3FATA 1LBWA 2ZZVA 2FNCA 2WBDA 2Y5KA 3IO4A 3WAFA 2V4CA 4PFRA 1US5A 2NXOA 1FPJA 5TPAA 2F8DA 3TQLA 4TLLB 4EXKA 4FEBA 5I58A 3KN8A 3KG2A 1IUDA 4LN5A 5AA2A 1B7HA 5F24A 3BIHA 1HSEA 3K00A 2XXKA 2THIA 3K0VA 5FTHA 1UIVA 1IMEA 3OSRA 3QMFA 3C31A 5JTYB 3LC8A 3PMVA 3UGWA 4GF8A 1USYE 4OETA 4IB2A 3B7DA 2QVRA 2E1SA 1IMAA 4F1UA 2F34A 4POWA 1SD3A 3S9EA 4ECFA 3CI8A 5L9OA 1NMUA 4MH5A 3W15C 1D9YA 3LSLA 4LZ5A 1JEVA 2Z8EA 4C0RA 1PB7A 1GTKA 1XS5A 3U94A 3GXAA 2Z23A 4IO6A 1BKAA 3KN7A 1O7TA 1SW5A 4NMYA 4NX1A 3E78A 3U93A 4O3BA 1N04A 4WXJA 4AQ4A 4JVDA 3M8UA 1A40A 5F7VA 3TODA 4PFYA 3TTLA 4NF6B 1TFDA 4OTEA 1DMBA 3S4UA 4YKKA 1A54A 4I1DA 4HCYA 4GL0A 5DEXA 4DZ1A 2Q8JA 2CEXA 4MAGA 5FTIA 5A5XA 1O63A 3T66A 3BFUA 5ET5A 1IXIA 4P0IA 4ZZAA 1LCTA 5AA2B 4H46A 3OD7A 4NF5A 5AA3A 4PFBA 5CI5A 3LR1A 3N26A 4KYEA 3ZS6A 2O6AA 1IQ7A 2V93A 3PUZE 3BBRA 3KEIA 1CB6A 3O2AA 2Q2CA 2LAOA 3D1RA 3S9NC 4JSDA 1MY4A 3TYHA 2CZIA 1FPIA 4PC9A 3IB1A 4RNSA 3PUVE 3ISPA 4UABA 1AL3A 1LEVA 3R6UA 3SEXA 1QKBA 4JVCA 4KCDA 3FJGA 1VFDA 4PTKA 4N07A 3VLUA 4OVRA 1OIBA 4H0WA 3MP1A 2GRVA 1OQGA 4H65A 3CVGA 4FEDA 4H5GA 1ATGA 3B6TA 1QVSA 5K2XA 1IITA 1WODA 4GX6A 2X7PA 1K9ZA 2V3TA 3OOAA 5CC2A 2PFZA 1I69A 4ELPA 1P99A 3IB0A 4PAKA 1Q35A 2AL5A 4XKPA 4IGRA 2QS3A 3CRBA 5DEXB 5EHSA 2P0SA 1URDA 1XOCA 1MH4A 2PX1A 3KGCA 2DE4A 3U92A 3MAMA 5A5XB 2F3BA 2XXRA 4DCYA 4ISUA 1R6ZA 2UVIA 4F19A 1IMDA 1K9YA 1SDXA 4YB7A 4M4GA 1QUIA 4JDFA 5IGAA 4NF5B 4KI0E 4X8RA 2O69A 1H3DA 4GVOA 5I84A 1OLAA 3BFTA 3IJXB 3SERA 1MXYA 4NWCA 4GXSB 1Y20A 4H45A 1SQYA 1Y3PA 3G3JA 4G8MA 1ZMGA 1RDZA 1SBPA 1CE2A 2P1SA 4OVQA 4KYSA 3K6XA 2L5VA 5EYGA 1B5HA 1MG1A 2OWTA 4HW8A 1IXGA 1GV8A 4KYDA 2XWVA 1NNPA 2GHAA 1OVBA 2I48A 2HQ0A 3SZPA 1B4HA 1TWYA 2Q9TA 3EHUA 4NE4A 1NV4A 1MRPA 3CIJA 4EDPA 4O8MA 1VE4A 3QAXA 4P11A 1NNKA 1AMFA 5AA4A 3FJ7A 3ODBA 2H4IA 1B7ZA 1RKMA 4LUBA 5A5LA 2DS9A 1POTA 3SEYA 2I58A 5H8NA 3FXBA 5IZ3A 5IKBA 3IB2A 2G93A 5KCJB 2D3IA 3HCQA 1N3WA 3OSQA 1VSOA 1QKAA 4RPOA 3B8BA 5DT6A 3IX1A 3LV0A 1N7XA 1UTHB 4PFTA 2GFEA 3OEMA 3RN8A 1B05A 3KSJA 1DSNA 2QVUA 5EYHA 5CMMA 2P3VA 1B51A 4F18A 2P3NA 1SYIA 3VFJA 4EF2A 4ELOA 4K3FA 1KA0A 4EQ9A 5EQAA 4THIA 3ZKLA 3PPRA 1DOTA 1JP4A 2XHDA 1I6BA 2Y7WA 2XX9A 2MKZA 1G0IA 4HE0A 4NAPA 4IO5A 1IXHA 4LZ7A 1D9VA 1M5CA 2R71A 1D9QA 4MHFA 4I62A 2REGA 4MEVA 4LVQA 1NUWA 4FORA 1S7YA 3ILUB 1N3XA 3OO7A 1OQHA 3RLFE 2CZHA 1EYJA 3TUSA 2V3UA 3BIGA 3MZ1A 4GQOA 2DYXA 3EPEA 2O1MA 3GZGA 4MFIA 4H8IA 4F1YA 3VXBA 3VDFA 4XKRA 3M3LA 5AA4B 4ZEDA 4F29A 4X9TA 1LFHA 4MIJA 4WKMA 5FHOA 1FQDA 3JZJA 1FTLA 3EKIA 3QUJA 2Y84A 4JBZA 1B2HA 3OMBA 5AE4A 3GBBA 4H67A 5H8NB 1FTAA 3L6GA 4U23A 1B1HA 4TOZA 2Q8MA 5IZZA 4KXPA 3H7MA 4GLIA 1FBCA 4XKQA 1FTMA 1JNFA 1FBHA 1FBEA 3VLVA 1LBVA 4LQ2A 1H43A 4OA4A 1YXIA 1PEBA 4U4XA 1OLCA 2H98A 2ZYKA 2HXWA 4RY1A 1Q1KA 4EQ7A 1FJ9A 3UP9A 4MCOA 3N6TA 3KOTA 5ICTA 1KA1A 1MXVA 1Y1ZA 4DI3D 3H06B 4OVJA 1Y3QA 3UK4A 5JTYA 3UIFA 1BLFA 4LP2B 1NNFA 4I3EA 4Q30B 1B52A 2DP8A 4GIZA 3QSLA 3SEVA 4QSDA 4KHZE 4QFOA 3CG1A 4EQBA 4XFEA 3DP4A 1P1QA 2ZYNA 4HCWA 4QSEA 3ROJA 4LA9A 3HSTA 3PU5A 1B3EA 1EH3A 3S9MC 1PC3A 2F6PA 4N17A 3HHFA 4R6YA 4PETA 1S50A 1ELJA 2E0SA 1QUJA 3GLBA 3IOWA 4LONB 1Z7NE 2FIEA 4OENA 4YB6A 2PCRA 2I6EA 2QS4A 2DDKA 2RCBA 1YZ0A 5H8HA 1FW0A 4U21A 2H9BA 3M3KA 4AS5A 2RF1A 4ZEKA 3EHTA 1B9JA 4P1LA 1NV6A 2F35A 4OYVA 4PAIA 3RUMA 2VPOA 4NF6A 2NVUB 3FD3A 4BDOA 4PFUA 1JEUA 3ILTB 2AYSA 3C33A 4KR5A 2RC8A 2VGQA 3O29A 4R74A 3HFUA 2Z22A 4G8NA 1FTJA 2I4BA 3DELB 3Q28A 1QULA 1YTVA 4HXVA 2I49A 3O6HA 1LSTA 2Y7KA 4O3AA 4E0WA 3MW0A 3I3VA 1A8FA 3H3GA 1XC1A 2HCAA 4YICA 3TFLA 2OJTA 3TAJA 3WAEA 2UVHA 5AA2D 5I2NA 3EHSA 3IORA 1AH5A 4OZ9A 4ZZEA 3OXNA 4GXAA 4F3GA 5K2YA 3RYDA 4F2OA 1A7LA 3KSXA 4NF4A 3KBRA 5FHNA 2XXHA 2IEEA 2XX7A 1LAFE 4H5FA 2UYEA 1NKXA 1GGGA 4O7MA 3E13X 1HSLA 3H6TA 3RTFB 4ESWA 3S9LC 3R26A 4WEDA 4DE8A 3CR9A 1NNTA 1EZ9A 3LSWA 2VT5A 1DCUA 4H6DA 3W9VA 4LATA 3IR1A 1EYKA 2F36A 3G3IA 3PUWE 2QPQA 4JWOA 2X26A 3IFCA 4TLMB 1MDP1 1NV5A 5H8HB 3RNNA 5ITOA 4ND9A 4PE3A 4I9DA 4MX6A 3E4RA 3TTKA 1SW4A 3TELA 3IAZA 3HHGA 4X48A 1A55A 1GVCA 4R72A 4P8BA 5CRYA 4MNPA 4G77A 2OBGA 4N4UA 4N91A 4DLDA 3MYUA 2ZYMA 2QJEA 3FV1A 1ZTYA 4BLAA 1Y4TA 3E3KA 4U2RA 3CG3A 2PYYA 5HBCA 2NWJA 1LLSA 2XXXA 5CMCA 1DTGA 5FHMA 3C36A 1BIYA 4F22A 2DOJA 2I4CA 3BKIB 4Z7EA 2XXQA 3RPWA 5DTBA 5KZTA 1I6AA 3NOHA 5B70A 5DYHA 4G8HA 4R9GA 2FHYA 5I2NB 5L9SA 3PPNA 2GH9A 2XWOA 2DSFA 1B3HA 1JVXA 4GOTA 4R9FA 2HHMA 4NF4B 3RTWB 2Q74A 3EF7A 3T0JA 1IZ1A 1QW0A 1BTJA 5I56A 1FQFA 2ZNSA 4G61A 4C1TA 5B7DA 2B65A 4F31B 1LFIA 1YPNA 3OENA 4OEVA 1M5DA 4YZZA 1B3GA 4OMBA 1B58A 3H6UA 3RGYA 5ET6A 5EQ7A 4GX4A 3LSXA 4OANA 3DP6A 1FPGA 3K1PA 1Z7ME 1VFEA 3PMWA 4YMAA 1MQHA 3A3CA 3FXUA 2A5TB 1UIUA 5KCJA 4X1DA 1MPCA 4C1UA 2OPEA 2PFYA 4AB6A 1RDYA 2I3VA 4GL8A 4GBWA 1AIVA 2QVVA 4GWZA 1UTHA 3H4ZA 1B6HA 2WYKA 1YCJA 1FBFA 3RPLA 4RYAA 5M2VA 4F3SA 3O66A 4KCCA 1MDQA 4PBHA 4RJZA 1FJ6A 4R75A 2ESNA 1FBGA 2HPGA 1US4A 4NEDA 4MJOA 3Q25A 1Y1MA 1S9TA 1MXWA 2ZNTA 2VPNA 2VP1A 2I0CA 4ELQA 3DLNA 4ESXA 2QS1A 4TQUQ 4YKJA 1B7UA 3IOTA 4AS4A 3KC0A 1JQFA 5I56B 3W9WA 1KWHA 3K01A 1UQWA 4G68C 4HTGA 3EN3A 1NUYA 4U1OA 3JYRA 4KQPA 4BDMA 3KJTA 4NWDA 2D21A 1I6QA 1Y4CA 1NUZA 1Q9DA 3VV5A 4DI4B 4IGTA 4N15A 1URSA 1NV2A 4Q5TA 5I7IA 3OO6A 3L6HA 1B4ZA 4BDLA 2F7CA 1B0LA 2P2AA 1PB9A 2QFLA 3FASA 2FIXA 2PMSA 2V3QA 2KLFA 2QMWA 3MZ9A 1B0HA 2ZXTA 3OELA 4FE8A 5ESYA 2F7BA 3G3FA 3T1BA 3F11A 5J16A 1ZLQA 1ZBMA 3MPLA 2ONSA 5I3SA 4R2BA 3KJ7A 5DVFA 3RT6B 4H8JA 4P47A 3VVFA 4MBPA 5I59A 5CMKA 3MVYA 2HZKA 3RPLB 4QHQA 3PV0E 2V84A 2PT2A 4N8GA 3MJNA 1LAHE 1JW5A 2DWJA 1LBZA 1ZIUA 4GWOA 1LB8A 5CM6A 1TFAA 1PBPA 1LBYA 1L5TA 1IMFA 1A99A 3A29A 1RDXA 2UYFA 2CZKA 3PPQA 1MS7A 1URGA 1M5EA 4UACA 3ZKKA 4QXDA 5JK4A 1B32A 1XT8A 4BDRA 1XHYA 4NN3A 1FPLA 4DXUA 4P3LA 3T9XB 2O51A 1MQDA 1SVXB 4H1XA 5H8QB 2UXAA 2WYPA 1TT1A 2F3DA 2XXPA 3FGSA 1R9LA 1MPDA 1O64A 1CNQA 3MVXA 3PGFA 4ZECA 1Y9UA 4YB5A 1LFGA 3PD9A 4UA8A 4JSOA 3OO9A 1FPDA 1B3LA 3KOSA 4JB7A 2F6GA 3A09A 2O7IA 4XEQA 4GD5A 3B6QA 4KD5A 5AA1A 3K2DA 1MXZA 2VOZA 5LOMA 1NI9A 1WVJA 4XIGQ 1DK4A 1FSAA 2B3FA 4BDNA 3D4CA 2Q88A 1MXXA 1AWBA 1MH3A 3QYTA 1JVYA 2HXRA 5I59B 5I2KA 1POY1 3KBZA 2CZLA 3LUZA 4FATA 2W7YA 4QSCA 3TTRA 4GFRA 2FA7A 5L8DA 2RINA 3TTNA 4DXBA 4ZEBA 2BJJX 3PPPA 3TEPA 1IMCA 1MXUA 3IO6A 3K02A 3O6IA 4DCXA 2B3BA 1N84A 1FRPA 2HZLA 4RK9A 3O9PA 3TKDA 2OZZA 1FQAA 3SESA 2HEUA 3T96B 4OFJA 2XXVA 4ZDMA 4N6KA 1FTKA 3KN3A 1ZJLA 4O3CA 4I40A 2PBWA 2Y5LA 4QFPA 1A8EA 3IOVA 4OHNA 3ZSFA 2ZZWA 5BWJA 2ABHA 1JETA 4R6KA 4ZEIA 2WX9A 4YU0A 1B3FA 3G3HA 1M5BA 4IR8A 1UTBA 2QMXA 2XXYA 1MQJA 5KDTA 3T9HB 3I6VA 1QJMA 3S2VA 4R2FA 2FYIA 2Q89A 2H25A 3CSGA 4ZS9A 1SW1A 4JXIA 4MNCA 2QRYA 1YYZA 4PGNA 1FBPA 4M1VA 2XA5A 2KQZA 1FCKA 1NH7A 1EU8A 2YJPA 2CMOA 4RPNA 4F3PA 3TTMA 1D4NA 4EF1A 3MBPA 3U8QA 3CFZA 1ZU0A 2H99A 3G7WA 3C32A 4QF9A 3I5OA 2DXRA 3QIMA 4PDDA 4RXLA 4KFQA 1MM7A 3UA8A 3GBAA 4R6HA 5CMBA 1LAXA 5I2KB 2ONRA 4ZEFA 4L17A 4GWYA 2R9JA 1P1UA 5TU0A 4G68B 4Z0IA 3CHGA 3MZBA 4F2QA 4F1VA 2I3WA 1FPFA 2R8TA 4PBQA 4NTLA 3V83A 3VXCA 4Q0CA 3RQTA 3IFAA 2RC9A 3Q26A 1VR5A 1USYH 4NGUA 2KR0A 5DVJA 3O6GA 4MF3A 4YKIA 3IL1B 3IK6B 1XI6A
chains in the Genus database with same CATH topology
5ET6A 4PF8A 5EQ7A 4GX3A 2JJKA 4GX4A 4OANA 1FPGA 1NUXA 4NQ8A 3B8BA 3LV0A 4I3YA 1IMBA 2QVUA 2PFYA 1RDYA 5EYHA 4GBWA 2P3VA 2XWIA 4F18A 2P3NA 2QVVA 4GWZA 4GWXA 4OVSA 1KA0A 5EQAA 4PGPA 4NF0A 2FVZA 2WYKA 1G0HA 1JP4A 4HE2A 2MKZA 1G0IA 4HE0A 4NAPA 1FBFA 3RPLA 1D9QA 4MHFA 4P9KA 4PBHA 1FJ6A 4N8YA 4X04A 4MEVA 1FBGA 2HPGA 1NUWA 4P56A 2WBBA 4MJOA 5DW8A 5LTCA 2XWKA 1KZ8A 4QBAA 1FBDA 2VPNA 2CZHA 3B50A 4JVIA 1EYJA 3BIGA 1LBXA 4AS4A 3KC0A 1LBWA 3MSTA 3W9WA 2ZZVA 2WBDA 2ZZXA 2Y5KA 4X9TA 4MIJA 1NUYA 3EKIA 4O94A 2V4CA 4PFRA 2B4MA 1FTAA 1FPJA 1NUZA 1Q9DA 2Q8MA 4DI4B 4KXPA 4N15A 5IZZA 1NV2A 1NV3A 4LN5A 1VDWA 1FBCA 5I7IA 1FBHA 1FBEA 2GQ1A 4PDHA 2QFLA 1LBVA 5F24A 4OA4A 1YXIA 2FIXA 3BIHA 2V3QA 2XXKA 1IMEA 3QMFA 5ESYA 1FJ9A 4GWWA 3T1BA 4MCOA 5J1DA 1KA1A 2QVRA 2B4LA 1IMAA 5J16A 4F1UA 4DI3D 5I3SA 4XF5A 4P47A 3KC1A 4NHBA 2HZKA 3RPLB 2OX3A 4I3EA 5I5PA 4XFEA 4N8GA 4HCWA 3ROJA 1LBZA 5IZ1A 5CM6A 1LBYA 4NX1A 3E78A 4OVPA 4N17A 4MNIA 1IMFA 4MMPA 4PETA 1INPA 4JVDA 3A29A 1RDXA 2CZKA 2FIEA 4PFIA 4QXDA 5JK4A 2PCRA 4NN3A 4HCYA 3FBPA 1FPLA 2DDKA 4P3LA 2CEXA 4MAGA 1YZ0A 4PAFA 4AS5A 5ET5A 4P1LA 1NV6A 2DE3A 2WYPA 2F3DA 4PAIA 2VPOA 4H46A 1CNQA 5EQ8A 4PFBA 3HFUA 4N6DA 1FPDA 5IM2A 4N81A 4XEQA 4HXVA 1NV0A 3D1RA 1BK4A 1NI9A 2CZIA 1DK4A 2OWZA 1FSAA 1FPIA 4YICA 1SPIA 4GWSA 4PC9A 5ET7A 1AWBA 2HXRA 3ISPA 5FBPA 3KBZA 4UABA 3LUZA 2DE2A 1LEVA 2BJIA 3RYDA 4JVCA 4PF6A 1IMCA 4PTKA 1FPBA 4OVRA 1FRPA 2HZLA 4O7MA 4HE1A 5LDZA 2VT5A 1DCUA 4GX6A 3W9VA 1K9ZA 4N6KA 2PFZA 1EYKA 4I40A 2Y5LA 4PAKA 2ZZWA 2QPQA 2DVZA 2WX9A 3IFCA 2DE4A 1NV5A 1FPKA 2F3BA 2CEYA 4PE3A 4IR8A 5T3JA 4MX6A 4PCDA 3GYYA 4F19A 4P1EA 1IMDA 1K9YA 4O7IA 5ET8A 2WEFA 5IGAA 4P8BA 4MNPA 4X8RA 2FBPA 4N4UA 4N91A 4MNCA 1YYZA 3MYUA 4PGNA 1FBPA 4M1VA 3E79A 2XA5A 2KQZA 1NV1A 4H45A 5EQ9A 4FBPA 4NG7A 4PDDA 1NV7A 4GWUA 1RDZA 4OVQA 3NOHA 2L5VA 5EYGA 2FHYA 1FPEA 1EYIA 4GWYA 3U65A 2XWVA 2XWOA 3PTYA 3SZPA 2HHMA 2Q9TA 3CHGA 2F5XA 4F1VA 1NV4A 5IZ3B 2Q74A 3T0JA 1FPFA 1QGXA 2R8TA 4PBQA 4O8MA 1DBZA 3IFAA 4G61A 4GBVA 4NGUA 2KR0A 4OVTA 4YZZA 5A5LA 3FXBA 5IZ3A 1XI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DDK A;  5ET6 A;  1FTA A;  1FPJ A;  1NUZ A;  4GX3 A;  5EQ7 A;  2JJK A;  4GX4 A;  1YZ0 A;  1FPG A;  3IFC A;  1Q9D A;  4AS5 A;  2Q8M A;  4KXP A;  1NV5 A;  1NUX A;  1NV2 A;  1NV3 A;  1FPK A;  2F3B A;  3B8B A;  5ET5 A;  1NV6 A;  1VDW A;  1FBC A;  4IR8 A;  2F3D A;  5T3J A;  3LV0 A;  1FBH A;  1FBE A;  2GQ1 A;  2QFL A;  4H46 A;  1IMD A;  1LBV A;  5F24 A;  1K9Y A;  1YXI A;  2FIX A;  1CNQ A;  3BIH A;  4O7I A;  5EQ8 A;  5ET8 A;  2WEF A;  1IME A;  3QMF A;  4I3Y A;  5ESY A;  2FBP A;  1FJ9 A;  1FPD A;  4GWW A;  1IMB A;  2QVU A;  1RDY A;  5EYH A;  1YYZ A;  1FBP A;  4GBW A;  2P3V A;  4N81 A;  1KA1 A;  2P3N A;  2QVR A;  2QVV A;  4GWZ A;  4GWX A;  1IMA A;  5J16 A;  4HXV A;  1KA0 A;  1NV0 A;  3D1R A;  5EQA A;  1NV1 A;  5I3S A;  1BK4 A;  4H45 A;  2FVZ A;  5EQ9 A;  1G0H A;  1NI9 A;  1JP4 A;  2CZI A;  1DK4 A;  2OWZ A;  1FSA A;  1FPI A;  4FBP A;  1SPI A;  4HE2 A;  1G0I A;  4HE0 A;  4GWS A;  1NV7 A;  4GWU A;  1FBF A;  1RDZ A;  3RPL A;  5ET7 A;  3KC1 A;  1AWB A;  3FBP A;  1D9Q A;  5EYG A;  3RPL B;  5FBP A;  2FHY A;  1FJ6 A;  2OX3 A;  4I3E A;  3KBZ A;  3LUZ A;  1FBG A;  1FPE A;  1LEV A;  1EYI A;  1NUW A;  4GWY A;  2BJI A;  2WBB A;  4MJO A;  5DW8 A;  3RYD A;  1KZ8 A;  1FBD A;  2HHM A;  3ROJ A;  1LBZ A;  1IMC A;  5IZ1 A;  4PTK A;  2CZH A;  1NV4 A;  1FPB A;  5IZ3 B;  1EYJ A;  2Q74 A;  3T0J A;  1FPF A;  1QGX A;  2R8T A;  1FRP A;  3BIG A;  1DBZ A;  1LBY A;  3IFA A;  1LBX A;  1IMF A;  4HE1 A;  1INP A;  4AS4 A;  3KC0 A;  1LBW A;  4G61 A;  4GBV A;  3A29 A;  1RDX A;  2WBD A;  5LDZ A;  2CZK A;  2Y5K A;  2VT5 A;  1DCU A;  4GX6 A;  1K9Z A;  2FIE A;  1NUY A;  4QXD A;  5A5L A;  1EYK A;  4I40 A;  2Y5L A;  5IZ3 A;  2PCR A;  1XI6 A;  1FPL A; 
#chains in the Genus database with same CATH topology
 3KFM A;  4GX3 A;  2JJK A;  5HM4 B;  1WDN A;  1NUX A;  4QFK A;  1EZP A;  3D4G A;  4LZ8 A;  3MUQ A;  1N0T A;  5EYF A;  3A3U A;  2OWS A;  4MLV A;  1UTB B;  1OVT A;  2DVC A;  4EUO A;  5KDT B;  2Y7P A;  4OVS A;  2UVJ A;  4IY5 A;  3C9H A;  5I57 A;  2FVZ A;  2A5T A;  3E9X A;  4HE2 A;  3VVE A;  4F39 A;  3HO7 A;  1LAG E;  2XXI A;  3N5L A;  3FXQ A;  1SI0 A;  3MQ9 A;  3UN6 A;  4X1B A;  4P9K A;  4X04 A;  4N6P A;  4R73 A;  1B5J A;  3FZV A;  4FAJ A;  1GR2 A;  2O1L A;  5ICQ A;  1KZ8 A;  4QBA A;  1FBD A;  5HPQ A;  2QSX A;  3PPO A;  3G3K A;  3O28 A;  3MC2 A;  5TPA B;  3EQ1 A;  4XKN A;  1LBX A;  1T0K A;  4PP0 A;  4FJP A;  4G4P A;  3ONM A;  3MST A;  5I58 B;  4I8C A;  2OK2 A;  4DDD A;  1Y3N A;  2ZZX A;  1J1N A;  5IAI A;  4IO3 A;  3LBS A;  2O7U A;  2G29 A;  2Q2A A;  1R9Q A;  4U4S A;  3TPA A;  4AB5 A;  3HV1 A;  1MY3 A;  4O94 A;  3FVO A;  2B4M A;  1FQE A;  4F3B A;  2ZYO A;  2GHB A;  3MP6 A;  2F78 A;  1NV3 A;  5EHM A;  4YMB A;  3SEW A;  1VDW A;  3C4M A;  2GQ1 A;  4PDH A;  1H76 A;  2VD2 A;  3HPI A;  2DWA A;  1MPB A;  3LUY A;  2AIX A;  4GWW A;  1N76 A;  3FV2 A;  5J1D A;  2B4L A;  5H8F A;  1B40 A;  1PBQ A;  2Z8F A;  1F9B A;  4XF5 A;  3U72 A;  5L9M A;  3K4U A;  4LQ5 A;  2ALU A;  2YLN A;  4NF8 A;  5I57 B;  1LB9 A;  4XXU A;  1QUK A;  1PB8 A;  3JV9 A;  3KC1 A;  4NHB A;  3K6W A;  3VVD A;  2O84 X;  1MY1 A;  4POX A;  1NFT A;  2OX3 A;  1FQB A;  1M5F A;  4WEP A;  4ELR A;  2XXU A;  1BP5 A;  5I5P A;  2XD3 A;  4G2Z A;  3V5A A;  3B6W A;  3TCH A;  1ANF A;  2A5S A;  5IZ1 A;  3K6V A;  3QUF A;  3IJO B;  4OQO A;  3RY3 A;  3FVG A;  4OVP A;  3H6V A;  4MNI A;  4MMP A;  1HSJ A;  2ANJ A;  1NL5 A;  1INP A;  2XX8 A;  2NUV A;  3AXF A;  4PFW A;  4JWX A;  2F7A A;  2HAU A;  4HS7 A;  4PFI A;  3QXM A;  3FJM A;  3FBP A;  1PDA A;  4DIG A;  2Y7I A;  2R6G E;  4PAF A;  2DE3 A;  1LCF A;  2XD2 A;  4PE5 B;  4YKP A;  1FTO A;  4KPT A;  1XVX A;  3Q29 A;  5EQ8 A;  4ONY A;  1OMP A;  3C35 A;  3MWB A;  4OER A;  1SI1 A;  4N6D A;  3V8X B;  1DTZ A;  5IM2 A;  1JW1 A;  5H8Q A;  2HAV A;  4ZE9 A;  4E0X A;  3U1O A;  4N81 A;  3FVN A;  5TP9 A;  4BDQ A;  1NV0 A;  5H8F B;  1BK4 A;  1RYX A;  2OWZ A;  1SPI A;  4GWS A;  4DXC A;  4NF8 B;  5ET7 A;  2WKY A;  2OCU A;  3MP8 A;  3C34 A;  5FBP A;  3LSF B;  2AL4 A;  3USD A;  3FIR A;  4PQJ A;  2DE2 A;  3M3F A;  4QFN A;  3MPK A;  3HN0 A;  4OFO A;  2BJI A;  1IIW A;  4PF6 A;  5CBS A;  3K1N A;  3V89 B;  1FPB A;  1YAE A;  4HE1 A;  1P1N A;  2VHA A;  3CFX A;  3MVZ A;  5LDZ A;  1H45 A;  3MVW A;  1LGB C;  2DXY A;  2VD3 A;  2D5W A;  4OEU A;  1MQI A;  3FVK A;  4MLQ A;  3T9U A;  3FUZ A;  4EXL A;  5ITP A;  2DVZ A;  3UOR A;  2H5Y A;  1FPK A;  3G3G A;  1B5I A;  2CEY A;  1ZKB A;  5T3J A;  1MY2 A;  3DM0 A;  1FQC A;  3GYY A;  2PVU A;  4PCD A;  3DP8 A;  4P1E A;  2XXT A;  3QK6 A;  4O7I A;  5ET8 A;  2WEF A;  2QL3 A;  2FBP A;  4IO2 A;  3PD8 A;  3K6U A;  3T93 B;  2M8C A;  2PT1 A;  3E79 A;  3IOU A;  3CSB A;  1LBB A;  2ZMB A;  1P1O A;  5BUU A;  3TCF A;  4FEC A;  3SEU A;  1NV1 A;  5TP9 B;  5EQ9 A;  3RT8 A;  4FBP A;  4NG7 A;  3H03 A;  1IXC A;  1TXF A;  5CBR A;  1NV7 A;  4GWU A;  3PMX A;  5ELV A;  4QFL A;  3FXR A;  3TZA A;  1MQG A;  3T9V A;  5JEI A;  3T22 A;  5DVI A;  2Y7R A;  1FPE A;  1EYI A;  2F97 A;  3U65 A;  3PUY E;  3OO8 A;  1R1N A;  3PTY A;  3VE1 B;  3TQW A;  4IY6 A;  2QS2 A;  2F5X A;  5IZ3 B;  1QGX A;  3SET A;  4IO4 A;  1DBZ A;  3N94 A;  3N6U A;  3P7I A;  2XXW A;  3TCG A;  4GBV A;  2I0B A;  4U22 A;  2DQV A;  2ZNU A;  2NOO A;  4G68 A;  3VLW A;  1N7W A;  2HFB A;  3THI A;  4OVT A;  1H44 A;  2UVG A;  5F1Q A;  1DPP A;  2RCA A;  4FIM A;  2Z8D A;  4PF8 A;  4JWY A;  4GRK A;  1NH8 A;  4NQ8 A;  1RYO A;  2YPN A;  1LBC A;  4OFL A;  2X7Q A;  3CFL A;  1SYH A;  4QRZ A;  4IO7 A;  1EZO A;  1MY0 A;  4OES A;  1B46 A;  2IA4 A;  2O68 A;  5H8S A;  4I3Y A;  5ISU A;  4RK2 A;  3SDF A;  1IMB A;  1SW2 A;  2XWI A;  2DWH A;  4GWX A;  4YAH X;  1II5 A;  3R7X A;  4ZE8 A;  3H6W A;  4PGP A;  4NF0 A;  4P0G A;  3O97 A;  1G0H A;  2RKM A;  3K1M A;  2DWI A;  2V25 A;  1JW4 A;  1B1X A;  4OXV A;  1P1W A;  3SKP A;  2OPD A;  2OLB A;  4N8Y A;  1XVY A;  2REJ A;  2ONK E;  1DPE A;  4OWD A;  3ECR A;  3TMG A;  4P56 A;  2WBB A;  5DW8 A;  4U1Z A;  5LTC A;  1D3K A;  2XWK A;  1IEJ A;  4Q8R A;  4N13 A;  3OEK A;  2RC7 A;  3B50 A;  4JVI A;  4RA1 A;  1MM6 A;  3PUX E;  3TDJ A;  4XTC Q;  3Q27 A;  3KZG A;  1AOV A;  3FAT A;  1LBW A;  2ZZV A;  2FNC A;  2WBD A;  2Y5K A;  3IO4 A;  3WAF A;  2V4C A;  4PFR A;  1US5 A;  2NXO A;  1FPJ A;  5TPA A;  2F8D A;  3TQL A;  4TLL B;  4EXK A;  4FEB A;  5I58 A;  3KN8 A;  3KG2 A;  1IUD A;  4LN5 A;  5AA2 A;  1B7H A;  5F24 A;  3BIH A;  1HSE A;  3K00 A;  2XXK A;  2THI A;  3K0V A;  5FTH A;  1UIV A;  1IME A;  3OSR A;  3QMF A;  3C31 A;  5JTY B;  3LC8 A;  3PMV A;  3UGW A;  4GF8 A;  1USY E;  4OET A;  4IB2 A;  3B7D A;  2QVR A;  2E1S A;  1IMA A;  4F1U A;  2F34 A;  4POW A;  1SD3 A;  3S9E A;  4ECF A;  3CI8 A;  5L9O A;  1NMU A;  4MH5 A;  3W15 C;  1D9Y A;  3LSL A;  4LZ5 A;  1JEV A;  2Z8E A;  4C0R A;  1PB7 A;  1GTK A;  1XS5 A;  3U94 A;  3GXA A;  2Z23 A;  4IO6 A;  1BKA A;  3KN7 A;  1O7T A;  1SW5 A;  4NMY A;  4NX1 A;  3E78 A;  3U93 A;  4O3B A;  1N04 A;  4WXJ A;  4AQ4 A;  4JVD A;  3M8U A;  1A40 A;  5F7V A;  3TOD A;  4PFY A;  3TTL A;  4NF6 B;  1TFD A;  4OTE A;  1DMB A;  3S4U A;  4YKK A;  1A54 A;  4I1D A;  4HCY A;  4GL0 A;  5DEX A;  4DZ1 A;  2Q8J A;  2CEX A;  4MAG A;  5FTI A;  5A5X A;  1O63 A;  3T66 A;  3BFU A;  5ET5 A;  1IXI A;  4P0I A;  4ZZA A;  1LCT A;  5AA2 B;  4H46 A;  3OD7 A;  4NF5 A;  5AA3 A;  4PFB A;  5CI5 A;  3LR1 A;  3N26 A;  4KYE A;  3ZS6 A;  2O6A A;  1IQ7 A;  2V93 A;  3PUZ E;  3BBR A;  3KEI A;  1CB6 A;  3O2A A;  2Q2C A;  2LAO A;  3D1R A;  3S9N C;  4JSD A;  1MY4 A;  3TYH A;  2CZI A;  1FPI A;  4PC9 A;  3IB1 A;  4RNS A;  3PUV E;  3ISP A;  4UAB A;  1AL3 A;  1LEV A;  3R6U A;  3SEX A;  1QKB A;  4JVC A;  4KCD A;  3FJG A;  1VFD A;  4PTK A;  4N07 A;  3VLU A;  4OVR A;  1OIB A;  4H0W A;  3MP1 A;  2GRV A;  1OQG A;  4H65 A;  3CVG A;  4FED A;  4H5G A;  1ATG A;  3B6T A;  1QVS A;  5K2X A;  1IIT A;  1WOD A;  4GX6 A;  2X7P A;  1K9Z A;  2V3T A;  3OOA A;  5CC2 A;  2PFZ A;  1I69 A;  4ELP A;  1P99 A;  3IB0 A;  4PAK A;  1Q35 A;  2AL5 A;  4XKP A;  4IGR A;  2QS3 A;  3CRB A;  5DEX B;  5EHS A;  2P0S A;  1URD A;  1XOC A;  1MH4 A;  2PX1 A;  3KGC A;  2DE4 A;  3U92 A;  3MAM A;  5A5X B;  2F3B A;  2XXR A;  4DCY A;  4ISU A;  1R6Z A;  2UVI A;  4F19 A;  1IMD A;  1K9Y A;  1SDX A;  4YB7 A;  4M4G A;  1QUI A;  4JDF A;  5IGA A;  4NF5 B;  4KI0 E;  4X8R A;  2O69 A;  1H3D A;  4GVO A;  5I84 A;  1OLA A;  3BFT A;  3IJX B;  3SER A;  1MXY A;  4NWC A;  4GXS B;  1Y20 A;  4H45 A;  1SQY A;  1Y3P A;  3G3J A;  4G8M A;  1ZMG A;  1RDZ A;  1SBP A;  1CE2 A;  2P1S A;  4OVQ A;  4KYS A;  3K6X A;  2L5V A;  5EYG A;  1B5H A;  1MG1 A;  2OWT A;  4HW8 A;  1IXG A;  1GV8 A;  4KYD A;  2XWV A;  1NNP A;  2GHA A;  1OVB A;  2I48 A;  2HQ0 A;  3SZP A;  1B4H A;  1TWY A;  2Q9T A;  3EHU A;  4NE4 A;  1NV4 A;  1MRP A;  3CIJ A;  4EDP A;  4O8M A;  1VE4 A;  3QAX A;  4P11 A;  1NNK A;  1AMF A;  5AA4 A;  3FJ7 A;  3ODB A;  2H4I A;  1B7Z A;  1RKM A;  4LUB A;  5A5L A;  2DS9 A;  1POT A;  3SEY A;  2I58 A;  5H8N A;  3FXB A;  5IZ3 A;  5IKB A;  3IB2 A;  2G93 A;  5KCJ B;  2D3I A;  3HCQ A;  1N3W A;  3OSQ A;  1VSO A;  1QKA A;  4RPO A;  3B8B A;  5DT6 A;  3IX1 A;  3LV0 A;  1N7X A;  1UTH B;  4PFT A;  2GFE A;  3OEM A;  3RN8 A;  1B05 A;  3KSJ A;  1DSN A;  2QVU A;  5EYH A;  5CMM A;  2P3V A;  1B51 A;  4F18 A;  2P3N A;  1SYI A;  3VFJ A;  4EF2 A;  4ELO A;  4K3F A;  1KA0 A;  4EQ9 A;  5EQA A;  4THI A;  3ZKL A;  3PPR A;  1DOT A;  1JP4 A;  2XHD A;  1I6B A;  2Y7W A;  2XX9 A;  2MKZ A;  1G0I A;  4HE0 A;  4NAP A;  4IO5 A;  1IXH A;  4LZ7 A;  1D9V A;  1M5C A;  2R71 A;  1D9Q A;  4MHF A;  4I62 A;  2REG A;  4MEV A;  4LVQ A;  1NUW A;  4FOR A;  1S7Y A;  3ILU B;  1N3X A;  3OO7 A;  1OQH A;  3RLF E;  2CZH A;  1EYJ A;  3TUS A;  2V3U A;  3BIG A;  3MZ1 A;  4GQO A;  2DYX A;  3EPE A;  2O1M A;  3GZG A;  4MFI A;  4H8I A;  4F1Y A;  3VXB A;  3VDF A;  4XKR A;  3M3L A;  5AA4 B;  4ZED A;  4F29 A;  4X9T A;  1LFH A;  4MIJ A;  4WKM A;  5FHO A;  1FQD A;  3JZJ A;  1FTL A;  3EKI A;  3QUJ A;  2Y84 A;  4JBZ A;  1B2H A;  3OMB A;  5AE4 A;  3GBB A;  4H67 A;  5H8N B;  1FTA A;  3L6G A;  4U23 A;  1B1H A;  4TOZ A;  2Q8M A;  5IZZ A;  4KXP A;  3H7M A;  4GLI A;  1FBC A;  4XKQ A;  1FTM A;  1JNF A;  1FBH A;  1FBE A;  3VLV A;  1LBV A;  4LQ2 A;  1H43 A;  4OA4 A;  1YXI A;  1PEB A;  4U4X A;  1OLC A;  2H98 A;  2ZYK A;  2HXW A;  4RY1 A;  1Q1K A;  4EQ7 A;  1FJ9 A;  3UP9 A;  4MCO A;  3N6T A;  3KOT A;  5ICT A;  1KA1 A;  1MXV A;  1Y1Z A;  4DI3 D;  3H06 B;  4OVJ A;  1Y3Q A;  3UK4 A;  5JTY A;  3UIF A;  1BLF A;  4LP2 B;  1NNF A;  4I3E A;  4Q30 B;  1B52 A;  2DP8 A;  4GIZ A;  3QSL A;  3SEV A;  4QSD A;  4KHZ E;  4QFO A;  3CG1 A;  4EQB A;  4XFE A;  3DP4 A;  1P1Q A;  2ZYN A;  4HCW A;  4QSE A;  3ROJ A;  4LA9 A;  3HST A;  3PU5 A;  1B3E A;  1EH3 A;  3S9M C;  1PC3 A;  2F6P A;  4N17 A;  3HHF A;  4R6Y A;  4PET A;  1S50 A;  1ELJ A;  2E0S A;  1QUJ A;  3GLB A;  3IOW A;  4LON B;  1Z7N E;  2FIE A;  4OEN A;  4YB6 A;  2PCR A;  2I6E A;  2QS4 A;  2DDK A;  2RCB A;  1YZ0 A;  5H8H A;  1FW0 A;  4U21 A;  2H9B A;  3M3K A;  4AS5 A;  2RF1 A;  4ZEK A;  3EHT A;  1B9J A;  4P1L A;  1NV6 A;  2F35 A;  4OYV A;  4PAI A;  3RUM A;  2VPO A;  4NF6 A;  2NVU B;  3FD3 A;  4BDO A;  4PFU A;  1JEU A;  3ILT B;  2AYS A;  3C33 A;  4KR5 A;  2RC8 A;  2VGQ A;  3O29 A;  4R74 A;  3HFU A;  2Z22 A;  4G8N A;  1FTJ A;  2I4B A;  3DEL B;  3Q28 A;  1QUL A;  1YTV A;  4HXV A;  2I49 A;  3O6H A;  1LST A;  2Y7K A;  4O3A A;  4E0W A;  3MW0 A;  3I3V A;  1A8F A;  3H3G A;  1XC1 A;  2HCA A;  4YIC A;  3TFL A;  2OJT A;  3TAJ A;  3WAE A;  2UVH A;  5AA2 D;  5I2N A;  3EHS A;  3IOR A;  1AH5 A;  4OZ9 A;  4ZZE A;  3OXN A;  4GXA A;  4F3G A;  5K2Y A;  3RYD A;  4F2O A;  1A7L A;  3KSX A;  4NF4 A;  3KBR A;  5FHN A;  2XXH A;  2IEE A;  2XX7 A;  1LAF E;  4H5F A;  2UYE A;  1NKX A;  1GGG A;  4O7M A;  3E13 X;  1HSL A;  3H6T A;  3RTF B;  4ESW A;  3S9L C;  3R26 A;  4WED A;  4DE8 A;  3CR9 A;  1NNT A;  1EZ9 A;  3LSW A;  2VT5 A;  1DCU A;  4H6D A;  3W9V A;  4LAT A;  3IR1 A;  1EYK A;  2F36 A;  3G3I A;  3PUW E;  2QPQ A;  4JWO A;  2X26 A;  3IFC A;  4TLM B;  1MDP 1;  1NV5 A;  5H8H B;  3RNN A;  5ITO A;  4ND9 A;  4PE3 A;  4I9D A;  4MX6 A;  3E4R A;  3TTK A;  1SW4 A;  3TEL A;  3IAZ A;  3HHG A;  4X48 A;  1A55 A;  1GVC A;  4R72 A;  4P8B A;  5CRY A;  4MNP A;  4G77 A;  2OBG A;  4N4U A;  4N91 A;  4DLD A;  3MYU A;  2ZYM A;  2QJE A;  3FV1 A;  1ZTY A;  4BLA A;  1Y4T A;  3E3K A;  4U2R A;  3CG3 A;  2PYY A;  5HBC A;  2NWJ A;  1LLS A;  2XXX A;  5CMC A;  1DTG A;  5FHM A;  3C36 A;  1BIY A;  4F22 A;  2DOJ A;  2I4C A;  3BKI B;  4Z7E A;  2XXQ A;  3RPW A;  5DTB A;  5KZT A;  1I6A A;  3NOH A;  5B70 A;  5DYH A;  4G8H A;  4R9G A;  2FHY A;  5I2N B;  5L9S A;  3PPN A;  2GH9 A;  2XWO A;  2DSF A;  1B3H A;  1JVX A;  4GOT A;  4R9F A;  2HHM A;  4NF4 B;  3RTW B;  2Q74 A;  3EF7 A;  3T0J A;  1IZ1 A;  1QW0 A;  1BTJ A;  5I56 A;  1FQF A;  2ZNS A;  4G61 A;  4C1T A;  5B7D A;  2B65 A;  4F31 B;  1LFI A;  1YPN A;  3OEN A;  4OEV A;  1M5D A;  4YZZ A;  1B3G A;  4OMB A;  1B58 A;  3H6U A;  3RGY A;  5ET6 A;  5EQ7 A;  4GX4 A;  3LSX A;  4OAN A;  3DP6 A;  1FPG A;  3K1P A;  1Z7M E;  1VFE A;  3PMW A;  4YMA A;  1MQH A;  3A3C A;  3FXU A;  2A5T B;  1UIU A;  5KCJ A;  4X1D A;  1MPC A;  4C1U A;  2OPE A;  2PFY A;  4AB6 A;  1RDY A;  2I3V A;  4GL8 A;  4GBW A;  1AIV A;  2QVV A;  4GWZ A;  1UTH A;  3H4Z A;  1B6H A;  2WYK A;  1YCJ A;  1FBF A;  3RPL A;  4RYA A;  5M2V A;  4F3S A;  3O66 A;  4KCC A;  1MDQ A;  4PBH A;  4RJZ A;  1FJ6 A;  4R75 A;  2ESN A;  1FBG A;  2HPG A;  1US4 A;  4NED A;  4MJO A;  3Q25 A;  1Y1M A;  1S9T A;  1MXW A;  2ZNT A;  2VPN A;  2VP1 A;  2I0C A;  4ELQ A;  3DLN A;  4ESX A;  2QS1 A;  4TQU Q;  4YKJ A;  1B7U A;  3IOT A;  4AS4 A;  3KC0 A;  1JQF A;  5I56 B;  3W9W A;  1KWH A;  3K01 A;  1UQW A;  4G68 C;  4HTG A;  3EN3 A;  1NUY A;  4U1O A;  3JYR A;  4KQP A;  4BDM A;  3KJT A;  4NWD A;  2D21 A;  1I6Q A;  1Y4C A;  1NUZ A;  1Q9D A;  3VV5 A;  4DI4 B;  4IGT A;  4N15 A;  1URS A;  1NV2 A;  4Q5T A;  5I7I A;  3OO6 A;  3L6H A;  1B4Z A;  4BDL A;  2F7C A;  1B0L A;  2P2A A;  1PB9 A;  2QFL A;  3FAS A;  2FIX A;  2PMS A;  2V3Q A;  2KLF A;  2QMW A;  3MZ9 A;  1B0H A;  2ZXT A;  3OEL A;  4FE8 A;  5ESY A;  2F7B A;  3G3F A;  3T1B A;  3F11 A;  5J16 A;  1ZLQ A;  1ZBM A;  3MPL A;  2ONS A;  5I3S A;  4R2B A;  3KJ7 A;  5DVF A;  3RT6 B;  4H8J A;  4P47 A;  3VVF A;  4MBP A;  5I59 A;  5CMK A;  3MVY A;  2HZK A;  3RPL B;  4QHQ A;  3PV0 E;  2V84 A;  2PT2 A;  4N8G A;  3MJN A;  1LAH E;  1JW5 A;  2DWJ A;  1LBZ A;  1ZIU A;  4GWO A;  1LB8 A;  5CM6 A;  1TFA A;  1PBP A;  1LBY A;  1L5T A;  1IMF A;  1A99 A;  3A29 A;  1RDX A;  2UYF A;  2CZK A;  3PPQ A;  1MS7 A;  1URG A;  1M5E A;  4UAC A;  3ZKK A;  4QXD A;  5JK4 A;  1B32 A;  1XT8 A;  4BDR A;  1XHY A;  4NN3 A;  1FPL A;  4DXU A;  4P3L A;  3T9X B;  2O51 A;  1MQD A;  1SVX B;  4H1X A;  5H8Q B;  2UXA A;  2WYP A;  1TT1 A;  2F3D A;  2XXP A;  3FGS A;  1R9L A;  1MPD A;  1O64 A;  1CNQ A;  3MVX A;  3PGF A;  4ZEC A;  1Y9U A;  4YB5 A;  1LFG A;  3PD9 A;  4UA8 A;  4JSO A;  3OO9 A;  1FPD A;  1B3L A;  3KOS A;  4JB7 A;  2F6G A;  3A09 A;  2O7I A;  4XEQ A;  4GD5 A;  3B6Q A;  4KD5 A;  5AA1 A;  3K2D A;  1MXZ A;  2VOZ A;  5LOM A;  1NI9 A;  1WVJ A;  4XIG Q;  1DK4 A;  1FSA A;  2B3F A;  4BDN A;  3D4C A;  2Q88 A;  1MXX A;  1AWB A;  1MH3 A;  3QYT A;  1JVY A;  2HXR A;  5I59 B;  5I2K A;  1POY 1;  3KBZ A;  2CZL A;  3LUZ A;  4FAT A;  2W7Y A;  4QSC A;  3TTR A;  4GFR A;  2FA7 A;  5L8D A;  2RIN A;  3TTN A;  4DXB A;  4ZEB A;  2BJJ X;  3PPP A;  3TEP A;  1IMC A;  1MXU A;  3IO6 A;  3K02 A;  3O6I A;  4DCX A;  2B3B A;  1N84 A;  1FRP A;  2HZL A;  4RK9 A;  3O9P A;  3TKD A;  2OZZ A;  1FQA A;  3SES A;  2HEU A;  3T96 B;  4OFJ A;  2XXV A;  4ZDM A;  4N6K A;  1FTK A;  3KN3 A;  1ZJL A;  4O3C A;  4I40 A;  2PBW A;  2Y5L A;  4QFP A;  1A8E A;  3IOV A;  4OHN A;  3ZSF A;  2ZZW A;  5BWJ A;  2ABH A;  1JET A;  4R6K A;  4ZEI A;  2WX9 A;  4YU0 A;  1B3F A;  3G3H A;  1M5B A;  4IR8 A;  1UTB A;  2QMX A;  2XXY A;  1MQJ A;  5KDT A;  3T9H B;  3I6V A;  1QJM A;  3S2V A;  4R2F A;  2FYI A;  2Q89 A;  2H25 A;  3CSG A;  4ZS9 A;  1SW1 A;  4JXI A;  4MNC A;  2QRY A;  1YYZ A;  4PGN A;  1FBP A;  4M1V A;  2XA5 A;  2KQZ A;  1FCK A;  1NH7 A;  1EU8 A;  2YJP A;  2CMO A;  4RPN A;  4F3P A;  3TTM A;  1D4N A;  4EF1 A;  3MBP A;  3U8Q A;  3CFZ A;  1ZU0 A;  2H99 A;  3G7W A;  3C32 A;  4QF9 A;  3I5O A;  2DXR A;  3QIM A;  4PDD A;  4RXL A;  4KFQ A;  1MM7 A;  3UA8 A;  3GBA A;  4R6H A;  5CMB A;  1LAX A;  5I2K B;  2ONR A;  4ZEF A;  4L17 A;  4GWY A;  2R9J A;  1P1U A;  5TU0 A;  4G68 B;  4Z0I A;  3CHG A;  3MZB A;  4F2Q A;  4F1V A;  2I3W A;  1FPF A;  2R8T A;  4PBQ A;  4NTL A;  3V83 A;  3VXC A;  4Q0C A;  3RQT A;  3IFA A;  2RC9 A;  3Q26 A;  1VR5 A;  1USY H;  4NGU A;  2KR0 A;  5DVJ A;  3O6G A;  4MF3 A;  4YKI A;  3IL1 B;  3IK6 B;  1XI6 A; 
#chains in the Genus database with same CATH homology
 5ET6 A;  4PF8 A;  5EQ7 A;  4GX3 A;  2JJK A;  4GX4 A;  4OAN A;  1FPG A;  1NUX A;  4NQ8 A;  3B8B A;  3LV0 A;  4I3Y A;  1IMB A;  2QVU A;  2PFY A;  1RDY A;  5EYH A;  4GBW A;  2P3V A;  2XWI A;  4F18 A;  2P3N A;  2QVV A;  4GWZ A;  4GWX A;  4OVS A;  1KA0 A;  5EQA A;  4PGP A;  4NF0 A;  2FVZ A;  2WYK A;  1G0H A;  1JP4 A;  4HE2 A;  2MKZ A;  1G0I A;  4HE0 A;  4NAP A;  1FBF A;  3RPL A;  1D9Q A;  4MHF A;  4P9K A;  4PBH A;  1FJ6 A;  4N8Y A;  4X04 A;  4MEV A;  1FBG A;  2HPG A;  1NUW A;  4P56 A;  2WBB A;  4MJO A;  5DW8 A;  5LTC A;  2XWK A;  1KZ8 A;  4QBA A;  1FBD A;  2VPN A;  2CZH A;  3B50 A;  4JVI A;  1EYJ A;  3BIG A;  1LBX A;  4AS4 A;  3KC0 A;  1LBW A;  3MST A;  3W9W A;  2ZZV A;  2WBD A;  2ZZX A;  2Y5K A;  4X9T A;  4MIJ A;  1NUY A;  3EKI A;  4O94 A;  2V4C A;  4PFR A;  2B4M A;  1FTA A;  1FPJ A;  1NUZ A;  1Q9D A;  2Q8M A;  4DI4 B;  4KXP A;  4N15 A;  5IZZ A;  1NV2 A;  1NV3 A;  4LN5 A;  1VDW A;  1FBC A;  5I7I A;  1FBH A;  1FBE A;  2GQ1 A;  4PDH A;  2QFL A;  1LBV A;  5F24 A;  4OA4 A;  1YXI A;  2FIX A;  3BIH A;  2V3Q A;  2XXK A;  1IME A;  3QMF A;  5ESY A;  1FJ9 A;  4GWW A;  3T1B A;  4MCO A;  5J1D A;  1KA1 A;  2QVR A;  2B4L A;  1IMA A;  5J16 A;  4F1U A;  4DI3 D;  5I3S A;  4XF5 A;  4P47 A;  3KC1 A;  4NHB A;  2HZK A;  3RPL B;  2OX3 A;  4I3E A;  5I5P A;  4XFE A;  4N8G A;  4HCW A;  3ROJ A;  1LBZ A;  5IZ1 A;  5CM6 A;  1LBY A;  4NX1 A;  3E78 A;  4OVP A;  4N17 A;  4MNI A;  1IMF A;  4MMP A;  4PET A;  1INP A;  4JVD A;  3A29 A;  1RDX A;  2CZK A;  2FIE A;  4PFI A;  4QXD A;  5JK4 A;  2PCR A;  4NN3 A;  4HCY A;  3FBP A;  1FPL A;  2DDK A;  4P3L A;  2CEX A;  4MAG A;  1YZ0 A;  4PAF A;  4AS5 A;  5ET5 A;  4P1L A;  1NV6 A;  2DE3 A;  2WYP A;  2F3D A;  4PAI A;  2VPO A;  4H46 A;  1CNQ A;  5EQ8 A;  4PFB A;  3HFU A;  4N6D A;  1FPD A;  5IM2 A;  4N81 A;  4XEQ A;  4HXV A;  1NV0 A;  3D1R A;  1BK4 A;  1NI9 A;  2CZI A;  1DK4 A;  2OWZ A;  1FSA A;  1FPI A;  4YIC A;  1SPI A;  4GWS A;  4PC9 A;  5ET7 A;  1AWB A;  2HXR A;  3ISP A;  5FBP A;  3KBZ A;  4UAB A;  3LUZ A;  2DE2 A;  1LEV A;  2BJI A;  3RYD A;  4JVC A;  4PF6 A;  1IMC A;  4PTK A;  1FPB A;  4OVR A;  1FRP A;  2HZL A;  4O7M A;  4HE1 A;  5LDZ A;  2VT5 A;  1DCU A;  4GX6 A;  3W9V A;  1K9Z A;  4N6K A;  2PFZ A;  1EYK A;  4I40 A;  2Y5L A;  4PAK A;  2ZZW A;  2QPQ A;  2DVZ A;  2WX9 A;  3IFC A;  2DE4 A;  1NV5 A;  1FPK A;  2F3B A;  2CEY A;  4PE3 A;  4IR8 A;  5T3J A;  4MX6 A;  4PCD A;  3GYY A;  4F19 A;  4P1E A;  1IMD A;  1K9Y A;  4O7I A;  5ET8 A;  2WEF A;  5IGA A;  4P8B A;  4MNP A;  4X8R A;  2FBP A;  4N4U A;  4N91 A;  4MNC A;  1YYZ A;  3MYU A;  4PGN A;  1FBP A;  4M1V A;  3E79 A;  2XA5 A;  2KQZ A;  1NV1 A;  4H45 A;  5EQ9 A;  4FBP A;  4NG7 A;  4PDD A;  1NV7 A;  4GWU A;  1RDZ A;  4OVQ A;  3NOH A;  2L5V A;  5EYG A;  2FHY A;  1FPE A;  1EYI A;  4GWY A;  3U65 A;  2XWV A;  2XWO A;  3PTY A;  3SZP A;  2HHM A;  2Q9T A;  3CHG A;  2F5X A;  4F1V A;  1NV4 A;  5IZ3 B;  2Q74 A;  3T0J A;  1FPF A;  1QGX A;  2R8T A;  4PBQ A;  4O8M A;  1DBZ A;  3IFA A;  4G61 A;  4GBV A;  4NGU A;  2KR0 A;  4OVT A;  4YZZ A;  5A5L A;  3FXB A;  5IZ3 A;  1XI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...