4O7IA

Structural and functional characterization of 3'(2'),5'-bisphosphate nucleotidase1 from entamoeba histolytica
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
317
structure length
317
Chain Sequence
MSFDKELALALEIVQVSCKITTSVAEHTLTDQTQIKNDKSPVTVGDYSVQAYVNKKIHETFPEDQIVAEEDTKTIPEDIFAKVCKHVQIYSDMKDDEIRKSIDLGNSTGGKGRHWVLDPIDGTLGFLRREQYAVCLAFMIDGDIKVGVLGCPNFEGGLIVAAQKGCGAKMFSVNDIKNGKDIHVSTTPKTSDMCFCESVEVSHTDQSRSKTITERLQVTKPPVRMDSQCKYMAIASGRADVYLRLPRNLSYQEKIWDHAAGYLIVKEAGGKVTDIYGNDLDFSLGRTLCNNHGIVASNGILHEETVNVVKDVLSDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural elucidation of a dual-activity PAP phosphatase-1 from Entamoeba histolytica capable of hydrolysing both 3'-phosphoadenosine 5'-phosphate and inositol 1,4-bisphosphate
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase, putative
total genus 117
structure length 317
sequence length 317
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4o7iA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4o7iA02
1IMDA 1DCUA 3IFCA 4O7IA 1EYKA 4KXPA 5ET6A 4HE0A 4GWUA 1IMBA 3D1RA 1FBCA 2QVRA 4HE2A 5EYHA 4FBPA 2QFLA 1INPA 4N81A 1FBDA 2GQ1A 4PTKA 3RYDA 3FBPA 4MJOA 5EQ8A 5ET7A 5DW8A 5ET5A 1NV4A 1NUYA 5ESYA 1FJ6A 2Q8MA 5LDZA 1FPIA 1YZ0A 1FPLA 1FPJA 1K9YA 1G0IA 1LBXA 2JJKA 4QXDA 1FPFA 4AS4A 1FPDA 3KC0A 5FBPA 3LUZA 2DDKA 1NV7A 4G61A 5EQ7A 2FIXA 4H45A 4I3YA 1FPGA 1FBEA 1IMFA 2HHMA 5ET8A 4GWXA 2WBDA 3B8BA 1FPKA 4GWSA 1FJ9A 3BIGA 5J16A 5EQAA 1JP4A 2VT5A 1VDWA 1LBYA 1RDYA 2FBPA 4I40A 1EYIA 3LV0A 1FSAA 1NV6A 1FPEA 1LBZA 1NV5A 3RPLA 2FHYA 5I3SA 1FBFA 1NUXA 3ROJA 2P3VA 2Q74A 3KBZA 3T0JA 1DBZA 1YXIA 1KA1A 1FPBA 1KA0A 4H46A 1YYZA 1CNQA 4GX6A 5IZ1A 4I3EA 2F3BA 5IZ3A 5IZ3B 1K9ZA 3RPLB 1NV2A 1SPIA 2CZHA 1NI9A 1NV0A 3IFAA 5F24A 2P3NA 1DK4A 2FIEA 1FBHA 1XI6A 1AWBA 4GWWA 4GWZA 1IMEA 3A29A 1IMCA 1FBGA 2CZIA 3KC1A 2F3DA 1FRPA 2Y5KA 1IMAA 1FBPA 1RDZA 4HE1A 4GX3A 2OX3A 2FVZA 5T3JA 4GX4A 4IR8A 1KZ8A 4GBVA 1EYJA 2PCRA 1BK4A 3QMFA 4AS5A 2WBBA 5EQ9A 1LEVA 1FTAA 2BJIA 1NV1A 1RDXA 4HXVA 2WEFA 2Y5LA 4GBWA 2QVVA 4GWYA 5EYGA 1NUZA 1NV3A 1G0HA 1D9QA 1NUWA 3BIHA 2R8TA 2QVUA 2CZKA 1LBVA 2OWZA 5A5LA 1Q9DA 1QGXA 1LBWA
chains in the Genus database with same CATH superfamily
2MKZA 1IMDA 3IFCA 3EHSA 4DDDA 4Q5TA 3ONMA 4DLDA 3FV2A 3MUQA 3H03A 3U93A 4F39A 4XKRA 2ONRA 4DI3D 2WYPA 3OMBA 3OO6A 1DPEA 3A3UA 1FTLA 4GXAA 2RC8A 5H8FB 4MLQA 3C35A 2ZYOA 4MHFA 2OCUA 2O69A 4DCYA 4RNSA 3IAZA 1UIUA 1BTJA 3KBRA 1F9BA 3ECRA 2HZLA 3U72A 1EYIA 3RPLA 4JXIA 3R26A 4MX6A 1TFAA 2KQZA 1KA0A 3ILUB 3C36A 5H8NB 3VLVA 3SEUA 3C31A 2CEXA 5H8HA 1XVYA 4G8HA 1LBCA 4JVCA 3OO8A 5CMKA 3IO6A 1TXFA 1FCKA 3UP9A 2F97A 3S4UA 3THIA 2A5TB 5H8QB 1LAHE 3MSTA 2OX3A 5T3JA 4KHZE 2V25A 4RY1A 4IGRA 4P0GA 4R6YA 4NX1A 4KCCA 3IORA 5HBCA 3P7IA 3VVEA 4GWYA 1SVXB 1FTKA 4OVJA 5JEIA 3KZGA 5CMMA 1USYH 3W15C 4QHQA 4RPOA 2ANJA 4GWUA 2X7PA 2FYIA 2IEEA 4G77A 5EYHA 3QXMA 3OELA 4IY5A 2A5TA 3OSRA 5DW8A 5ESYA 1FJ6A 1R9LA 2H5YA 1K9YA 1LBXA 2I6EA 1B5JA 1Y4CA 5TU0A 4NF8B 1SW4A 2RCAA 1M5CA 2I4BA 3G7WA 2QJEA 1HSLA 3CFZA 1S50A 3PD8A 2OK2A 3IB1A 4ESWA 4PBHA 3FJ7A 5CM6A 3LSLA 4JDFA 1D3KA 3DP6A 5AA4A 4N4UA 4ZECA 5AA2D 3IOTA 4PBQA 4AB5A 1DTGA 4KQPA 3MP8A 3T9VA 1SPIA 2CZHA 5DVFA 4LATA 2B65A 2OBGA 4PF6A 4XF5A 1YAEA 4KYSA 1OLAA 3KGCA 4ONYA 1B05A 4F31B 1RDZA 1WVJA 5DVJA 2QMWA 3SEXA 1NNTA 2I48A 3TTRA 2Y7PA 3GBBA 3VVFA 1Y3PA 3G3JA 3MZ1A 2BJIA 2WEFA 2YPNA 2QS3A 2A5SA 4MBPA 3QIMA 3FGSA 4MCOA 5AA3A 1EZOA 1EYKA 4R2BA 4F1YA 4KXPA 1M5FA 4ZDMA 4GLIA 3RGYA 1FBCA 2E0SA 4Z7EA 1O63A 3ZKKA 1ELJA 5TP9B 1QJMA 4P1EA 4QFKA 2GQ1A 2UVGA 3S2VA 4GF8A 5LDZA 1FPJA 3FASA 2I0BA 4QXDA 2DSFA 3TCGA 3OSQA 4TLMB 3IB2A 5DYHA 5ITPA 2OPEA 4NF8A 1OIBA 1B32A 5HM4B 2HHMA 1SYIA 4OFJA 1MXWA 4G4PA 4PFIA 1Y20A 1O64A 3IOUA 1OVBA 1MDQA 3PMVA 5EYFA 3LV0A 1TT1A 2NVUB 4HS7A 2FHYA 3RQTA 4MEVA 1N0TA 3BFTA 4UACA 3BKIB 1YYZA 1SQYA 4NG7A 5IZ1A 4DXUA 1IXGA 5FTIA 3O97A 4HCWA 2F8DA 4OFOA 5CBRA 4DXBA 4LZ7A 4YICA 2DWIA 1FBGA 1VFEA 2ONKE 1B4HA 1ZIUA 5IGAA 4YZZA 3D4GA 2O1MA 4E0XA 3K02A 2FNCA 2ZNSA 4QFNA 1WODA 1SDXA 4MNIA 4ZEDA 1Z7ME 4M4GA 2ZYKA 4OERA 3GBAA 4NF4B 2O68A 3KSXA 4GBWA 1PB7A 1US4A 5I5PA 1PEBA 3BFUA 1MPCA 4TOZA 1P99A 4Q30B 1A55A 4WKMA 4NAPA 3IL1B 5I56B 3EF7A 2ZZVA 2KLFA 4U1ZA 4BDLA 2HZKA 1M5EA 4N81A 4MMPA 2PBWA 1B1XA 1OLCA 4OQOA 1SYHA 5BUUA 2V3UA 1YCJA 3N6UA 4H1XA 5J1DA 1IEJA 2B4MA 2F7BA 3V83A 2HXWA 2FBPA 1IITA 3FJMA 4YU0A 3ROJA 1VSOA 4OHNA 4MF3A 3SEVA 2D21A 3K1MA 1VFDA 3FD3A 5KDTB 1H43A 2O84X 3A09A 4XKPA 1DK4A 4KPTA 3S9EA 4OVRA 4ZE8A 3B6WA 4QFPA 3HV1A 1S9TA 3MVYA 2RC9A 4EF1A 3IR1A 2L5VA 3H7MA 3K00A 2YJPA 4EQBA 1AMFA 4OESA 3K1PA 1FTAA 1P1UA 3MYUA 4H5GA 3JYRA 3FVOA 5LTCA 3O66A 1NUWA 3TDJA 4U1OA 2GHBA 4ELQA 3TODA 2ALUA 1B3FA 3FVKA 4DCXA 4HE0A 2WYKA 4PAFA 1B3EA 4GFRA 1Y9UA 4K3FA 2Z8DA 4RPNA 2DVCA 3RN8A 3PUWE 4PDDA 1NH7A 4OYVA 1OQGA 2F36A 1FPIA 3IK6B 3M3KA 3V8XB 2XXVA 4AS4A 2QL3A 1B51A 1FQEA 3KG2A 3H6UA 5CBSA 1EU8A 1POY1 2I3VA 3PU5A 4G68A 1FJ9A 5KZTA 3IX1A 4NGUA 1JP4A 3VLUA 3USDA 2H4IA 1FPEA 4E0WA 4F3GA 4FJPA 4ELPA 2F35A 3K0VA 4PDHA 4POXA 5AA2A 1YPNA 4X9TA 3PUZE 1NMUA 5IZ3A 4YKIA 4F2QA 4P56A 4OVPA 3KEIA 1AIVA 2Y7KA 2G29A 1AWBA 2PYYA 4ZEFA 1B52A 3PV0E 5IAIA 3DELB 1PBPA 3MP1A 3U94A 1AH5A 1EYJA 1FQAA 3ILTB 5I2NA 2GH9A 3GLBA 5H8FA 1OVTA 5AA1A 4IO7A 4LA9A 4OA4A 4O3AA 4P47A 1Y1ZA 3HO7A 2XXWA 2DQVA 1LBWA 1B2HA 2CZLA 3O6GA 2ABHA 1MS7A 1IIWA 2HPGA 1HSJA 4FECA 1VE4A 3MW0A 2ZYMA 4GD5A 4N15A 4OENA 3FUZA 1LFGA 2V93A 4IO4A 2Q8MA 2DDKA 2OPDA 2THIA 2DE3A 4DI4B 3OO7A 1XC1A 3E13X 1JW5A 4I62A 1KWHA 2XXPA 4HTGA 2M8CA 3O29A 4NF4A 3S9LC 4N6KA 3N94A 3A3CA 2P1SA 1BIYA 3T93B 5B70A 4FAJA 5A5XB 5K2YA 2ZXTA 3PD9A 4FATA 1MY3A 4R74A 1A7LA 2Y7RA 4I1DA 4H8IA 1FBPA 3BBRA 1ZLQA 2Y7IA 4U2RA 2FVZA 4IR8A 1JNFA 3TQWA 3LR1A 2RCBA 2QS4A 1Q35A 3N26A 4H5FA 3C33A 2V4CA 1DTZA 4X48A 1MXUA 5ITOA 2XXRA 5IZZA 5F7VA 1D9QA 4THIA 5JK4A 1QW0A 3B6QA 4UA8A 4F19A 3M8UA 3L6HA 1MXZA 1A8FA 1ZKBA 2HEUA 4HE2A 4N13A 3TTLA 2UYFA 4BDQA 5EQ8A 3U1OA 4GOTA 4KD5A 1NV4A 3SKPA 5AE4A 3MVZA 3PMXA 3QSLA 4U21A 5KDTA 4OMBA 3OENA 3TYHA 4I3YA 1LAFE 3R6UA 4PFUA 3K1NA 1MY4A 1LBBA 2XXYA 3HFUA 2UXAA 1JEVA 4GWSA 5J16A 4FIMA 5EQAA 4F1UA 2DWHA 1RDYA 4ESXA 1UIVA 4KYEA 1AL3A 5I3SA 2XWKA 3T1BA 5FHNA 1DBZA 3I5OA 4KCDA 2QRYA 3NOHA 3B50A 5L9MA 4I3EA 4F18A 3OO9A 2ESNA 1IMCA 5I56A 4EDPA 2ONSA 3KC1A 3PMWA 3MZBA 1LB8A 1II5A 4PP0A 4LONB 5AA4B 3CG1A 3CI8A 4BDMA 4G68B 1P1WA 1QVSA 2CZKA 2OWZA 2R9JA 1QKBA 2REJA 3RY3A 4R75A 3SEWA 4R9FA 3T22A 2XD2A 1INPA 1IXIA 3PPRA 1YTVA 2ZYNA 4LQ2A 2X26A 4G8MA 4XXUA 4EUOA 3TPAA 4OFLA 2UYEA 1D4NA 4U4SA 2E1SA 3TCFA 1Y3NA 3UORA 5DT6A 1FPGA 3B6TA 4GWXA 2WBDA 4WEPA 1GR2A 1USYE 4C1UA 4PFYA 4R6HA 2HXRA 4EF2A 3ZKLA 4IO5A 2O51A 4OVSA 5A5XA 5H8QA 5L8DA 4ZE9A 1YXIA 3KJ7A 3MBPA 3I3VA 4P3LA 5I59B 5EHMA 3T96B 4EXKA 2DS9A 1NV2A 4F1VA 1PBQA 3LBSA 1NI9A 1NV0A 2XA5A 4GWZA 2Q9TA 2B3BA 2AYSA 5DEXB 5CMCA 1B1HA 4GRKA 2HFBA 2I0CA 4WXJA 4R6KA 3FVGA 1R9QA 1MQGA 1LB9A 3QMFA 4BLAA 5EQ9A 1FQCA 2X7QA 4LVQA 5I57B 2QVVA 2OWSA 1G0HA 2H9BA 4TLLB 2F7AA 4JWXA 3CVGA 1NNKA 4H6DA 2XXQA 5FTHA 2HCAA 1N7WA 3D1RA 2QVRA 1B3LA 4PETA 3RLFE 4O3BA 3IOWA 4RA1A 2OLBA 4YMBA 2DYXA 4ND9A 4GL8A 5ET7A 2WX9A 3OEKA 2BJJX 1MM6A 4X8RA 3E9XA 4AQ4A 1FPFA 1H3DA 1MQDA 1NV7A 4H67A 5ET8A 1I6QA 3LC8A 3B8BA 1MDP1 2F6PA 4OWDA 2VT5A 1LSTA 2CMOA 5IKBA 2DWAA 2VD3A 4PC9A 2Y84A 4GQOA 4KR5A 1NNFA 2ZZXA 3PTYA 1FPBA 1IXCA 4H46A 4FE8A 1B7ZA 1UTBA 5ELVA 1SD3A 4JWOA 5I2KB 4NWDA 2DVZA 5I59A 4NF0A 2V3QA 4I8CA 1QUKA 3IFAA 4NWCA 3TTKA 3K6VA 2G93A 1POTA 4GWWA 2UVHA 3A29A 2RC7A 4PF8A 2RF1A 1MM7A 3MP6A 5I58A 1I69A 4M1VA 3RT8A 5B7DA 4RXLA 2ZNTA 4GX3A 1M5BA 3G3HA 4NF5B 3UGWA 4LZ8A 4RYAA 4AS5A 4PGNA 1JEUA 1MQIA 1RDXA 2F78A 1B5HA 3UN6A 1XS5A 3Q27A 4O94A 5TPAB 3HHGA 4JB7A 3S9MC 4YMAA 1JW1A 3HN0A 2GFEA 2Z22A 3PPPA 4OXVA 1DCUA 4O7IA 4H8JA 3U8QA 3O2AA 1QUIA 4UABA 1P1QA 3QYTA 4GXSB 1BP5A 4OEVA 3QAXA 3TELA 2B3FA 2Y7WA 4MNPA 5ET5A 2VHAA 1YZ0A 1Y1MA 4BDNA 5FBPA 1FQBA 3M3LA 1MRPA 3CFLA 3D4CA 1B5IA 4P0IA 4NQ8A 1J1NA 4L17A 4OZ9A 1JVXA 3N5LA 1MPBA 1ATGA 5ICQA 1RKMA 2NUVA 2AL5A 1UTHB 2QPQA 3KBZA 4C0RA 4OANA 4EQ9A 3VE1B 3K6WA 1H45A 1NL5A 2XXTA 2REGA 2ZNUA 3CR9A 2F3BA 1EZPA 4DZ1A 3HSTA 5TP9A 4PAIA 5HPQA 4MLVA 4ECFA 4MFIA 1N04A 2AL4A 1IMAA 4GX4A 3L6GA 4JSDA 4R9GA 2O7UA 4HW8A 1BK4A 1SI0A 3OXNA 5EHSA 1JVYA 2XD3A 3RNNA 2NXOA 2HAVA 2Y5LA 3F11A 3SESA 3TTNA 2NWJA 3IJOB 3H6TA 2NOOA 2GRVA 3K6UA 3SZPA 4YB5A 1XT8A 1RYXA 5ET6A 1Y4TA 4U23A 3WAFA 1A8EA 3KOSA 1SW1A 4LZ5A 3WAEA 2Z23A 4ZS9A 3AXFA 2FA7A 5BWJA 5K2XA 1B7UA 3FBPA 4MJOA 3OOAA 1UTHA 1NUYA 1FPLA 1G0IA 1CB6A 1AOVA 1MXXA 4MH5A 4JVDA 3HPIA 4QFOA 2R6GE 2FIXA 4JWYA 3VDFA 1ZJLA 3MPKA 1SI1A 5L9OA 3I6VA 5H8SA 5JTYA 4LQ5A 4G8NA 4R73A 2LAOA 1VDWA 2V3TA 3V5AA 3QK6A 4XEQA 5CRYA 3EKIA 4XTCQ 4NMYA 5I7IA 3EPEA 1LFIA 4POWA 1KA1A 4GL0A 2DXRA 3U92A 3M3FA 4GX6A 1FTJA 1DSNA 3TQLA 5TPAA 3DP4A 1MY0A 3CIJA 1H76A 1R6ZA 4HCYA 1JQFA 2DE4A 3PGFA 1N7XA 1RYOA 3G3KA 4YKPA 1B3GA 3FXBA 4NE4A 1L5TA 4HE1A 1QUJA 3TMGA 4NF5A 1KZ8A 4GBVA 1B4ZA 3ODBA 3EHTA 4OVTA 2PCRA 3VLWA 2OZZA 3Q26A 1NNPA 3FZVA 1ZTYA 3H6WA 1FQDA 1M5DA 2WKYA 1UQWA 1ANFA 5EYGA 2VP1A 1NV3A 4IO3A 2D3IA 3TAJA 5H8HB 4P8BA 3DP8A 1LBVA 4YKKA 2CEYA 1CE2A 1MH3A 2HAUA 3LSXA 3T9HB 5CC2A 2PT2A 1MG1A 2UVJA 2Z8EA 3MVXA 4LP2B 4ELRA 5F1QA 3T66A 5I2KA 4X1DA 5FHMA 1JW4A 1T0KA 1O7TA 3K4UA 2RINA 4O7MA 4G2ZA 1URGA 4NHBA 4H45A 3Q29A 1FBEA 2HQ0A 4KYDA 2I3WA 4PFWA 4I40A 3HHFA 1NV6A 3E79A 2IA4A 4PQJA 1NUXA 4F2OA 2F34A 1QULA 1I6BA 5M2VA 1K9ZA 3SERA 4PFTA 3ZS6A 1B58A 5AA2B 1FBHA 3G3GA 1IMEA 3KN3A 3CRBA 3VVDA 4N91A 4ZEBA 4KI0E 4XIGQ 3O28A 5I57A 4ISUA 1MQJA 2DOJA 3VV5A 2XX7A 4F22A 1MY1A 2O6AA 3CSGA 2P0SA 1URSA 3IO4A 5ICTA 4F3PA 3EHUA 1N3XA 2OWTA 5I84A 1JETA 4PE3A 1PC3A 2VPNA 4F29A 4IGTA 1IUDA 3KSJA 1QGXA 4U4XA 2H98A 5KCJB 5DEXA 3C34A 3PPQA 3TCHA 1P1NA 1D9VA 1IMBA 1LCTA 1GTKA 2QFLA 1LAXA 4GWOA 2Q89A 3B7DA 2P2AA 2XHDA 1OQHA 2GHAA 3V89B 2PFYA 3LUZA 5LOMA 3U65A 1LGBC 2VGQA 1IMFA 4XKNA 1PB8A 3RTFB 2OJTA 5KCJA 3BIGA 1IXHA 3KN7A 1LCFA 3MPLA 1PB9A 4PFBA 5DVIA 1HSEA 4I9DA 3T9XB 1FBFA 3KFMA 4F3BA 2XX9A 1Q1KA 2P3VA 3T0JA 4XFEA 4EXLA 3MC2A 1EH3A 1MY2A 2XXHA 4ZZEA 2XWOA 1DOTA 4IB2A 2P3NA 2FIEA 2DXYA 2PX1A 1XI6A 4ZEIA 3O6HA 2F3DA 4F3SA 3GXAA 3PUYE 4FEDA 1MXVA 2D5WA 3C4MA 3TKDA 4Q8RA 1OMPA 2XWIA 1EZ9A 2F5XA 1FTMA 3CG3A 3EQ1A 3UK4A 2PFZA 2F7CA 3MZ9A 3QUFA 3FATA 1XVXA 1LEVA 1XOCA 4KFQA 1DPPA 3W9VA 3JZJA 1VR5A 3H06B 3QUJA 1LFHA 4YB6A 3C9HA 3BIHA 2QVUA 2Z8FA 4GIZA 2QS1A 1Q9DA 3G3FA 1NKXA 3R7XA 4JVIA 3IJXB 4YKJA 4NF6A 4IO6A 1BKAA 2XX8A 3RYDA 3GZGA 3JV9A 3CFXA 3SEYA 1FPDA 4C1TA 4P1LA 4JBZA 4G61A 5EQ7A 3OEMA 4PFRA 3K6XA 1N84A 1LBYA 1B9JA 4IO2A 1FW0A 1MXYA 1Y3QA 2PT1A 1B0HA 2DE2A 3FIRA 3FXUA 4PCDA 4LN5A 3LSWA 2UVIA 3TEPA 1N3WA 1H44A 3FJGA 4QBAA 2VOZA 2QS2A 3PUVE 3TZAA 5IZ3B 4OEUA 2QMXA 3O6IA 3VXBA 4XKQA 3EN3A 2H99A 4N6PA 4GVOA 4X1BA 3H4ZA 2I49A 4FEBA 4O8MA 2Q88A 4RK9A 1FQFA 3CSBA 1Z7NE 2XXUA 3T9UA 5H8NA 2ZMBA 3OD7A 2O1LA 3RPWA 1B3HA 3PPOA 4X04A 2KR0A 3KOTA 4QSEA 2O7IA 1ZMGA 3UIFA 4PAKA 5DTBA 3MAMA 4RJZA 3VFJA 3FXQA 2XXKA 5ISUA 3C32A 4MAGA 4ELOA 3CHGA 1MPDA 1PDAA 4P11A 3FV1A 2Q8JA 4DIGA 1URDA 4FBPA 4Z0IA 1N76A 4N17A 4OTEA 4QFLA 1LAGE 1P1OA 4PTKA 4EQ7A 3KN8A 1SW2A 1LLSA 3DLNA 2AIXA 4H65A 1BLFA 3FXRA 4JSOA 3RUMA 3KC0A 2RKMA 4MIJA 4QF9A 4DXCA 4OETA 1GGGA 4QSDA 4NEDA 5CMBA 3G3IA 3MVWA 1FPKA 1I6AA 3SETA 4R72A 4QSCA 4TQUQ 4BDOA 3KJTA 4U22A 2F6GA 4PGPA 4OVQA 3MJNA 1NV5A 4NF6B 2XXIA 3H6VA 3VXCA 3RT6B 3RTWB 1GVCA 3TFLA 1ZU0A 1GV8A 5CI5A 3RPLB 1MQHA 1A40A 1DMBA 3S9NC 4ZEKA 4N6DA 2DWJA 2YLNA 1NH8A 3K2DA 3PUXE 3PPNA 3SDFA 4Q0CA 4ZZAA 1S7YA 1R1NA 4N8YA 4R2FA 4PE5B 1FTOA 1TFDA 3Q25A 3LSFB 1SBPA 5I2NB 1SW5A 2XXXA 3FVNA 4RK2A 3HCQA 3TTMA 4IY6A 2R8TA 4O3CA 5A5LA 4MNCA 2QSXA 3H3GA 5FHOA 1B7HA 5IM2A 1IQ7A 4AB6A 2PVUA 2DP8A 1XHYA 3E3KA 2I58A 1FBDA 1TWYA 3IB0A 4BDRA 1NFTA 3E78A 5I58B 3K01A 1B40A 1QKAA 2ZZWA 2JJKA 4H0WA 1B6HA 1A54A 4P9KA 2I4CA 4DE8A 2H25A 1MH4A 3W9WA 5L9SA 2XWVA 1FSAA 4QRZA 3IOVA 1LBZA 1WDNA 1B0LA 5JTYB 2Q74A 3ISPA 4G68C 1CNQA 1IZ1A 2V84A 3DM0A 4YB7A 1US5A 5F24A 3Q28A 4N8GA 3UA8A 4FORA 2PMSA 3GYYA 4NN3A 2CZIA 1FRPA 2Y5KA 3O9PA 3ZSFA 3E4RA 3MQ9A 3N6TA 1UTBB 1D9YA 3TUSA 1A99A 3LUYA 2WBBA 2W7YA 1NV1A 4HXVA 2VD2A 4NTLA 2R71A 4WEDA 1NUZA 4LUBA 1B46A 2B4LA 4N07A 4YAHX 3MWBA 2VPOA 2Q2AA 1ZBMA 2Q2CA
chains in the Genus database with same CATH topology
2MKZA 4MAGA 4JVIA 4F19A 4PGPA 1IMDA 1DCUA 3IFCA 4O7IA 1EYKA 4KXPA 5ET6A 4HE0A 4GWUA 4NAPA 5IM2A 2WYKA 2CEYA 4PAFA 2HPGA 1IMBA 3CHGA 3D1RA 1FBCA 2QVRA 4HE2A 2ZZVA 4PETA 5EYHA 4UABA 4FBPA 4N17A 2QFLA 2HZKA 4PDDA 1INPA 4N81A 1FBDA 2WYPA 4MMPA 2GQ1A 4PTKA 3RYDA 4P1EA 3FBPA 4MJOA 5EQ8A 3E78A 4F1VA 5ET7A 4N15A 2WX9A 5DW8A 4MNPA 5ET5A 1NV4A 1NUYA 5ESYA 1FJ6A 2Q8MA 2ZZWA 5LDZA 1FPIA 1YZ0A 1FPLA 4X8RA 1FPJA 1K9YA 1G0IA 1LBXA 2JJKA 2PFYA 4QXDA 1FPFA 4AS4A 1FPDA 3KC0A 5FBPA 3LUZA 4O7MA 4P1LA 2DDKA 3U65A 4JVDA 4MIJA 4MHFA 1NV7A 4G61A 5EQ7A 2DE3A 4NHBA 2FIXA 4H45A 4I3YA 4P9KA 4DI4B 1FPGA 1FBEA 1IMFA 2HHMA 5I7IA 5ET8A 5J1DA 4GWXA 3HFUA 2WBDA 4PFRA 3B8BA 4PFIA 1FPKA 4GWSA 1FJ9A 3BIGA 5J16A 4NQ8A 5EQAA 4F1UA 4PCDA 2B4MA 4NGUA 4PBHA 1JP4A 5CM6A 2HZLA 2VT5A 1VDWA 3W9WA 1LBYA 1RDYA 2FBPA 4I40A 2XWVA 4PFBA 1EYIA 3LV0A 1FSAA 1NV6A 2HXRA 3E79A 4OVQA 1FPEA 1LBZA 4OVSA 1NV5A 4PC9A 3RPLA 2DE2A 2FHYA 5I3SA 4XEQA 1FBFA 1NUXA 2QPQA 3EKIA 3ROJA 2XWKA 2P3VA 4MX6A 4N4UA 2Q74A 3KBZA 2KQZA 2ZZXA 3T0JA 4LN5A 1DBZA 4MEVA 4N6KA 3PTYA 1YXIA 4OANA 1KA1A 1FPBA 4PDHA 1KA0A 4H46A 3ISPA 4PBQA 4QBAA 4X9TA 4XFEA 3NOHA 1YYZA 1CNQA 3B50A 4P3LA 4NG7A 4GX6A 5IZ1A 4I3EA 2F3BA 5IZ3A 5IZ3B 2XWOA 1K9ZA 3RPLB 1NV2A 2DVZA 2CEXA 1SPIA 2CZHA 2V3QA 4NF0A 4HCWA 1NI9A 4P56A 4OVPA 4PAIA 1NV0A 3IFAA 4JVCA 4XF5A 5F24A 4PF6A 2P3NA 4DI3D 4F18A 1DK4A 2FIEA 1FBHA 1XI6A 2XA5A 4HCYA 1AWBA 4GWWA 4GWZA 4N8GA 3T1BA 1IMEA 2Q9TA 3A29A 3GYYA 1IMCA 4N6DA 4OVRA 4PF8A 4YICA 1FBGA 4NN3A 2DE4A 2CZIA 4O8MA 3KC1A 2F3DA 4N91A 1FRPA 2Y5KA 5IGAA 1IMAA 4YZZA 3MSTA 1FBPA 1RDZA 4M1VA 3FXBA 4HE1A 4GX3A 2OX3A 2FVZA 5T3JA 2F5XA 2L5VA 2XWIA 4GX4A 4IR8A 1KZ8A 4MNIA 4GBVA 2PFZA 1EYJA 4OVTA 2PCRA 1BK4A 3QMFA 4AS5A 4N8YA 4PGNA 2WBBA 5EQ9A 1LEVA 1FTAA 2BJIA 4NX1A 4X04A 3W9VA 1NV1A 1RDXA 4HXVA 2V4CA 2WEFA 2Y5LA 3MYUA 4GBWA 2KR0A 2QVVA 4GWYA 5I5PA 5LTCA 5EYGA 1NUZA 5IZZA 1NV3A 1G0HA 2B4LA 4O94A 4OA4A 4PE3A 1D9QA 1NUWA 2VPNA 4P47A 4PAKA 4P8BA 3BIHA 5JK4A 2R8TA 2QVUA 2CZKA 1LBVA 2OWZA 5A5LA 2VPOA 4MCOA 4MNCA 3SZPA 1Q9DA 1QGXA 2XXKA 1LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMD A;  1DCU A;  3IFC A;  4O7I A;  1EYK A;  4KXP A;  5ET6 A;  4HE0 A;  4GWU A;  1IMB A;  3D1R A;  1FBC A;  2QVR A;  4HE2 A;  5EYH A;  4FBP A;  2QFL A;  1INP A;  4N81 A;  1FBD A;  2GQ1 A;  4PTK A;  3RYD A;  3FBP A;  4MJO A;  5EQ8 A;  5ET7 A;  5DW8 A;  5ET5 A;  1NV4 A;  1NUY A;  5ESY A;  1FJ6 A;  2Q8M A;  5LDZ A;  1FPI A;  1YZ0 A;  1FPL A;  1FPJ A;  1K9Y A;  1G0I A;  1LBX A;  2JJK A;  4QXD A;  1FPF A;  4AS4 A;  1FPD A;  3KC0 A;  5FBP A;  3LUZ A;  2DDK A;  1NV7 A;  4G61 A;  5EQ7 A;  2FIX A;  4H45 A;  4I3Y A;  1FPG A;  1FBE A;  1IMF A;  2HHM A;  5ET8 A;  4GWX A;  2WBD A;  3B8B A;  1FPK A;  4GWS A;  1FJ9 A;  3BIG A;  5J16 A;  5EQA A;  1JP4 A;  2VT5 A;  1VDW A;  1LBY A;  1RDY A;  2FBP A;  4I40 A;  1EYI A;  3LV0 A;  1FSA A;  1NV6 A;  1FPE A;  1LBZ A;  1NV5 A;  3RPL A;  2FHY A;  5I3S A;  1FBF A;  1NUX A;  3ROJ A;  2P3V A;  2Q74 A;  3KBZ A;  3T0J A;  1DBZ A;  1YXI A;  1KA1 A;  1FPB A;  1KA0 A;  4H46 A;  1YYZ A;  1CNQ A;  4GX6 A;  5IZ1 A;  4I3E A;  2F3B A;  5IZ3 A;  5IZ3 B;  1K9Z A;  3RPL B;  1NV2 A;  1SPI A;  2CZH A;  1NI9 A;  1NV0 A;  3IFA A;  5F24 A;  2P3N A;  1DK4 A;  2FIE A;  1FBH A;  1XI6 A;  1AWB A;  4GWW A;  4GWZ A;  1IME A;  3A29 A;  1IMC A;  1FBG A;  2CZI A;  3KC1 A;  2F3D A;  1FRP A;  2Y5K A;  1IMA A;  1FBP A;  1RDZ A;  4HE1 A;  4GX3 A;  2OX3 A;  2FVZ A;  5T3J A;  4GX4 A;  4IR8 A;  1KZ8 A;  4GBV A;  1EYJ A;  2PCR A;  1BK4 A;  3QMF A;  4AS5 A;  2WBB A;  5EQ9 A;  1LEV A;  1FTA A;  2BJI A;  1NV1 A;  1RDX A;  4HXV A;  2WEF A;  2Y5L A;  4GBW A;  2QVV A;  4GWY A;  5EYG A;  1NUZ A;  1NV3 A;  1G0H A;  1D9Q A;  1NUW A;  3BIH A;  2R8T A;  2QVU A;  2CZK A;  1LBV A;  2OWZ A;  5A5L A;  1Q9D A;  1QGX A;  1LBW A; 
#chains in the Genus database with same CATH topology
 2MKZ A;  1IMD A;  3IFC A;  3EHS A;  4DDD A;  4Q5T A;  3ONM A;  4DLD A;  3FV2 A;  3MUQ A;  3H03 A;  3U93 A;  4F39 A;  4XKR A;  2ONR A;  4DI3 D;  2WYP A;  3OMB A;  3OO6 A;  1DPE A;  3A3U A;  1FTL A;  4GXA A;  2RC8 A;  5H8F B;  4MLQ A;  3C35 A;  2ZYO A;  4MHF A;  2OCU A;  2O69 A;  4DCY A;  4RNS A;  3IAZ A;  1UIU A;  1BTJ A;  3KBR A;  1F9B A;  3ECR A;  2HZL A;  3U72 A;  1EYI A;  3RPL A;  4JXI A;  3R26 A;  4MX6 A;  1TFA A;  2KQZ A;  1KA0 A;  3ILU B;  3C36 A;  5H8N B;  3VLV A;  3SEU A;  3C31 A;  2CEX A;  5H8H A;  1XVY A;  4G8H A;  1LBC A;  4JVC A;  3OO8 A;  5CMK A;  3IO6 A;  1TXF A;  1FCK A;  3UP9 A;  2F97 A;  3S4U A;  3THI A;  2A5T B;  5H8Q B;  1LAH E;  3MST A;  2OX3 A;  5T3J A;  4KHZ E;  2V25 A;  4RY1 A;  4IGR A;  4P0G A;  4R6Y A;  4NX1 A;  4KCC A;  3IOR A;  5HBC A;  3P7I A;  3VVE A;  4GWY A;  1SVX B;  1FTK A;  4OVJ A;  5JEI A;  3KZG A;  5CMM A;  1USY H;  3W15 C;  4QHQ A;  4RPO A;  2ANJ A;  4GWU A;  2X7P A;  2FYI A;  2IEE A;  4G77 A;  5EYH A;  3QXM A;  3OEL A;  4IY5 A;  2A5T A;  3OSR A;  5DW8 A;  5ESY A;  1FJ6 A;  1R9L A;  2H5Y A;  1K9Y A;  1LBX A;  2I6E A;  1B5J A;  1Y4C A;  5TU0 A;  4NF8 B;  1SW4 A;  2RCA A;  1M5C A;  2I4B A;  3G7W A;  2QJE A;  1HSL A;  3CFZ A;  1S50 A;  3PD8 A;  2OK2 A;  3IB1 A;  4ESW A;  4PBH A;  3FJ7 A;  5CM6 A;  3LSL A;  4JDF A;  1D3K A;  3DP6 A;  5AA4 A;  4N4U A;  4ZEC A;  5AA2 D;  3IOT A;  4PBQ A;  4AB5 A;  1DTG A;  4KQP A;  3MP8 A;  3T9V A;  1SPI A;  2CZH A;  5DVF A;  4LAT A;  2B65 A;  2OBG A;  4PF6 A;  4XF5 A;  1YAE A;  4KYS A;  1OLA A;  3KGC A;  4ONY A;  1B05 A;  4F31 B;  1RDZ A;  1WVJ A;  5DVJ A;  2QMW A;  3SEX A;  1NNT A;  2I48 A;  3TTR A;  2Y7P A;  3GBB A;  3VVF A;  1Y3P A;  3G3J A;  3MZ1 A;  2BJI A;  2WEF A;  2YPN A;  2QS3 A;  2A5S A;  4MBP A;  3QIM A;  3FGS A;  4MCO A;  5AA3 A;  1EZO A;  1EYK A;  4R2B A;  4F1Y A;  4KXP A;  1M5F A;  4ZDM A;  4GLI A;  3RGY A;  1FBC A;  2E0S A;  4Z7E A;  1O63 A;  3ZKK A;  1ELJ A;  5TP9 B;  1QJM A;  4P1E A;  4QFK A;  2GQ1 A;  2UVG A;  3S2V A;  4GF8 A;  5LDZ A;  1FPJ A;  3FAS A;  2I0B A;  4QXD A;  2DSF A;  3TCG A;  3OSQ A;  4TLM B;  3IB2 A;  5DYH A;  5ITP A;  2OPE A;  4NF8 A;  1OIB A;  1B32 A;  5HM4 B;  2HHM A;  1SYI A;  4OFJ A;  1MXW A;  4G4P A;  4PFI A;  1Y20 A;  1O64 A;  3IOU A;  1OVB A;  1MDQ A;  3PMV A;  5EYF A;  3LV0 A;  1TT1 A;  2NVU B;  4HS7 A;  2FHY A;  3RQT A;  4MEV A;  1N0T A;  3BFT A;  4UAC A;  3BKI B;  1YYZ A;  1SQY A;  4NG7 A;  5IZ1 A;  4DXU A;  1IXG A;  5FTI A;  3O97 A;  4HCW A;  2F8D A;  4OFO A;  5CBR A;  4DXB A;  4LZ7 A;  4YIC A;  2DWI A;  1FBG A;  1VFE A;  2ONK E;  1B4H A;  1ZIU A;  5IGA A;  4YZZ A;  3D4G A;  2O1M A;  4E0X A;  3K02 A;  2FNC A;  2ZNS A;  4QFN A;  1WOD A;  1SDX A;  4MNI A;  4ZED A;  1Z7M E;  4M4G A;  2ZYK A;  4OER A;  3GBA A;  4NF4 B;  2O68 A;  3KSX A;  4GBW A;  1PB7 A;  1US4 A;  5I5P A;  1PEB A;  3BFU A;  1MPC A;  4TOZ A;  1P99 A;  4Q30 B;  1A55 A;  4WKM A;  4NAP A;  3IL1 B;  5I56 B;  3EF7 A;  2ZZV A;  2KLF A;  4U1Z A;  4BDL A;  2HZK A;  1M5E A;  4N81 A;  4MMP A;  2PBW A;  1B1X A;  1OLC A;  4OQO A;  1SYH A;  5BUU A;  2V3U A;  1YCJ A;  3N6U A;  4H1X A;  5J1D A;  1IEJ A;  2B4M A;  2F7B A;  3V83 A;  2HXW A;  2FBP A;  1IIT A;  3FJM A;  4YU0 A;  3ROJ A;  1VSO A;  4OHN A;  4MF3 A;  3SEV A;  2D21 A;  3K1M A;  1VFD A;  3FD3 A;  5KDT B;  1H43 A;  2O84 X;  3A09 A;  4XKP A;  1DK4 A;  4KPT A;  3S9E A;  4OVR A;  4ZE8 A;  3B6W A;  4QFP A;  3HV1 A;  1S9T A;  3MVY A;  2RC9 A;  4EF1 A;  3IR1 A;  2L5V A;  3H7M A;  3K00 A;  2YJP A;  4EQB A;  1AMF A;  4OES A;  3K1P A;  1FTA A;  1P1U A;  3MYU A;  4H5G A;  3JYR A;  3FVO A;  5LTC A;  3O66 A;  1NUW A;  3TDJ A;  4U1O A;  2GHB A;  4ELQ A;  3TOD A;  2ALU A;  1B3F A;  3FVK A;  4DCX A;  4HE0 A;  2WYK A;  4PAF A;  1B3E A;  4GFR A;  1Y9U A;  4K3F A;  2Z8D A;  4RPN A;  2DVC A;  3RN8 A;  3PUW E;  4PDD A;  1NH7 A;  4OYV A;  1OQG A;  2F36 A;  1FPI A;  3IK6 B;  3M3K A;  3V8X B;  2XXV A;  4AS4 A;  2QL3 A;  1B51 A;  1FQE A;  3KG2 A;  3H6U A;  5CBS A;  1EU8 A;  1POY 1;  2I3V A;  3PU5 A;  4G68 A;  1FJ9 A;  5KZT A;  3IX1 A;  4NGU A;  1JP4 A;  3VLU A;  3USD A;  2H4I A;  1FPE A;  4E0W A;  4F3G A;  4FJP A;  4ELP A;  2F35 A;  3K0V A;  4PDH A;  4POX A;  5AA2 A;  1YPN A;  4X9T A;  3PUZ E;  1NMU A;  5IZ3 A;  4YKI A;  4F2Q A;  4P56 A;  4OVP A;  3KEI A;  1AIV A;  2Y7K A;  2G29 A;  1AWB A;  2PYY A;  4ZEF A;  1B52 A;  3PV0 E;  5IAI A;  3DEL B;  1PBP A;  3MP1 A;  3U94 A;  1AH5 A;  1EYJ A;  1FQA A;  3ILT B;  5I2N A;  2GH9 A;  3GLB A;  5H8F A;  1OVT A;  5AA1 A;  4IO7 A;  4LA9 A;  4OA4 A;  4O3A A;  4P47 A;  1Y1Z A;  3HO7 A;  2XXW A;  2DQV A;  1LBW A;  1B2H A;  2CZL A;  3O6G A;  2ABH A;  1MS7 A;  1IIW A;  2HPG A;  1HSJ A;  4FEC A;  1VE4 A;  3MW0 A;  2ZYM A;  4GD5 A;  4N15 A;  4OEN A;  3FUZ A;  1LFG A;  2V93 A;  4IO4 A;  2Q8M A;  2DDK A;  2OPD A;  2THI A;  2DE3 A;  4DI4 B;  3OO7 A;  1XC1 A;  3E13 X;  1JW5 A;  4I62 A;  1KWH A;  2XXP A;  4HTG A;  2M8C A;  3O29 A;  4NF4 A;  3S9L C;  4N6K A;  3N94 A;  3A3C A;  2P1S A;  1BIY A;  3T93 B;  5B70 A;  4FAJ A;  5A5X B;  5K2Y A;  2ZXT A;  3PD9 A;  4FAT A;  1MY3 A;  4R74 A;  1A7L A;  2Y7R A;  4I1D A;  4H8I A;  1FBP A;  3BBR A;  1ZLQ A;  2Y7I A;  4U2R A;  2FVZ A;  4IR8 A;  1JNF A;  3TQW A;  3LR1 A;  2RCB A;  2QS4 A;  1Q35 A;  3N26 A;  4H5F A;  3C33 A;  2V4C A;  1DTZ A;  4X48 A;  1MXU A;  5ITO A;  2XXR A;  5IZZ A;  5F7V A;  1D9Q A;  4THI A;  5JK4 A;  1QW0 A;  3B6Q A;  4UA8 A;  4F19 A;  3M8U A;  3L6H A;  1MXZ A;  1A8F A;  1ZKB A;  2HEU A;  4HE2 A;  4N13 A;  3TTL A;  2UYF A;  4BDQ A;  5EQ8 A;  3U1O A;  4GOT A;  4KD5 A;  1NV4 A;  3SKP A;  5AE4 A;  3MVZ A;  3PMX A;  3QSL A;  4U21 A;  5KDT A;  4OMB A;  3OEN A;  3TYH A;  4I3Y A;  1LAF E;  3R6U A;  4PFU A;  3K1N A;  1MY4 A;  1LBB A;  2XXY A;  3HFU A;  2UXA A;  1JEV A;  4GWS A;  5J16 A;  4FIM A;  5EQA A;  4F1U A;  2DWH A;  1RDY A;  4ESX A;  1UIV A;  4KYE A;  1AL3 A;  5I3S A;  2XWK A;  3T1B A;  5FHN A;  1DBZ A;  3I5O A;  4KCD A;  2QRY A;  3NOH A;  3B50 A;  5L9M A;  4I3E A;  4F18 A;  3OO9 A;  2ESN A;  1IMC A;  5I56 A;  4EDP A;  2ONS A;  3KC1 A;  3PMW A;  3MZB A;  1LB8 A;  1II5 A;  4PP0 A;  4LON B;  5AA4 B;  3CG1 A;  3CI8 A;  4BDM A;  4G68 B;  1P1W A;  1QVS A;  2CZK A;  2OWZ A;  2R9J A;  1QKB A;  2REJ A;  3RY3 A;  4R75 A;  3SEW A;  4R9F A;  3T22 A;  2XD2 A;  1INP A;  1IXI A;  3PPR A;  1YTV A;  2ZYN A;  4LQ2 A;  2X26 A;  4G8M A;  4XXU A;  4EUO A;  3TPA A;  4OFL A;  2UYE A;  1D4N A;  4U4S A;  2E1S A;  3TCF A;  1Y3N A;  3UOR A;  5DT6 A;  1FPG A;  3B6T A;  4GWX A;  2WBD A;  4WEP A;  1GR2 A;  1USY E;  4C1U A;  4PFY A;  4R6H A;  2HXR A;  4EF2 A;  3ZKL A;  4IO5 A;  2O51 A;  4OVS A;  5A5X A;  5H8Q A;  5L8D A;  4ZE9 A;  1YXI A;  3KJ7 A;  3MBP A;  3I3V A;  4P3L A;  5I59 B;  5EHM A;  3T96 B;  4EXK A;  2DS9 A;  1NV2 A;  4F1V A;  1PBQ A;  3LBS A;  1NI9 A;  1NV0 A;  2XA5 A;  4GWZ A;  2Q9T A;  2B3B A;  2AYS A;  5DEX B;  5CMC A;  1B1H A;  4GRK A;  2HFB A;  2I0C A;  4WXJ A;  4R6K A;  3FVG A;  1R9Q A;  1MQG A;  1LB9 A;  3QMF A;  4BLA A;  5EQ9 A;  1FQC A;  2X7Q A;  4LVQ A;  5I57 B;  2QVV A;  2OWS A;  1G0H A;  2H9B A;  4TLL B;  2F7A A;  4JWX A;  3CVG A;  1NNK A;  4H6D A;  2XXQ A;  5FTH A;  2HCA A;  1N7W A;  3D1R A;  2QVR A;  1B3L A;  4PET A;  3RLF E;  4O3B A;  3IOW A;  4RA1 A;  2OLB A;  4YMB A;  2DYX A;  4ND9 A;  4GL8 A;  5ET7 A;  2WX9 A;  3OEK A;  2BJJ X;  1MM6 A;  4X8R A;  3E9X A;  4AQ4 A;  1FPF A;  1H3D A;  1MQD A;  1NV7 A;  4H67 A;  5ET8 A;  1I6Q A;  3LC8 A;  3B8B A;  1MDP 1;  2F6P A;  4OWD A;  2VT5 A;  1LST A;  2CMO A;  5IKB A;  2DWA A;  2VD3 A;  4PC9 A;  2Y84 A;  4GQO A;  4KR5 A;  1NNF A;  2ZZX A;  3PTY A;  1FPB A;  1IXC A;  4H46 A;  4FE8 A;  1B7Z A;  1UTB A;  5ELV A;  1SD3 A;  4JWO A;  5I2K B;  4NWD A;  2DVZ A;  5I59 A;  4NF0 A;  2V3Q A;  4I8C A;  1QUK A;  3IFA A;  4NWC A;  3TTK A;  3K6V A;  2G93 A;  1POT A;  4GWW A;  2UVH A;  3A29 A;  2RC7 A;  4PF8 A;  2RF1 A;  1MM7 A;  3MP6 A;  5I58 A;  1I69 A;  4M1V A;  3RT8 A;  5B7D A;  4RXL A;  2ZNT A;  4GX3 A;  1M5B A;  3G3H A;  4NF5 B;  3UGW A;  4LZ8 A;  4RYA A;  4AS5 A;  4PGN A;  1JEU A;  1MQI A;  1RDX A;  2F78 A;  1B5H A;  3UN6 A;  1XS5 A;  3Q27 A;  4O94 A;  5TPA B;  3HHG A;  4JB7 A;  3S9M C;  4YMA A;  1JW1 A;  3HN0 A;  2GFE A;  2Z22 A;  3PPP A;  4OXV A;  1DCU A;  4O7I A;  4H8J A;  3U8Q A;  3O2A A;  1QUI A;  4UAB A;  1P1Q A;  3QYT A;  4GXS B;  1BP5 A;  4OEV A;  3QAX A;  3TEL A;  2B3F A;  2Y7W A;  4MNP A;  5ET5 A;  2VHA A;  1YZ0 A;  1Y1M A;  4BDN A;  5FBP A;  1FQB A;  3M3L A;  1MRP A;  3CFL A;  3D4C A;  1B5I A;  4P0I A;  4NQ8 A;  1J1N A;  4L17 A;  4OZ9 A;  1JVX A;  3N5L A;  1MPB A;  1ATG A;  5ICQ A;  1RKM A;  2NUV A;  2AL5 A;  1UTH B;  2QPQ A;  3KBZ A;  4C0R A;  4OAN A;  4EQ9 A;  3VE1 B;  3K6W A;  1H45 A;  1NL5 A;  2XXT A;  2REG A;  2ZNU A;  3CR9 A;  2F3B A;  1EZP A;  4DZ1 A;  3HST A;  5TP9 A;  4PAI A;  5HPQ A;  4MLV A;  4ECF A;  4MFI A;  1N04 A;  2AL4 A;  1IMA A;  4GX4 A;  3L6G A;  4JSD A;  4R9G A;  2O7U A;  4HW8 A;  1BK4 A;  1SI0 A;  3OXN A;  5EHS A;  1JVY A;  2XD3 A;  3RNN A;  2NXO A;  2HAV A;  2Y5L A;  3F11 A;  3SES A;  3TTN A;  2NWJ A;  3IJO B;  3H6T A;  2NOO A;  2GRV A;  3K6U A;  3SZP A;  4YB5 A;  1XT8 A;  1RYX A;  5ET6 A;  1Y4T A;  4U23 A;  3WAF A;  1A8E A;  3KOS A;  1SW1 A;  4LZ5 A;  3WAE A;  2Z23 A;  4ZS9 A;  3AXF A;  2FA7 A;  5BWJ A;  5K2X A;  1B7U A;  3FBP A;  4MJO A;  3OOA A;  1UTH A;  1NUY A;  1FPL A;  1G0I A;  1CB6 A;  1AOV A;  1MXX A;  4MH5 A;  4JVD A;  3HPI A;  4QFO A;  2R6G E;  2FIX A;  4JWY A;  3VDF A;  1ZJL A;  3MPK A;  1SI1 A;  5L9O A;  3I6V A;  5H8S A;  5JTY A;  4LQ5 A;  4G8N A;  4R73 A;  2LAO A;  1VDW A;  2V3T A;  3V5A A;  3QK6 A;  4XEQ A;  5CRY A;  3EKI A;  4XTC Q;  4NMY A;  5I7I A;  3EPE A;  1LFI A;  4POW A;  1KA1 A;  4GL0 A;  2DXR A;  3U92 A;  3M3F A;  4GX6 A;  1FTJ A;  1DSN A;  3TQL A;  5TPA A;  3DP4 A;  1MY0 A;  3CIJ A;  1H76 A;  1R6Z A;  4HCY A;  1JQF A;  2DE4 A;  3PGF A;  1N7X A;  1RYO A;  3G3K A;  4YKP A;  1B3G A;  3FXB A;  4NE4 A;  1L5T A;  4HE1 A;  1QUJ A;  3TMG A;  4NF5 A;  1KZ8 A;  4GBV A;  1B4Z A;  3ODB A;  3EHT A;  4OVT A;  2PCR A;  3VLW A;  2OZZ A;  3Q26 A;  1NNP A;  3FZV A;  1ZTY A;  3H6W A;  1FQD A;  1M5D A;  2WKY A;  1UQW A;  1ANF A;  5EYG A;  2VP1 A;  1NV3 A;  4IO3 A;  2D3I A;  3TAJ A;  5H8H B;  4P8B A;  3DP8 A;  1LBV A;  4YKK A;  2CEY A;  1CE2 A;  1MH3 A;  2HAU A;  3LSX A;  3T9H B;  5CC2 A;  2PT2 A;  1MG1 A;  2UVJ A;  2Z8E A;  3MVX A;  4LP2 B;  4ELR A;  5F1Q A;  3T66 A;  5I2K A;  4X1D A;  5FHM A;  1JW4 A;  1T0K A;  1O7T A;  3K4U A;  2RIN A;  4O7M A;  4G2Z A;  1URG A;  4NHB A;  4H45 A;  3Q29 A;  1FBE A;  2HQ0 A;  4KYD A;  2I3W A;  4PFW A;  4I40 A;  3HHF A;  1NV6 A;  3E79 A;  2IA4 A;  4PQJ A;  1NUX A;  4F2O A;  2F34 A;  1QUL A;  1I6B A;  5M2V A;  1K9Z A;  3SER A;  4PFT A;  3ZS6 A;  1B58 A;  5AA2 B;  1FBH A;  3G3G A;  1IME A;  3KN3 A;  3CRB A;  3VVD A;  4N91 A;  4ZEB A;  4KI0 E;  4XIG Q;  3O28 A;  5I57 A;  4ISU A;  1MQJ A;  2DOJ A;  3VV5 A;  2XX7 A;  4F22 A;  1MY1 A;  2O6A A;  3CSG A;  2P0S A;  1URS A;  3IO4 A;  5ICT A;  4F3P A;  3EHU A;  1N3X A;  2OWT A;  5I84 A;  1JET A;  4PE3 A;  1PC3 A;  2VPN A;  4F29 A;  4IGT A;  1IUD A;  3KSJ A;  1QGX A;  4U4X A;  2H98 A;  5KCJ B;  5DEX A;  3C34 A;  3PPQ A;  3TCH A;  1P1N A;  1D9V A;  1IMB A;  1LCT A;  1GTK A;  2QFL A;  1LAX A;  4GWO A;  2Q89 A;  3B7D A;  2P2A A;  2XHD A;  1OQH A;  2GHA A;  3V89 B;  2PFY A;  3LUZ A;  5LOM A;  3U65 A;  1LGB C;  2VGQ A;  1IMF A;  4XKN A;  1PB8 A;  3RTF B;  2OJT A;  5KCJ A;  3BIG A;  1IXH A;  3KN7 A;  1LCF A;  3MPL A;  1PB9 A;  4PFB A;  5DVI A;  1HSE A;  4I9D A;  3T9X B;  1FBF A;  3KFM A;  4F3B A;  2XX9 A;  1Q1K A;  2P3V A;  3T0J A;  4XFE A;  4EXL A;  3MC2 A;  1EH3 A;  1MY2 A;  2XXH A;  4ZZE A;  2XWO A;  1DOT A;  4IB2 A;  2P3N A;  2FIE A;  2DXY A;  2PX1 A;  1XI6 A;  4ZEI A;  3O6H A;  2F3D A;  4F3S A;  3GXA A;  3PUY E;  4FED A;  1MXV A;  2D5W A;  3C4M A;  3TKD A;  4Q8R A;  1OMP A;  2XWI A;  1EZ9 A;  2F5X A;  1FTM A;  3CG3 A;  3EQ1 A;  3UK4 A;  2PFZ A;  2F7C A;  3MZ9 A;  3QUF A;  3FAT A;  1XVX A;  1LEV A;  1XOC A;  4KFQ A;  1DPP A;  3W9V A;  3JZJ A;  1VR5 A;  3H06 B;  3QUJ A;  1LFH A;  4YB6 A;  3C9H A;  3BIH A;  2QVU A;  2Z8F A;  4GIZ A;  2QS1 A;  1Q9D A;  3G3F A;  1NKX A;  3R7X A;  4JVI A;  3IJX B;  4YKJ A;  4NF6 A;  4IO6 A;  1BKA A;  2XX8 A;  3RYD A;  3GZG A;  3JV9 A;  3CFX A;  3SEY A;  1FPD A;  4C1T A;  4P1L A;  4JBZ A;  4G61 A;  5EQ7 A;  3OEM A;  4PFR A;  3K6X A;  1N84 A;  1LBY A;  1B9J A;  4IO2 A;  1FW0 A;  1MXY A;  1Y3Q A;  2PT1 A;  1B0H A;  2DE2 A;  3FIR A;  3FXU A;  4PCD A;  4LN5 A;  3LSW A;  2UVI A;  3TEP A;  1N3W A;  1H44 A;  3FJG A;  4QBA A;  2VOZ A;  2QS2 A;  3PUV E;  3TZA A;  5IZ3 B;  4OEU A;  2QMX A;  3O6I A;  3VXB A;  4XKQ A;  3EN3 A;  2H99 A;  4N6P A;  4GVO A;  4X1B A;  3H4Z A;  2I49 A;  4FEB A;  4O8M A;  2Q88 A;  4RK9 A;  1FQF A;  3CSB A;  1Z7N E;  2XXU A;  3T9U A;  5H8N A;  2ZMB A;  3OD7 A;  2O1L A;  3RPW A;  1B3H A;  3PPO A;  4X04 A;  2KR0 A;  3KOT A;  4QSE A;  2O7I A;  1ZMG A;  3UIF A;  4PAK A;  5DTB A;  3MAM A;  4RJZ A;  3VFJ A;  3FXQ A;  2XXK A;  5ISU A;  3C32 A;  4MAG A;  4ELO A;  3CHG A;  1MPD A;  1PDA A;  4P11 A;  3FV1 A;  2Q8J A;  4DIG A;  1URD A;  4FBP A;  4Z0I A;  1N76 A;  4N17 A;  4OTE A;  4QFL A;  1LAG E;  1P1O A;  4PTK A;  4EQ7 A;  3KN8 A;  1SW2 A;  1LLS A;  3DLN A;  2AIX A;  4H65 A;  1BLF A;  3FXR A;  4JSO A;  3RUM A;  3KC0 A;  2RKM A;  4MIJ A;  4QF9 A;  4DXC A;  4OET A;  1GGG A;  4QSD A;  4NED A;  5CMB A;  3G3I A;  3MVW A;  1FPK A;  1I6A A;  3SET A;  4R72 A;  4QSC A;  4TQU Q;  4BDO A;  3KJT A;  4U22 A;  2F6G A;  4PGP A;  4OVQ A;  3MJN A;  1NV5 A;  4NF6 B;  2XXI A;  3H6V A;  3VXC A;  3RT6 B;  3RTW B;  1GVC A;  3TFL A;  1ZU0 A;  1GV8 A;  5CI5 A;  3RPL B;  1MQH A;  1A40 A;  1DMB A;  3S9N C;  4ZEK A;  4N6D A;  2DWJ A;  2YLN A;  1NH8 A;  3K2D A;  3PUX E;  3PPN A;  3SDF A;  4Q0C A;  4ZZA A;  1S7Y A;  1R1N A;  4N8Y A;  4R2F A;  4PE5 B;  1FTO A;  1TFD A;  3Q25 A;  3LSF B;  1SBP A;  5I2N B;  1SW5 A;  2XXX A;  3FVN A;  4RK2 A;  3HCQ A;  3TTM A;  4IY6 A;  2R8T A;  4O3C A;  5A5L A;  4MNC A;  2QSX A;  3H3G A;  5FHO A;  1B7H A;  5IM2 A;  1IQ7 A;  4AB6 A;  2PVU A;  2DP8 A;  1XHY A;  3E3K A;  2I58 A;  1FBD A;  1TWY A;  3IB0 A;  4BDR A;  1NFT A;  3E78 A;  5I58 B;  3K01 A;  1B40 A;  1QKA A;  2ZZW A;  2JJK A;  4H0W A;  1B6H A;  1A54 A;  4P9K A;  2I4C A;  4DE8 A;  2H25 A;  1MH4 A;  3W9W A;  5L9S A;  2XWV A;  1FSA A;  4QRZ A;  3IOV A;  1LBZ A;  1WDN A;  1B0L A;  5JTY B;  2Q74 A;  3ISP A;  4G68 C;  1CNQ A;  1IZ1 A;  2V84 A;  3DM0 A;  4YB7 A;  1US5 A;  5F24 A;  3Q28 A;  4N8G A;  3UA8 A;  4FOR A;  2PMS A;  3GYY A;  4NN3 A;  2CZI A;  1FRP A;  2Y5K A;  3O9P A;  3ZSF A;  3E4R A;  3MQ9 A;  3N6T A;  1UTB B;  1D9Y A;  3TUS A;  1A99 A;  3LUY A;  2WBB A;  2W7Y A;  1NV1 A;  4HXV A;  2VD2 A;  4NTL A;  2R71 A;  4WED A;  1NUZ A;  4LUB A;  1B46 A;  2B4L A;  4N07 A;  4YAH X;  3MWB A;  2VPO A;  2Q2A A;  1ZBM A;  2Q2C A; 
#chains in the Genus database with same CATH homology
 2MKZ A;  4MAG A;  4JVI A;  4F19 A;  4PGP A;  1IMD A;  1DCU A;  3IFC A;  4O7I A;  1EYK A;  4KXP A;  5ET6 A;  4HE0 A;  4GWU A;  4NAP A;  5IM2 A;  2WYK A;  2CEY A;  4PAF A;  2HPG A;  1IMB A;  3CHG A;  3D1R A;  1FBC A;  2QVR A;  4HE2 A;  2ZZV A;  4PET A;  5EYH A;  4UAB A;  4FBP A;  4N17 A;  2QFL A;  2HZK A;  4PDD A;  1INP A;  4N81 A;  1FBD A;  2WYP A;  4MMP A;  2GQ1 A;  4PTK A;  3RYD A;  4P1E A;  3FBP A;  4MJO A;  5EQ8 A;  3E78 A;  4F1V A;  5ET7 A;  4N15 A;  2WX9 A;  5DW8 A;  4MNP A;  5ET5 A;  1NV4 A;  1NUY A;  5ESY A;  1FJ6 A;  2Q8M A;  2ZZW A;  5LDZ A;  1FPI A;  1YZ0 A;  1FPL A;  4X8R A;  1FPJ A;  1K9Y A;  1G0I A;  1LBX A;  2JJK A;  2PFY A;  4QXD A;  1FPF A;  4AS4 A;  1FPD A;  3KC0 A;  5FBP A;  3LUZ A;  4O7M A;  4P1L A;  2DDK A;  3U65 A;  4JVD A;  4MIJ A;  4MHF A;  1NV7 A;  4G61 A;  5EQ7 A;  2DE3 A;  4NHB A;  2FIX A;  4H45 A;  4I3Y A;  4P9K A;  4DI4 B;  1FPG A;  1FBE A;  1IMF A;  2HHM A;  5I7I A;  5ET8 A;  5J1D A;  4GWX A;  3HFU A;  2WBD A;  4PFR A;  3B8B A;  4PFI A;  1FPK A;  4GWS A;  1FJ9 A;  3BIG A;  5J16 A;  4NQ8 A;  5EQA A;  4F1U A;  4PCD A;  2B4M A;  4NGU A;  4PBH A;  1JP4 A;  5CM6 A;  2HZL A;  2VT5 A;  1VDW A;  3W9W A;  1LBY A;  1RDY A;  2FBP A;  4I40 A;  2XWV A;  4PFB A;  1EYI A;  3LV0 A;  1FSA A;  1NV6 A;  2HXR A;  3E79 A;  4OVQ A;  1FPE A;  1LBZ A;  4OVS A;  1NV5 A;  4PC9 A;  3RPL A;  2DE2 A;  2FHY A;  5I3S A;  4XEQ A;  1FBF A;  1NUX A;  2QPQ A;  3EKI A;  3ROJ A;  2XWK A;  2P3V A;  4MX6 A;  4N4U A;  2Q74 A;  3KBZ A;  2KQZ A;  2ZZX A;  3T0J A;  4LN5 A;  1DBZ A;  4MEV A;  4N6K A;  3PTY A;  1YXI A;  4OAN A;  1KA1 A;  1FPB A;  4PDH A;  1KA0 A;  4H46 A;  3ISP A;  4PBQ A;  4QBA A;  4X9T A;  4XFE A;  3NOH A;  1YYZ A;  1CNQ A;  3B50 A;  4P3L A;  4NG7 A;  4GX6 A;  5IZ1 A;  4I3E A;  2F3B A;  5IZ3 A;  5IZ3 B;  2XWO A;  1K9Z A;  3RPL B;  1NV2 A;  2DVZ A;  2CEX A;  1SPI A;  2CZH A;  2V3Q A;  4NF0 A;  4HCW A;  1NI9 A;  4P56 A;  4OVP A;  4PAI A;  1NV0 A;  3IFA A;  4JVC A;  4XF5 A;  5F24 A;  4PF6 A;  2P3N A;  4DI3 D;  4F18 A;  1DK4 A;  2FIE A;  1FBH A;  1XI6 A;  2XA5 A;  4HCY A;  1AWB A;  4GWW A;  4GWZ A;  4N8G A;  3T1B A;  1IME A;  2Q9T A;  3A29 A;  3GYY A;  1IMC A;  4N6D A;  4OVR A;  4PF8 A;  4YIC A;  1FBG A;  4NN3 A;  2DE4 A;  2CZI A;  4O8M A;  3KC1 A;  2F3D A;  4N91 A;  1FRP A;  2Y5K A;  5IGA A;  1IMA A;  4YZZ A;  3MST A;  1FBP A;  1RDZ A;  4M1V A;  3FXB A;  4HE1 A;  4GX3 A;  2OX3 A;  2FVZ A;  5T3J A;  2F5X A;  2L5V A;  2XWI A;  4GX4 A;  4IR8 A;  1KZ8 A;  4MNI A;  4GBV A;  2PFZ A;  1EYJ A;  4OVT A;  2PCR A;  1BK4 A;  3QMF A;  4AS5 A;  4N8Y A;  4PGN A;  2WBB A;  5EQ9 A;  1LEV A;  1FTA A;  2BJI A;  4NX1 A;  4X04 A;  3W9V A;  1NV1 A;  1RDX A;  4HXV A;  2V4C A;  2WEF A;  2Y5L A;  3MYU A;  4GBW A;  2KR0 A;  2QVV A;  4GWY A;  5I5P A;  5LTC A;  5EYG A;  1NUZ A;  5IZZ A;  1NV3 A;  1G0H A;  2B4L A;  4O94 A;  4OA4 A;  4PE3 A;  1D9Q A;  1NUW A;  2VPN A;  4P47 A;  4PAK A;  4P8B A;  3BIH A;  5JK4 A;  2R8T A;  2QVU A;  2CZK A;  1LBV A;  2OWZ A;  5A5L A;  2VPO A;  4MCO A;  4MNC A;  3SZP A;  1Q9D A;  1QGX A;  2XXK A;  1LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...