2VT5A

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2vt5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2vt5A02
1JP4A 1NV7A 1K9ZA 5IZ3A 5IZ3B 2PCRA 1NV5A 1LBYA 4GWXA 4KXPA 3ROJA 3LV0A 1KZ8A 1SPIA 1NV1A 1FBGA 3KC1A 1FPBA 1YZ0A 2Q8MA 3QMFA 2F3BA 4MJOA 5IZ1A 4FBPA 4AS4A 1XI6A 1DBZA 1NUYA 2FHYA 2P3VA 1IMDA 1NV4A 2OX3A 5DW8A 4I3EA 2WEFA 1KA1A 5F24A 1FPKA 2FIXA 1NUWA 1LBZA 1FPIA 4I40A 1FPJA 1FPFA 2HHMA 2QVVA 1D9QA 4GBWA 5EQAA 4H46A 2QVRA 1NV2A 3KBZA 5LDZA 1RDZA 3D1RA 4HE2A 4N81A 3IFCA 4GBVA 1FSAA 1EYJA 1IMAA 1NUZA 1LBVA 1NV6A 4GWSA 5EQ7A 2CZIA 2P3NA 4GX6A 1G0IA 4IR8A 1KA0A 3RPLB 3BIGA 1EYIA 5FBPA 3LUZA 1DCUA 2DDKA 2CZHA 4GWUA 1LBWA 4GX4A 3FBPA 2WBDA 5EYHA 2Y5LA 4QXDA 5ET8A 1IMCA 1FTAA 1INPA 2R8TA 5EQ8A 5I3SA 1FBCA 2JJKA 3B8BA 3RYDA 5T3JA 1FBFA 4HE1A 4HE0A 1FPGA 5ESYA 1NV0A 2QFLA 4AS5A 1YXIA 3A29A 1YYZA 1DK4A 4O7IA 2FIEA 5EYGA 3RPLA 1FJ6A 1FBPA 1FBEA 4PTKA 2Y5KA 1FBHA 1NI9A 5EQ9A 4HXVA 2Q74A 1FPLA 2OWZA 3IFAA 4I3YA 2FVZA 1K9YA 1G0HA 2GQ1A 1LEVA 3BIHA 1FBDA 3T0JA 5ET6A 1FPEA 2CZKA 1NV3A 1NUXA 1RDYA 1QGXA 4G61A 4GWWA 3KC0A 1IMEA 2F3DA 4GX3A 5ET5A 1CNQA 1AWBA 5J16A 2WBBA 5A5LA 1Q9DA 1RDXA 2FBPA 1IMBA 1EYKA 1VDWA 2VT5A 2BJIA 1IMFA 1FRPA 4GWZA 5ET7A 1FPDA 1FJ9A 2QVUA 1LBXA 1BK4A 4GWYA 4H45A
chains in the Genus database with same CATH superfamily
4GIZA 3QIMA 4X48A 5CRYA 2NUVA 3PMWA 2UVJA 3EF7A 4KHZE 2DS9A 2O7UA 1FQAA 5JEIA 5DEXA 3TKDA 1SPIA 1IIWA 3KSJA 3FD3A 3LSXA 4PFYA 3U8QA 4OFJA 3FVOA 4DI3D 1B5JA 3OO7A 1B1XA 1FPIA 2RC9A 2Y7KA 2H99A 3KJTA 3PV0E 4M1VA 4ND9A 1PB9A 4PBQA 4XTCQ 3IO4A 3T9XB 2ZYNA 4EF1A 4MNIA 3KBZA 4NG7A 1AOVA 3KN8A 3UIFA 4NHBA 4X1DA 1HSEA 1TT1A 1Q35A 3ILTB 4MAGA 1IITA 5EQ7A 3FGSA 4NF8A 3TZAA 1OQHA 4I8CA 4ESXA 1PBQA 4POXA 1TFAA 1Y3PA 2QMXA 5CI5A 1ANFA 2XX7A 4G4PA 2DWJA 3OEKA 2GRVA 2F5XA 3TCHA 4R9FA 2Q74A 4E0XA 4EQ7A 4RK2A 2DE2A 5ISUA 3A3CA 2Z8EA 5LOMA 4ZS9A 5F7VA 4GX3A 2O68A 2Q9TA 4NN3A 1TFDA 1PB7A 5ELVA 3PPQA 4P1EA 4LQ2A 4KYDA 3E4RA 1SYIA 2PT1A 5H8HA 5CBRA 1JW4A 1LAXA 1LLSA 3S9LC 4KXPA 4NF0A 2AIXA 1KZ8A 1FPBA 2Q8MA 3N94A 4DE8A 4MJOA 3HPIA 4BDMA 1FQCA 4YKJA 1MRPA 2FHYA 3MQ9A 3FVGA 3PPNA 5DW8A 4P56A 2OLBA 3MAMA 4U4SA 2HHMA 1JETA 1YTVA 4ZE9A 1NMUA 4XKRA 1UIUA 4H46A 4PE5B 5F1QA 1N84A 3W9WA 2NXOA 3D1RA 4N81A 3KN3A 2VD2A 2PT2A 1XC1A 1B1HA 4F31B 1LBVA 2XA5A 3H7MA 4N6KA 1M5DA 5TP9B 1MDP1 1VE4A 1MY1A 4TLLB 5JK4A 4NQ8A 2R8TA 3U93A 4MEVA 2DXYA 3FJGA 3K6WA 3S4UA 3S9NC 1FBFA 3CIJA 3G3JA 4NF5A 4PQJA 1B2HA 4MF3A 1B32A 3BFTA 4RNSA 2OWZA 4F39A 3RY3A 4QFOA 4PFWA 4FEBA 4Q30B 2ONSA 3OSQA 2QS2A 4U2RA 1XVYA 1Q9DA 5EHMA 1MQGA 4ELOA 4F1VA 4KI0E 4XXUA 4H8IA 3UA8A 4ZDMA 1QVSA 3E3KA 3E79A 4R72A 1B9JA 2XD2A 3EPEA 4OWDA 5FHNA 3F11A 1GGGA 4DCXA 4AS4A 5CMKA 4IY6A 2CEYA 2OX3A 4GFRA 3TTKA 1FPJA 3QSLA 4XIGQ 1ZJLA 3Q25A 1QW0A 2QS3A 3OENA 1II5A 3E9XA 4N6PA 4GWOA 4IO7A 3K1PA 4DCYA 1OVTA 4FAJA 4EDPA 3O9PA 1M5FA 1NV6A 2CZIA 1N0TA 2P0SA 3V5AA 3CG1A 4QRZA 3B6WA 1Z7ME 1B05A 3LR1A 4F3BA 2REGA 2M8CA 1PDAA 3VLUA 5KZTA 3RTWB 1RYXA 3T9VA 5EHSA 3C9HA 4HE0A 2DVZA 2QFLA 1OLAA 4ZZEA 3K6VA 5IGAA 1B6HA 1SVXB 5M2VA 3VVDA 1P1OA 4XKNA 1MXVA 4IO3A 3G3HA 1JNFA 3PPRA 5I57B 3ECRA 4QSDA 3OO6A 1MS7A 1RDYA 5ET5A 2XWKA 3EKIA 1JEVA 2YJPA 5ITPA 3CFLA 3TEPA 5ET7A 1FPDA 2VHAA 1A55A 1GV8A 4LA9A 3SESA 3M8UA 1NV7A 2DXRA 4PFUA 5IZ3A 3FV2A 4IGRA 5I2KB 1OVBA 4KYSA 3IB2A 3O66A 1FTLA 1LFIA 3C31A 2VD3A 3W9VA 4POWA 1L5TA 1KA1A 1OLCA 4NF6A 2ZZVA 1MY4A 1NH7A 3GBBA 4QFNA 1UTHA 5DYHA 2QVRA 4NAPA 3VXCA 5H8SA 4HE2A 3IFCA 4GBVA 3TTRA 4DXBA 2DWIA 5AA2A 2OJTA 2KQZA 1KA0A 4PFBA 4PFIA 4JVCA 5FHMA 5EYHA 4R2FA 3HN0A 1Y20A 2QS4A 4YU0A 2V25A 2YPNA 4IO6A 3PUVE 5I3SA 3GBAA 3IL1B 4X8RA 2A5SA 4MIJA 4N6DA 1OIBA 2ZMBA 2Y5KA 3Q26A 3WAEA 4G8MA 3EQ1A 1YPNA 3IB1A 1PEBA 2RC7A 3M3KA 3SEXA 1LAGE 4PGPA 2HXWA 5ICQA 1NUXA 3PPOA 5IZZA 2HEUA 4HTGA 2X26A 4OVQA 3G3IA 2WYKA 4GVOA 3PD8A 3PPPA 1BK4A 1AMFA 4UA8A 3MVWA 3O28A 3HHFA 1QUIA 3RUMA 5L9OA 3TDJA 5DEXB 4P0GA 4PAKA 2GFEA 1IMDA 1EZOA 4ECFA 2WYPA 4F3GA 1FQEA 3T93B 3BBRA 2KR0A 3TODA 1SW1A 1D9QA 3GZGA 3TFLA 3CRBA 1AH5A 5L8DA 2NVUB 4PF8A 3H6VA 1I69A 1B3EA 2I4BA 4PCDA 1BIYA 4YB6A 4O8MA 3MVYA 5CBSA 3KSXA 3VDFA 4KQPA 4NF8B 1P1NA 1EYIA 5FBPA 1B5IA 1B7UA 1D9VA 2O1MA 2VOZA 2VGQA 1P1UA 3IAZA 4GLIA 3HHGA 4OFOA 3TELA 3SEUA 1B3HA 2I49A 3I6VA 5AE4A 4LUBA 2F7CA 4C1TA 1NV0A 2ESNA 1N3WA 3SZPA 4R6KA 1LGBC 5EQ9A 5I2NA 5I7IA 4YMBA 2I3WA 1FPLA 3C34A 2PFZA 2I0BA 3G3KA 2OWTA 4F1YA 4ZEIA 1EU8A 4GWWA 3V89B 4O94A 4P3LA 3B50A 3FASA 1LBCA 1OQGA 3Q27A 1PC3A 1VFEA 3O2AA 4OESA 4MX6A 3N5LA 1FCKA 5H8HB 1JQFA 2P1SA 3OMBA 2D3IA 1IEJA 1MH3A 3LSWA 5LTCA 3GLBA 2QS1A 4H5GA 3KC1A 3QMFA 5H8FA 5IZ1A 1B40A 3MP1A 2DE3A 1N76A 2W7YA 4PAFA 4YMAA 2FIXA 4NWCA 1XOCA 4I40A 4Q8RA 3FVNA 2I58A 3SERA 1NL5A 2ANJA 3KN7A 2ABHA 3TCGA 1B52A 2Z8FA 4BDNA 3KFMA 1FQDA 1B58A 1GTKA 4U1OA 4R2BA 2B4LA 3C32A 5ICTA 3K02A 2CZHA 2QSXA 3ZS6A 4PETA 1O63A 4U21A 3FJMA 3AXFA 3MJNA 3PUXE 1INPA 4XF5A 5EQ8A 3P7IA 4DDDA 5T3JA 4R9GA 3CI8A 2Q2CA 2V3UA 4NF5B 2OBGA 4OA4A 4PTKA 2I0CA 1NI9A 4P1LA 4HXVA 4P47A 3I3VA 3IJXB 3TUSA 2GQ1A 4HW8A 3BIHA 2PFYA 4R74A 3I5OA 1LBBA 1NNKA 3CVGA 2OZZA 4BLAA 3QAXA 1MXYA 1QGXA 5J16A 3KC0A 4PGNA 4RA1A 1RDXA 2GHBA 3ZKLA 2FBPA 2F6GA 3FIRA 3OD7A 1IMFA 4MFIA 1SW2A 3QYTA 1MXUA 1LBXA 4TOZA 4KCDA 4XEQA 3S9MC 1Z7NE 4NX1A 2XXYA 4H0WA 3T1BA 5CMMA 1YZ0A 2HCAA 2F3BA 4FBPA 4UACA 2VP1A 3H6WA 2XXKA 4O3BA 3DP4A 2F7BA 3QK6A 1POY1 3M3LA 3IOUA 3R26A 3VV5A 1H76A 4OZ9A 5LDZA 5AA4B 4JSOA 1FQBA 3FZVA 3K00A 4X1BA 1IXGA 1A40A 3K1NA 1IMAA 2V4CA 4MCOA 4OVTA 4EUOA 4GOTA 1LBWA 1UQWA 4JWYA 2F35A 4ELRA 1H43A 4OENA 1EZPA 4P9KA 4NWDA 1FBCA 2DOJA 1MH4A 3VVFA 4YICA 2Q88A 2Y7RA 4AS5A 1TXFA 1J1NA 3RPWA 2ZYKA 3C33A 1FBPA 2V3QA 4R6HA 4PP0A 3PUZE 5K2YA 2XXHA 1HSLA 1B4ZA 2H9BA 4EQ9A 5B7DA 1A8EA 5I56B 2Z23A 3K4UA 1ZIUA 5DTBA 2D21A 4DXCA 2O7IA 4FJPA 3DP6A 1MY0A 2HFBA 4HE1A 3HFUA 2HXRA 5IZ3B 3L6HA 4N4UA 5CMCA 1QKBA 5FTHA 3RTFB 1DBZA 3B6TA 2F97A 2UXAA 4GRKA 2THIA 1IXCA 2DP8A 2Q8JA 1LBZA 4K3FA 4ZEBA 4NF6B 4FIMA 1NNFA 3FXBA 4LVQA 3A3UA 2UYEA 3TMGA 2V84A 2WX9A 4U22A 3RGYA 1UTHB 1BLFA 2HZLA 3ZSFA 3N26A 1M5CA 1MG1A 2UVIA 1EYJA 1R9QA 5AA2B 4C0RA 2ZNUA 3O6HA 4DI4B 2B4MA 5FHOA 1Y1MA 2NOOA 1BTJA 3TQWA 1QUKA 1O7TA 4MHFA 4JWXA 3EHUA 4U23A 1MXWA 1NKXA 5AA4A 3MVXA 2Y7WA 4MNPA 3RN8A 1QKAA 1VFDA 1URSA 3ONMA 2ZYMA 4ELQA 4ESWA 4YB5A 4RXLA 1AIVA 5HBCA 2Z8DA 4AQ4A 4JVIA 4KR5A 1DSNA 3IR1A 3E13X 1CNQA 1NNPA 5A5LA 3IORA 2O6AA 3RNNA 3FVKA 1RKMA 3IOTA 4OVRA 1B7ZA 3MUQA 3PTYA 4IGTA 3H3GA 3IJOB 1NV5A 1MXXA 3ROJA 4HCYA 3U1OA 1NV1A 4I9DA 5I56A 2ZNTA 2Y7PA 1LFGA 2WEFA 2X7PA 4DZ1A 4XKQA 3VFJA 1S50A 2IEEA 4Q5TA 1VR5A 3HCQA 1I6QA 4OMBA 4EQBA 2RCAA 2OPEA 1IXIA 2A5TA 2V93A 4XKPA 4IR8A 4ZEKA 2ZXTA 1B0LA 4FEDA 3LUZA 1S7YA 4LONB 1XHYA 3C35A 4E0WA 4QSEA 5BUUA 1MY2A 2R9JA 3IK6B 3E78A 4EXKA 3TTMA 2ZYOA 4NF4B 4L17A 2Q89A 1FPGA 2XXXA 3MW0A 3A29A 2QL3A 3MP8A 4O7MA 5EYGA 1HSJA 1S9TA 5I2NB 5HPQA 4DIGA 4IB2A 3ZKKA 2Z22A 4Z7EA 4DLDA 4C1UA 2UYFA 3KJ7A 4YZZA 4JBZA 5IAIA 5J1DA 2WBBA 1LCFA 3KBRA 1VDWA 3DELB 3H03A 3U94A 3GXAA 1JEUA 3VE1B 3RT8A 2PBWA 3UORA 3ILUB 1K9ZA 4G8HA 1NFTA 4F2QA 1B51A 1QJMA 1YAEA 5H8FB 1PBPA 1URDA 4F19A 3MP6A 1WODA 2G93A 4ZEFA 1OMPA 1ZBMA 3FXUA 5L9SA 2H98A 1JW1A 3LBSA 3O6IA 3IO6A 3D4CA 5K2XA 4O3CA 4OVPA 1FSAA 2H4IA 1B3FA 1SYHA 4N8YA 3Q29A 3RPLB 4YKKA 1D3KA 3RLFE 4ELPA 3G3GA 2B65A 4JXIA 5H8QA 1XVXA 4N17A 4OETA 1FTAA 5CM6A 4G68A 4M4GA 3DM0A 2VPNA 1MQDA 1FQFA 2F34A 4LP2B 4TLMB 3U92A 1DK4A 3MYUA 3CFZA 3MZ1A 5CC2A 2O51A 1IUDA 5KCJA 1WDNA 4PC9A 3OEMA 3OSRA 3QUJA 1FPEA 5I59A 1M5EA 2QRYA 1TWYA 2KLFA 2XXVA 5HM4B 4NF4A 2VPOA 2BJIA 4G68C 2WKYA 1URGA 3H06B 1USYH 2I4CA 5JTYA 1MPBA 5KDTB 2LAOA 3LV0A 2I6EA 2XXRA 2O84X 1CB6A 4UABA 4YKIA 1NUYA 1NH8A 3MBPA 3VVEA 4FATA 4G2ZA 3QXMA 3VLVA 4JB7A 1FTKA 3MWBA 4QHQA 4OANA 4F22A 3C36A 2UVHA 3T96B 5EQAA 2AYSA 3MZ9A 4P0IA 2Y7IA 4N07A 1EH3A 2ONKE 3Q28A 1FW0A 2PMSA 3FUZA 2ALUA 1LSTA 3TAJA 3H6UA 1B3GA 1IXHA 2XHDA 1SI0A 2P3NA 3MSTA 4H5FA 3BIGA 4R73A 1PB8A 3HSTA 5FTIA 4OYVA 3R6UA 2O69A 2XXUA 3S9EA 3N6UA 4H67A 4WKMA 3CSBA 3JV9A 1XS5A 2UVGA 1YXIA 4GXSB 3T66A 5AA2D 2GH9A 2F8DA 3SEWA 3RPLA 3U72A 2HAVA 1MQIA 2QMWA 1UTBA 3K6UA 3L6GA 4IO5A 5TPAA 1A8FA 4OEVA 5EYFA 4QBAA 2FA7A 4RPOA 4F3SA 2X7QA 4LATA 3K6XA 2GHAA 4PDDA 3T22A 1Y4TA 2OPDA 2E1SA 2PCRA 1LBYA 4GQOA 4Z0IA 1R9LA 1EZ9A 2V3TA 1XI6A 1B4HA 1M5BA 4I3EA 2XWOA 5F24A 3C4MA 1P1WA 2OK2A 1FPFA 4QFLA 1ZKBA 4U4XA 1D4NA 2XX9A 3FATA 3MZBA 1NV2A 2PVUA 2DWHA 3K2DA 4NMYA 5KDTA 1A7LA 2FYIA 3LSLA 1NUZA 3TCFA 2DVCA 4AB5A 4GWSA 1WVJA 1R1NA 3LSFB 4BDLA 4GWUA 4G77A 4QXDA 3QUFA 1MQHA 2CEXA 5TU0A 3KOSA 5I5PA 1JVYA 5I58A 2XX8A 3B8BA 4OQOA 4QF9A 3OO8A 1T0KA 4PAIA 4I3YA 1MPDA 1BKAA 1G0HA 3PMVA 3T0JA 2DQVA 2HZKA 4FORA 2ZZXA 4KFQA 4R6YA 1A54A 3B7DA 4F3PA 4O3AA 1IMBA 4N91A 1US5A 3PUYE 3SKPA 1N7WA 5DT6A 2XXTA 2H5YA 5B70A 4GWXA 1JVXA 2F78A 1MXZA 4ZZAA 4F29A 1USYE 3FJ7A 4ZE8A 3TTLA 1LFHA 4N13A 4PDHA 1SW5A 1JW5A 2G29A 1B5HA 3UGWA 2PX1A 3CG3A 4RPNA 5A5XB 1ZMGA 1ZU0A 2A5TB 2XXQA 1G0IA 4F1UA 1VSOA 1ATGA 4X04A 1SI1A 1DCUA 3S2VA 2XWIA 2CMOA 4LN5A 4MLQA 2F7AA 3T9HB 2Y84A 3KG2A 3G3FA 1D9YA 3RYDA 2RINA 1ELJA 1SD3A 4NTLA 1YCJA 1P99A 3EHSA 1FBHA 3MVZA 3EN3A 4YKPA 5H8NB 2FVZA 4KCCA 1LEVA 3D4GA 4TQUQ 1NV3A 4MH5A 3CSGA 4G61A 3KZGA 4ONYA 1P1QA 4EF2A 3U65A 3KGCA 4RJZA 1FJ9A 4X9TA 1DTGA 3TYHA 2CZLA 2B3FA 3H6TA 5I84A 2IA4A 2L5VA 3SEYA 3LUYA 2PYYA 5CMBA 3PD9A 4BDRA 2XD3A 3M3FA 1FBGA 1Y4CA 1QULA 1MDQA 1FPKA 1LB8A 4GL8A 3IB0A 5ITOA 4RYAA 1A99A 1NNTA 3V8XB 1RDZA 1DPPA 4H6DA 2DSFA 1MPCA 3RQTA 1H44A 3TTNA 5AA3A 3KEIA 1KWHA 4N8GA 4JSDA 4FE8A 5TP9A 2RF1A 2F36A 3O29A 5H8QB 1Y9UA 4MMPA 4BDQA 2FNCA 1LB9A 3IOWA 4HS7A 4WEDA 2P2AA 4G68B 4GF8A 5A5XA 1YYZA 2D5WA 4O7IA 1BP5A 3O6GA 4RY1A 3IFAA 2OWSA 5KCJB 5ET6A 2CZKA 4YAHX 5I59B 4KYEA 1MM7A 1H45A 3OO9A 3K01A 3CR9A 2O1LA 2BJJX 2NWJA 4GXAA 3JYRA 4ZEDA 1MM6A 2VT5A 5BWJA 1CE2A 2REJA 3ISPA 4R75A 4MBPA 2ONRA 5H8NA 3T9UA 4WEPA 4JWOA 3SETA 4DXUA 3VXBA 5JTYB 4LZ7A 3H4ZA 1B7HA 1UIVA 3HO7A 4P11A 1N7XA 2XXPA 5DVFA 3OELA 2RCBA 1B46A 4PFRA 4KPTA 2I3VA 2DYXA 3BKIB 3R7XA 4QFPA 2XXIA 1DMBA 4NGUA 1N3XA 1ZLQA 4I1DA 1MY3A 4GBWA 2AL5A 1SDXA 1QUJA 1LAFE 2R71A 4IO2A 3FXRA 2MKZA 1AL3A 4OTEA 4THIA 1H3DA 2E0SA 4U1ZA 2DDKA 2R6GE 1SQYA 4GX4A 3FBPA 2WBDA 4EXLA 3V83A 4PF6A 3UP9A 2Y5LA 2OCUA 5ET8A 4OVSA 4PE3A 3UN6A 4F2OA 3VLWA 3TPAA 4OVJA 1SBPA 1N04A 2YLNA 5L9MA 1Y3QA 4GD5A 4NE4A 4OXVA 3MPLA 4JVDA 1O64A 1POTA 5I57A 3ODBA 4P8BA 1FBDA 3G7WA 4LQ5A 3A09A 1UTBB 2DE4A 2HPGA 4FECA 3WAFA 5TPAB 3TQLA 4N15A 3NOHA 4RK9A 2F3DA 1MQJA 3IOVA 1FTMA 3SDFA 4WXJA 1EYKA 1F9BA 3DP8A 3FXQA 4GWZA 4NEDA 3MPKA 1FTJA 1B3LA 4PFTA 4JDFA 4AB6A 4HCWA 4H45A 1US4A 4OHNA 1JP4A 3MC2A 4BDOA 3OOAA 5I2KA 1ZTYA 2ZZWA 4KD5A 3LC8A 4F18A 2I48A 3USDA 2RC8A 2P3VA 3THIA 3O97A 1NV4A 3PMXA 4IO4A 5DVIA 5IKBA 1NUWA 1IZ1A 5AA1A 4QFKA 2QVVA 4MNCA 4MLVA 3FV1A 1R6ZA 3OXNA 2RKMA 1IQ7A 4OEUA 4YB7A 2F6PA 3PUWE 1XT8A 4OERA 3N6TA 4GX6A 3CFXA 3DLNA 4I62A 5DVJA 1Q1KA 2XWVA 4ISUA 3KOTA 3SEVA 1B0HA 1DPEA 1IMCA 5IM2A 2QPQA 3UK4A 5I58B 3B6QA 2JJKA 3JZJA 4H1XA 5ESYA 1SW4A 2B3BA 4OFLA 2XXWA 3BFUA 4G8NA 2HAUA 1LCTA 2AL4A 1GVCA 4Q0CA 2FIEA 4XFEA 1FJ6A 3CHGA 1FBEA 4QSCA 3PGFA 2DWAA 1Y1ZA 2ZNSA 1K9YA 4H8JA 1FTOA 4PBHA 3GYYA 2HQ0A 2Q2AA 2H25A 3EHTA 4ZECA 1DOTA 4LZ5A 2QJEA 1Y3NA 1IMEA 3HV1A 1I6BA 1AWBA 1RYOA 4H65A 1I6AA 4IY5A 4LZ8A 3RT6B 1FRPA 3K1MA 3IX1A 1DTZA 3PU5A 4GL0A 2QVUA 3K0VA 3W15C 1LAHE 4GWYA 1GR2A
chains in the Genus database with same CATH topology
3PTYA 1NV5A 4GWXA 3ROJA 1SPIA 4HCYA 1NV1A 4PAKA 4DI3D 1IMDA 2WYPA 2WEFA 1FPIA 4PBQA 2KR0A 4M1VA 4PDHA 1D9QA 4MNIA 3KBZA 4NG7A 4PF8A 4NHBA 4PCDA 4MAGA 4O8MA 5EQ7A 4IR8A 1G0IA 4F1UA 4X04A 1EYIA 5FBPA 3LUZA 1DCUA 2XWIA 4LN5A 3E78A 3RYDA 1FPGA 1NV0A 3SZPA 3A29A 2F5XA 4O7MA 5EYGA 1FBHA 5EQ9A 5I7IA 2Q74A 1FPLA 2FVZA 2DE2A 1LEVA 2PFZA 1NV3A 4G61A 4YZZA 4GWWA 4GX3A 2Q9TA 4P3LA 4O94A 5J1DA 2WBBA 4NN3A 3B50A 1VDWA 3U65A 4P1EA 1FJ9A 4MX6A 4X9TA 2L5VA 1K9ZA 5LTCA 4KXPA 4NF0A 1KZ8A 1FBGA 3KC1A 1FPBA 2Q8MA 3QMFA 4MJOA 5IZ1A 2FHYA 5DW8A 4P56A 4F19A 2DE3A 4PAFA 1FPKA 2FIXA 4I40A 2HHMA 4H46A 3W9WA 1RDZA 3D1RA 4N81A 4OVPA 1FSAA 1LBVA 4N8YA 2B4LA 2XA5A 4N6KA 3RPLB 4N8GA 2CZHA 4PETA 4MMPA 4N17A 1FTAA 5JK4A 5CM6A 1INPA 4NQ8A 2R8TA 4XF5A 5EQ8A 4MEVA 2VPNA 5T3JA 1FBFA 1YYZA 1DK4A 3MYUA 4OA4A 4O7IA 4PTKA 1NI9A 4P1LA 4HXVA 4P47A 2OWZA 3IFAA 2GQ1A 3BIHA 4PC9A 2PFYA 5ET6A 1FPEA 2CZKA 1QGXA 5J16A 3KC0A 4PGNA 1Q9DA 1RDXA 2FBPA 2VPOA 2VT5A 2BJIA 1IMFA 3ISPA 4F1VA 1LBXA 4XEQA 3E79A 4NX1A 3T1BA 3LV0A 1YZ0A 2F3BA 4UABA 4PFRA 4FBPA 4AS4A 1NUYA 2CEYA 2OX3A 2XXKA 4OANA 1FPJA 4NGUA 4GBWA 5EQAA 5LDZA 1IMAA 2MKZA 1NV6A 2V4CA 4MCOA 2CZIA 2P3NA 3MSTA 4OVTA 3BIGA 4GWYA 2DDKA 1LBWA 4GX4A 3FBPA 2WBDA 4PF6A 2Y5LA 5ET8A 4OVSA 4PE3A 4P9KA 1FBCA 4YICA 4HE0A 2DVZA 2QFLA 4AS5A 1YXIA 5IGAA 4JVDA 3RPLA 1FBPA 2V3QA 4P8BA 1FBDA 2DE4A 2HPGA 1RDYA 4N15A 3NOHA 5ET5A 2F3DA 2XWKA 4QBAA 3EKIA 1EYKA 4GWZA 5ET7A 1FPDA 4HE1A 4HCWA 3HFUA 4H45A 1JP4A 1NV7A 4PDDA 5IZ3A 2HXRA 5IZ3B 2PCRA 2ZZWA 4N4UA 1LBYA 4F18A 1XI6A 1DBZA 2P3VA 3W9VA 1NV4A 4I3EA 2XWOA 1KA1A 5F24A 1NUWA 1LBZA 1FPFA 3FXBA 2QVVA 2ZZVA 4MNCA 2WX9A 2QVRA 1NV2A 4NAPA 2HZLA 4HE2A 3IFCA 4GBVA 1EYJA 1NUZA 4GWSA 4DI4B 4GX6A 2KQZA 1KA0A 2B4MA 4PFBA 2XWVA 4GWUA 4MHFA 4PFIA 4JVCA 5EYHA 4QXDA 2CEXA 1IMCA 5IM2A 2QPQA 5I5PA 5I3SA 4MNPA 2JJKA 3B8BA 4X8RA 5ESYA 4MIJA 4N6DA 2FIEA 4XFEA 1FJ6A 3CHGA 1FBEA 4PAIA 2Y5KA 4I3YA 1K9YA 1G0HA 4PBHA 3GYYA 3T0JA 2HZKA 4JVIA 4PGPA 2ZZXA 1NUXA 5IZZA 1IMEA 1CNQA 1AWBA 5A5LA 1IMBA 4OVQA 1FRPA 4N91A 2WYKA 2QVUA 1BK4A 4OVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JP4 A;  1NV7 A;  1K9Z A;  5IZ3 A;  5IZ3 B;  2PCR A;  1NV5 A;  1LBY A;  4GWX A;  4KXP A;  3ROJ A;  3LV0 A;  1KZ8 A;  1SPI A;  1NV1 A;  1FBG A;  3KC1 A;  1FPB A;  1YZ0 A;  2Q8M A;  3QMF A;  2F3B A;  4MJO A;  5IZ1 A;  4FBP A;  4AS4 A;  1XI6 A;  1DBZ A;  1NUY A;  2FHY A;  2P3V A;  1IMD A;  1NV4 A;  2OX3 A;  5DW8 A;  4I3E A;  2WEF A;  1KA1 A;  5F24 A;  1FPK A;  2FIX A;  1NUW A;  1LBZ A;  1FPI A;  4I40 A;  1FPJ A;  1FPF A;  2HHM A;  2QVV A;  1D9Q A;  4GBW A;  5EQA A;  4H46 A;  2QVR A;  1NV2 A;  3KBZ A;  5LDZ A;  1RDZ A;  3D1R A;  4HE2 A;  4N81 A;  3IFC A;  4GBV A;  1FSA A;  1EYJ A;  1IMA A;  1NUZ A;  1LBV A;  1NV6 A;  4GWS A;  5EQ7 A;  2CZI A;  2P3N A;  4GX6 A;  1G0I A;  4IR8 A;  1KA0 A;  3RPL B;  3BIG A;  1EYI A;  5FBP A;  3LUZ A;  1DCU A;  2DDK A;  2CZH A;  4GWU A;  1LBW A;  4GX4 A;  3FBP A;  2WBD A;  5EYH A;  2Y5L A;  4QXD A;  5ET8 A;  1IMC A;  1FTA A;  1INP A;  2R8T A;  5EQ8 A;  5I3S A;  1FBC A;  2JJK A;  3B8B A;  3RYD A;  5T3J A;  1FBF A;  4HE1 A;  4HE0 A;  1FPG A;  5ESY A;  1NV0 A;  2QFL A;  4AS5 A;  1YXI A;  3A29 A;  1YYZ A;  1DK4 A;  4O7I A;  2FIE A;  5EYG A;  3RPL A;  1FJ6 A;  1FBP A;  1FBE A;  4PTK A;  2Y5K A;  1FBH A;  1NI9 A;  5EQ9 A;  4HXV A;  2Q74 A;  1FPL A;  2OWZ A;  3IFA A;  4I3Y A;  2FVZ A;  1K9Y A;  1G0H A;  2GQ1 A;  1LEV A;  3BIH A;  1FBD A;  3T0J A;  5ET6 A;  1FPE A;  2CZK A;  1NV3 A;  1NUX A;  1RDY A;  1QGX A;  4G61 A;  4GWW A;  3KC0 A;  1IME A;  2F3D A;  4GX3 A;  5ET5 A;  1CNQ A;  1AWB A;  5J16 A;  2WBB A;  5A5L A;  1Q9D A;  1RDX A;  2FBP A;  1IMB A;  1EYK A;  1VDW A;  2VT5 A;  2BJI A;  1IMF A;  1FRP A;  4GWZ A;  5ET7 A;  1FPD A;  1FJ9 A;  2QVU A;  1LBX A;  1BK4 A;  4GWY A;  4H45 A; 
#chains in the Genus database with same CATH topology
 4GIZ A;  3QIM A;  4X48 A;  5CRY A;  2NUV A;  3PMW A;  2UVJ A;  3EF7 A;  4KHZ E;  2DS9 A;  2O7U A;  1FQA A;  5JEI A;  5DEX A;  3TKD A;  1SPI A;  1IIW A;  3KSJ A;  3FD3 A;  3LSX A;  4PFY A;  3U8Q A;  4OFJ A;  3FVO A;  4DI3 D;  1B5J A;  3OO7 A;  1B1X A;  1FPI A;  2RC9 A;  2Y7K A;  2H99 A;  3KJT A;  3PV0 E;  4M1V A;  4ND9 A;  1PB9 A;  4PBQ A;  4XTC Q;  3IO4 A;  3T9X B;  2ZYN A;  4EF1 A;  4MNI A;  3KBZ A;  4NG7 A;  1AOV A;  3KN8 A;  3UIF A;  4NHB A;  4X1D A;  1HSE A;  1TT1 A;  1Q35 A;  3ILT B;  4MAG A;  1IIT A;  5EQ7 A;  3FGS A;  4NF8 A;  3TZA A;  1OQH A;  4I8C A;  4ESX A;  1PBQ A;  4POX A;  1TFA A;  1Y3P A;  2QMX A;  5CI5 A;  1ANF A;  2XX7 A;  4G4P A;  2DWJ A;  3OEK A;  2GRV A;  2F5X A;  3TCH A;  4R9F A;  2Q74 A;  4E0X A;  4EQ7 A;  4RK2 A;  2DE2 A;  5ISU A;  3A3C A;  2Z8E A;  5LOM A;  4ZS9 A;  5F7V A;  4GX3 A;  2O68 A;  2Q9T A;  4NN3 A;  1TFD A;  1PB7 A;  5ELV A;  3PPQ A;  4P1E A;  4LQ2 A;  4KYD A;  3E4R A;  1SYI A;  2PT1 A;  5H8H A;  5CBR A;  1JW4 A;  1LAX A;  1LLS A;  3S9L C;  4KXP A;  4NF0 A;  2AIX A;  1KZ8 A;  1FPB A;  2Q8M A;  3N94 A;  4DE8 A;  4MJO A;  3HPI A;  4BDM A;  1FQC A;  4YKJ A;  1MRP A;  2FHY A;  3MQ9 A;  3FVG A;  3PPN A;  5DW8 A;  4P56 A;  2OLB A;  3MAM A;  4U4S A;  2HHM A;  1JET A;  1YTV A;  4ZE9 A;  1NMU A;  4XKR A;  1UIU A;  4H46 A;  4PE5 B;  5F1Q A;  1N84 A;  3W9W A;  2NXO A;  3D1R A;  4N81 A;  3KN3 A;  2VD2 A;  2PT2 A;  1XC1 A;  1B1H A;  4F31 B;  1LBV A;  2XA5 A;  3H7M A;  4N6K A;  1M5D A;  5TP9 B;  1MDP 1;  1VE4 A;  1MY1 A;  4TLL B;  5JK4 A;  4NQ8 A;  2R8T A;  3U93 A;  4MEV A;  2DXY A;  3FJG A;  3K6W A;  3S4U A;  3S9N C;  1FBF A;  3CIJ A;  3G3J A;  4NF5 A;  4PQJ A;  1B2H A;  4MF3 A;  1B32 A;  3BFT A;  4RNS A;  2OWZ A;  4F39 A;  3RY3 A;  4QFO A;  4PFW A;  4FEB A;  4Q30 B;  2ONS A;  3OSQ A;  2QS2 A;  4U2R A;  1XVY A;  1Q9D A;  5EHM A;  1MQG A;  4ELO A;  4F1V A;  4KI0 E;  4XXU A;  4H8I A;  3UA8 A;  4ZDM A;  1QVS A;  3E3K A;  3E79 A;  4R72 A;  1B9J A;  2XD2 A;  3EPE A;  4OWD A;  5FHN A;  3F11 A;  1GGG A;  4DCX A;  4AS4 A;  5CMK A;  4IY6 A;  2CEY A;  2OX3 A;  4GFR A;  3TTK A;  1FPJ A;  3QSL A;  4XIG Q;  1ZJL A;  3Q25 A;  1QW0 A;  2QS3 A;  3OEN A;  1II5 A;  3E9X A;  4N6P A;  4GWO A;  4IO7 A;  3K1P A;  4DCY A;  1OVT A;  4FAJ A;  4EDP A;  3O9P A;  1M5F A;  1NV6 A;  2CZI A;  1N0T A;  2P0S A;  3V5A A;  3CG1 A;  4QRZ A;  3B6W A;  1Z7M E;  1B05 A;  3LR1 A;  4F3B A;  2REG A;  2M8C A;  1PDA A;  3VLU A;  5KZT A;  3RTW B;  1RYX A;  3T9V A;  5EHS A;  3C9H A;  4HE0 A;  2DVZ A;  2QFL A;  1OLA A;  4ZZE A;  3K6V A;  5IGA A;  1B6H A;  1SVX B;  5M2V A;  3VVD A;  1P1O A;  4XKN A;  1MXV A;  4IO3 A;  3G3H A;  1JNF A;  3PPR A;  5I57 B;  3ECR A;  4QSD A;  3OO6 A;  1MS7 A;  1RDY A;  5ET5 A;  2XWK A;  3EKI A;  1JEV A;  2YJP A;  5ITP A;  3CFL A;  3TEP A;  5ET7 A;  1FPD A;  2VHA A;  1A55 A;  1GV8 A;  4LA9 A;  3SES A;  3M8U A;  1NV7 A;  2DXR A;  4PFU A;  5IZ3 A;  3FV2 A;  4IGR A;  5I2K B;  1OVB A;  4KYS A;  3IB2 A;  3O66 A;  1FTL A;  1LFI A;  3C31 A;  2VD3 A;  3W9V A;  4POW A;  1L5T A;  1KA1 A;  1OLC A;  4NF6 A;  2ZZV A;  1MY4 A;  1NH7 A;  3GBB A;  4QFN A;  1UTH A;  5DYH A;  2QVR A;  4NAP A;  3VXC A;  5H8S A;  4HE2 A;  3IFC A;  4GBV A;  3TTR A;  4DXB A;  2DWI A;  5AA2 A;  2OJT A;  2KQZ A;  1KA0 A;  4PFB A;  4PFI A;  4JVC A;  5FHM A;  5EYH A;  4R2F A;  3HN0 A;  1Y20 A;  2QS4 A;  4YU0 A;  2V25 A;  2YPN A;  4IO6 A;  3PUV E;  5I3S A;  3GBA A;  3IL1 B;  4X8R A;  2A5S A;  4MIJ A;  4N6D A;  1OIB A;  2ZMB A;  2Y5K A;  3Q26 A;  3WAE A;  4G8M A;  3EQ1 A;  1YPN A;  3IB1 A;  1PEB A;  2RC7 A;  3M3K A;  3SEX A;  1LAG E;  4PGP A;  2HXW A;  5ICQ A;  1NUX A;  3PPO A;  5IZZ A;  2HEU A;  4HTG A;  2X26 A;  4OVQ A;  3G3I A;  2WYK A;  4GVO A;  3PD8 A;  3PPP A;  1BK4 A;  1AMF A;  4UA8 A;  3MVW A;  3O28 A;  3HHF A;  1QUI A;  3RUM A;  5L9O A;  3TDJ A;  5DEX B;  4P0G A;  4PAK A;  2GFE A;  1IMD A;  1EZO A;  4ECF A;  2WYP A;  4F3G A;  1FQE A;  3T93 B;  3BBR A;  2KR0 A;  3TOD A;  1SW1 A;  1D9Q A;  3GZG A;  3TFL A;  3CRB A;  1AH5 A;  5L8D A;  2NVU B;  4PF8 A;  3H6V A;  1I69 A;  1B3E A;  2I4B A;  4PCD A;  1BIY A;  4YB6 A;  4O8M A;  3MVY A;  5CBS A;  3KSX A;  3VDF A;  4KQP A;  4NF8 B;  1P1N A;  1EYI A;  5FBP A;  1B5I A;  1B7U A;  1D9V A;  2O1M A;  2VOZ A;  2VGQ A;  1P1U A;  3IAZ A;  4GLI A;  3HHG A;  4OFO A;  3TEL A;  3SEU A;  1B3H A;  2I49 A;  3I6V A;  5AE4 A;  4LUB A;  2F7C A;  4C1T A;  1NV0 A;  2ESN A;  1N3W A;  3SZP A;  4R6K A;  1LGB C;  5EQ9 A;  5I2N A;  5I7I A;  4YMB A;  2I3W A;  1FPL A;  3C34 A;  2PFZ A;  2I0B A;  3G3K A;  2OWT A;  4F1Y A;  4ZEI A;  1EU8 A;  4GWW A;  3V89 B;  4O94 A;  4P3L A;  3B50 A;  3FAS A;  1LBC A;  1OQG A;  3Q27 A;  1PC3 A;  1VFE A;  3O2A A;  4OES A;  4MX6 A;  3N5L A;  1FCK A;  5H8H B;  1JQF A;  2P1S A;  3OMB A;  2D3I A;  1IEJ A;  1MH3 A;  3LSW A;  5LTC A;  3GLB A;  2QS1 A;  4H5G A;  3KC1 A;  3QMF A;  5H8F A;  5IZ1 A;  1B40 A;  3MP1 A;  2DE3 A;  1N76 A;  2W7Y A;  4PAF A;  4YMA A;  2FIX A;  4NWC A;  1XOC A;  4I40 A;  4Q8R A;  3FVN A;  2I58 A;  3SER A;  1NL5 A;  2ANJ A;  3KN7 A;  2ABH A;  3TCG A;  1B52 A;  2Z8F A;  4BDN A;  3KFM A;  1FQD A;  1B58 A;  1GTK A;  4U1O A;  4R2B A;  2B4L A;  3C32 A;  5ICT A;  3K02 A;  2CZH A;  2QSX A;  3ZS6 A;  4PET A;  1O63 A;  4U21 A;  3FJM A;  3AXF A;  3MJN A;  3PUX E;  1INP A;  4XF5 A;  5EQ8 A;  3P7I A;  4DDD A;  5T3J A;  4R9G A;  3CI8 A;  2Q2C A;  2V3U A;  4NF5 B;  2OBG A;  4OA4 A;  4PTK A;  2I0C A;  1NI9 A;  4P1L A;  4HXV A;  4P47 A;  3I3V A;  3IJX B;  3TUS A;  2GQ1 A;  4HW8 A;  3BIH A;  2PFY A;  4R74 A;  3I5O A;  1LBB A;  1NNK A;  3CVG A;  2OZZ A;  4BLA A;  3QAX A;  1MXY A;  1QGX A;  5J16 A;  3KC0 A;  4PGN A;  4RA1 A;  1RDX A;  2GHB A;  3ZKL A;  2FBP A;  2F6G A;  3FIR A;  3OD7 A;  1IMF A;  4MFI A;  1SW2 A;  3QYT A;  1MXU A;  1LBX A;  4TOZ A;  4KCD A;  4XEQ A;  3S9M C;  1Z7N E;  4NX1 A;  2XXY A;  4H0W A;  3T1B A;  5CMM A;  1YZ0 A;  2HCA A;  2F3B A;  4FBP A;  4UAC A;  2VP1 A;  3H6W A;  2XXK A;  4O3B A;  3DP4 A;  2F7B A;  3QK6 A;  1POY 1;  3M3L A;  3IOU A;  3R26 A;  3VV5 A;  1H76 A;  4OZ9 A;  5LDZ A;  5AA4 B;  4JSO A;  1FQB A;  3FZV A;  3K00 A;  4X1B A;  1IXG A;  1A40 A;  3K1N A;  1IMA A;  2V4C A;  4MCO A;  4OVT A;  4EUO A;  4GOT A;  1LBW A;  1UQW A;  4JWY A;  2F35 A;  4ELR A;  1H43 A;  4OEN A;  1EZP A;  4P9K A;  4NWD A;  1FBC A;  2DOJ A;  1MH4 A;  3VVF A;  4YIC A;  2Q88 A;  2Y7R A;  4AS5 A;  1TXF A;  1J1N A;  3RPW A;  2ZYK A;  3C33 A;  1FBP A;  2V3Q A;  4R6H A;  4PP0 A;  3PUZ E;  5K2Y A;  2XXH A;  1HSL A;  1B4Z A;  2H9B A;  4EQ9 A;  5B7D A;  1A8E A;  5I56 B;  2Z23 A;  3K4U A;  1ZIU A;  5DTB A;  2D21 A;  4DXC A;  2O7I A;  4FJP A;  3DP6 A;  1MY0 A;  2HFB A;  4HE1 A;  3HFU A;  2HXR A;  5IZ3 B;  3L6H A;  4N4U A;  5CMC A;  1QKB A;  5FTH A;  3RTF B;  1DBZ A;  3B6T A;  2F97 A;  2UXA A;  4GRK A;  2THI A;  1IXC A;  2DP8 A;  2Q8J A;  1LBZ A;  4K3F A;  4ZEB A;  4NF6 B;  4FIM A;  1NNF A;  3FXB A;  4LVQ A;  3A3U A;  2UYE A;  3TMG A;  2V84 A;  2WX9 A;  4U22 A;  3RGY A;  1UTH B;  1BLF A;  2HZL A;  3ZSF A;  3N26 A;  1M5C A;  1MG1 A;  2UVI A;  1EYJ A;  1R9Q A;  5AA2 B;  4C0R A;  2ZNU A;  3O6H A;  4DI4 B;  2B4M A;  5FHO A;  1Y1M A;  2NOO A;  1BTJ A;  3TQW A;  1QUK A;  1O7T A;  4MHF A;  4JWX A;  3EHU A;  4U23 A;  1MXW A;  1NKX A;  5AA4 A;  3MVX A;  2Y7W A;  4MNP A;  3RN8 A;  1QKA A;  1VFD A;  1URS A;  3ONM A;  2ZYM A;  4ELQ A;  4ESW A;  4YB5 A;  4RXL A;  1AIV A;  5HBC A;  2Z8D A;  4AQ4 A;  4JVI A;  4KR5 A;  1DSN A;  3IR1 A;  3E13 X;  1CNQ A;  1NNP A;  5A5L A;  3IOR A;  2O6A A;  3RNN A;  3FVK A;  1RKM A;  3IOT A;  4OVR A;  1B7Z A;  3MUQ A;  3PTY A;  4IGT A;  3H3G A;  3IJO B;  1NV5 A;  1MXX A;  3ROJ A;  4HCY A;  3U1O A;  1NV1 A;  4I9D A;  5I56 A;  2ZNT A;  2Y7P A;  1LFG A;  2WEF A;  2X7P A;  4DZ1 A;  4XKQ A;  3VFJ A;  1S50 A;  2IEE A;  4Q5T A;  1VR5 A;  3HCQ A;  1I6Q A;  4OMB A;  4EQB A;  2RCA A;  2OPE A;  1IXI A;  2A5T A;  2V93 A;  4XKP A;  4IR8 A;  4ZEK A;  2ZXT A;  1B0L A;  4FED A;  3LUZ A;  1S7Y A;  4LON B;  1XHY A;  3C35 A;  4E0W A;  4QSE A;  5BUU A;  1MY2 A;  2R9J A;  3IK6 B;  3E78 A;  4EXK A;  3TTM A;  2ZYO A;  4NF4 B;  4L17 A;  2Q89 A;  1FPG A;  2XXX A;  3MW0 A;  3A29 A;  2QL3 A;  3MP8 A;  4O7M A;  5EYG A;  1HSJ A;  1S9T A;  5I2N B;  5HPQ A;  4DIG A;  4IB2 A;  3ZKK A;  2Z22 A;  4Z7E A;  4DLD A;  4C1U A;  2UYF A;  3KJ7 A;  4YZZ A;  4JBZ A;  5IAI A;  5J1D A;  2WBB A;  1LCF A;  3KBR A;  1VDW A;  3DEL B;  3H03 A;  3U94 A;  3GXA A;  1JEU A;  3VE1 B;  3RT8 A;  2PBW A;  3UOR A;  3ILU B;  1K9Z A;  4G8H A;  1NFT A;  4F2Q A;  1B51 A;  1QJM A;  1YAE A;  5H8F B;  1PBP A;  1URD A;  4F19 A;  3MP6 A;  1WOD A;  2G93 A;  4ZEF A;  1OMP A;  1ZBM A;  3FXU A;  5L9S A;  2H98 A;  1JW1 A;  3LBS A;  3O6I A;  3IO6 A;  3D4C A;  5K2X A;  4O3C A;  4OVP A;  1FSA A;  2H4I A;  1B3F A;  1SYH A;  4N8Y A;  3Q29 A;  3RPL B;  4YKK A;  1D3K A;  3RLF E;  4ELP A;  3G3G A;  2B65 A;  4JXI A;  5H8Q A;  1XVX A;  4N17 A;  4OET A;  1FTA A;  5CM6 A;  4G68 A;  4M4G A;  3DM0 A;  2VPN A;  1MQD A;  1FQF A;  2F34 A;  4LP2 B;  4TLM B;  3U92 A;  1DK4 A;  3MYU A;  3CFZ A;  3MZ1 A;  5CC2 A;  2O51 A;  1IUD A;  5KCJ A;  1WDN A;  4PC9 A;  3OEM A;  3OSR A;  3QUJ A;  1FPE A;  5I59 A;  1M5E A;  2QRY A;  1TWY A;  2KLF A;  2XXV A;  5HM4 B;  4NF4 A;  2VPO A;  2BJI A;  4G68 C;  2WKY A;  1URG A;  3H06 B;  1USY H;  2I4C A;  5JTY A;  1MPB A;  5KDT B;  2LAO A;  3LV0 A;  2I6E A;  2XXR A;  2O84 X;  1CB6 A;  4UAB A;  4YKI A;  1NUY A;  1NH8 A;  3MBP A;  3VVE A;  4FAT A;  4G2Z A;  3QXM A;  3VLV A;  4JB7 A;  1FTK A;  3MWB A;  4QHQ A;  4OAN A;  4F22 A;  3C36 A;  2UVH A;  3T96 B;  5EQA A;  2AYS A;  3MZ9 A;  4P0I A;  2Y7I A;  4N07 A;  1EH3 A;  2ONK E;  3Q28 A;  1FW0 A;  2PMS A;  3FUZ A;  2ALU A;  1LST A;  3TAJ A;  3H6U A;  1B3G A;  1IXH A;  2XHD A;  1SI0 A;  2P3N A;  3MST A;  4H5F A;  3BIG A;  4R73 A;  1PB8 A;  3HST A;  5FTI A;  4OYV A;  3R6U A;  2O69 A;  2XXU A;  3S9E A;  3N6U A;  4H67 A;  4WKM A;  3CSB A;  3JV9 A;  1XS5 A;  2UVG A;  1YXI A;  4GXS B;  3T66 A;  5AA2 D;  2GH9 A;  2F8D A;  3SEW A;  3RPL A;  3U72 A;  2HAV A;  1MQI A;  2QMW A;  1UTB A;  3K6U A;  3L6G A;  4IO5 A;  5TPA A;  1A8F A;  4OEV A;  5EYF A;  4QBA A;  2FA7 A;  4RPO A;  4F3S A;  2X7Q A;  4LAT A;  3K6X A;  2GHA A;  4PDD A;  3T22 A;  1Y4T A;  2OPD A;  2E1S A;  2PCR A;  1LBY A;  4GQO A;  4Z0I A;  1R9L A;  1EZ9 A;  2V3T A;  1XI6 A;  1B4H A;  1M5B A;  4I3E A;  2XWO A;  5F24 A;  3C4M A;  1P1W A;  2OK2 A;  1FPF A;  4QFL A;  1ZKB A;  4U4X A;  1D4N A;  2XX9 A;  3FAT A;  3MZB A;  1NV2 A;  2PVU A;  2DWH A;  3K2D A;  4NMY A;  5KDT A;  1A7L A;  2FYI A;  3LSL A;  1NUZ A;  3TCF A;  2DVC A;  4AB5 A;  4GWS A;  1WVJ A;  1R1N A;  3LSF B;  4BDL A;  4GWU A;  4G77 A;  4QXD A;  3QUF A;  1MQH A;  2CEX A;  5TU0 A;  3KOS A;  5I5P A;  1JVY A;  5I58 A;  2XX8 A;  3B8B A;  4OQO A;  4QF9 A;  3OO8 A;  1T0K A;  4PAI A;  4I3Y A;  1MPD A;  1BKA A;  1G0H A;  3PMV A;  3T0J A;  2DQV A;  2HZK A;  4FOR A;  2ZZX A;  4KFQ A;  4R6Y A;  1A54 A;  3B7D A;  4F3P A;  4O3A A;  1IMB A;  4N91 A;  1US5 A;  3PUY E;  3SKP A;  1N7W A;  5DT6 A;  2XXT A;  2H5Y A;  5B70 A;  4GWX A;  1JVX A;  2F78 A;  1MXZ A;  4ZZA A;  4F29 A;  1USY E;  3FJ7 A;  4ZE8 A;  3TTL A;  1LFH A;  4N13 A;  4PDH A;  1SW5 A;  1JW5 A;  2G29 A;  1B5H A;  3UGW A;  2PX1 A;  3CG3 A;  4RPN A;  5A5X B;  1ZMG A;  1ZU0 A;  2A5T B;  2XXQ A;  1G0I A;  4F1U A;  1VSO A;  1ATG A;  4X04 A;  1SI1 A;  1DCU A;  3S2V A;  2XWI A;  2CMO A;  4LN5 A;  4MLQ A;  2F7A A;  3T9H B;  2Y84 A;  3KG2 A;  3G3F A;  1D9Y A;  3RYD A;  2RIN A;  1ELJ A;  1SD3 A;  4NTL A;  1YCJ A;  1P99 A;  3EHS A;  1FBH A;  3MVZ A;  3EN3 A;  4YKP A;  5H8N B;  2FVZ A;  4KCC A;  1LEV A;  3D4G A;  4TQU Q;  1NV3 A;  4MH5 A;  3CSG A;  4G61 A;  3KZG A;  4ONY A;  1P1Q A;  4EF2 A;  3U65 A;  3KGC A;  4RJZ A;  1FJ9 A;  4X9T A;  1DTG A;  3TYH A;  2CZL A;  2B3F A;  3H6T A;  5I84 A;  2IA4 A;  2L5V A;  3SEY A;  3LUY A;  2PYY A;  5CMB A;  3PD9 A;  4BDR A;  2XD3 A;  3M3F A;  1FBG A;  1Y4C A;  1QUL A;  1MDQ A;  1FPK A;  1LB8 A;  4GL8 A;  3IB0 A;  5ITO A;  4RYA A;  1A99 A;  1NNT A;  3V8X B;  1RDZ A;  1DPP A;  4H6D A;  2DSF A;  1MPC A;  3RQT A;  1H44 A;  3TTN A;  5AA3 A;  3KEI A;  1KWH A;  4N8G A;  4JSD A;  4FE8 A;  5TP9 A;  2RF1 A;  2F36 A;  3O29 A;  5H8Q B;  1Y9U A;  4MMP A;  4BDQ A;  2FNC A;  1LB9 A;  3IOW A;  4HS7 A;  4WED A;  2P2A A;  4G68 B;  4GF8 A;  5A5X A;  1YYZ A;  2D5W A;  4O7I A;  1BP5 A;  3O6G A;  4RY1 A;  3IFA A;  2OWS A;  5KCJ B;  5ET6 A;  2CZK A;  4YAH X;  5I59 B;  4KYE A;  1MM7 A;  1H45 A;  3OO9 A;  3K01 A;  3CR9 A;  2O1L A;  2BJJ X;  2NWJ A;  4GXA A;  3JYR A;  4ZED A;  1MM6 A;  2VT5 A;  5BWJ A;  1CE2 A;  2REJ A;  3ISP A;  4R75 A;  4MBP A;  2ONR A;  5H8N A;  3T9U A;  4WEP A;  4JWO A;  3SET A;  4DXU A;  3VXB A;  5JTY B;  4LZ7 A;  3H4Z A;  1B7H A;  1UIV A;  3HO7 A;  4P11 A;  1N7X A;  2XXP A;  5DVF A;  3OEL A;  2RCB A;  1B46 A;  4PFR A;  4KPT A;  2I3V A;  2DYX A;  3BKI B;  3R7X A;  4QFP A;  2XXI A;  1DMB A;  4NGU A;  1N3X A;  1ZLQ A;  4I1D A;  1MY3 A;  4GBW A;  2AL5 A;  1SDX A;  1QUJ A;  1LAF E;  2R71 A;  4IO2 A;  3FXR A;  2MKZ A;  1AL3 A;  4OTE A;  4THI A;  1H3D A;  2E0S A;  4U1Z A;  2DDK A;  2R6G E;  1SQY A;  4GX4 A;  3FBP A;  2WBD A;  4EXL A;  3V83 A;  4PF6 A;  3UP9 A;  2Y5L A;  2OCU A;  5ET8 A;  4OVS A;  4PE3 A;  3UN6 A;  4F2O A;  3VLW A;  3TPA A;  4OVJ A;  1SBP A;  1N04 A;  2YLN A;  5L9M A;  1Y3Q A;  4GD5 A;  4NE4 A;  4OXV A;  3MPL A;  4JVD A;  1O64 A;  1POT A;  5I57 A;  3ODB A;  4P8B A;  1FBD A;  3G7W A;  4LQ5 A;  3A09 A;  1UTB B;  2DE4 A;  2HPG A;  4FEC A;  3WAF A;  5TPA B;  3TQL A;  4N15 A;  3NOH A;  4RK9 A;  2F3D A;  1MQJ A;  3IOV A;  1FTM A;  3SDF A;  4WXJ A;  1EYK A;  1F9B A;  3DP8 A;  3FXQ A;  4GWZ A;  4NED A;  3MPK A;  1FTJ A;  1B3L A;  4PFT A;  4JDF A;  4AB6 A;  4HCW A;  4H45 A;  1US4 A;  4OHN A;  1JP4 A;  3MC2 A;  4BDO A;  3OOA A;  5I2K A;  1ZTY A;  2ZZW A;  4KD5 A;  3LC8 A;  4F18 A;  2I48 A;  3USD A;  2RC8 A;  2P3V A;  3THI A;  3O97 A;  1NV4 A;  3PMX A;  4IO4 A;  5DVI A;  5IKB A;  1NUW A;  1IZ1 A;  5AA1 A;  4QFK A;  2QVV A;  4MNC A;  4MLV A;  3FV1 A;  1R6Z A;  3OXN A;  2RKM A;  1IQ7 A;  4OEU A;  4YB7 A;  2F6P A;  3PUW E;  1XT8 A;  4OER A;  3N6T A;  4GX6 A;  3CFX A;  3DLN A;  4I62 A;  5DVJ A;  1Q1K A;  2XWV A;  4ISU A;  3KOT A;  3SEV A;  1B0H A;  1DPE A;  1IMC A;  5IM2 A;  2QPQ A;  3UK4 A;  5I58 B;  3B6Q A;  2JJK A;  3JZJ A;  4H1X A;  5ESY A;  1SW4 A;  2B3B A;  4OFL A;  2XXW A;  3BFU A;  4G8N A;  2HAU A;  1LCT A;  2AL4 A;  1GVC A;  4Q0C A;  2FIE A;  4XFE A;  1FJ6 A;  3CHG A;  1FBE A;  4QSC A;  3PGF A;  2DWA A;  1Y1Z A;  2ZNS A;  1K9Y A;  4H8J A;  1FTO A;  4PBH A;  3GYY A;  2HQ0 A;  2Q2A A;  2H25 A;  3EHT A;  4ZEC A;  1DOT A;  4LZ5 A;  2QJE A;  1Y3N A;  1IME A;  3HV1 A;  1I6B A;  1AWB A;  1RYO A;  4H65 A;  1I6A A;  4IY5 A;  4LZ8 A;  3RT6 B;  1FRP A;  3K1M A;  3IX1 A;  1DTZ A;  3PU5 A;  4GL0 A;  2QVU A;  3K0V A;  3W15 C;  1LAH E;  4GWY A;  1GR2 A; 
#chains in the Genus database with same CATH homology
 3PTY A;  1NV5 A;  4GWX A;  3ROJ A;  1SPI A;  4HCY A;  1NV1 A;  4PAK A;  4DI3 D;  1IMD A;  2WYP A;  2WEF A;  1FPI A;  4PBQ A;  2KR0 A;  4M1V A;  4PDH A;  1D9Q A;  4MNI A;  3KBZ A;  4NG7 A;  4PF8 A;  4NHB A;  4PCD A;  4MAG A;  4O8M A;  5EQ7 A;  4IR8 A;  1G0I A;  4F1U A;  4X04 A;  1EYI A;  5FBP A;  3LUZ A;  1DCU A;  2XWI A;  4LN5 A;  3E78 A;  3RYD A;  1FPG A;  1NV0 A;  3SZP A;  3A29 A;  2F5X A;  4O7M A;  5EYG A;  1FBH A;  5EQ9 A;  5I7I A;  2Q74 A;  1FPL A;  2FVZ A;  2DE2 A;  1LEV A;  2PFZ A;  1NV3 A;  4G61 A;  4YZZ A;  4GWW A;  4GX3 A;  2Q9T A;  4P3L A;  4O94 A;  5J1D A;  2WBB A;  4NN3 A;  3B50 A;  1VDW A;  3U65 A;  4P1E A;  1FJ9 A;  4MX6 A;  4X9T A;  2L5V A;  1K9Z A;  5LTC A;  4KXP A;  4NF0 A;  1KZ8 A;  1FBG A;  3KC1 A;  1FPB A;  2Q8M A;  3QMF A;  4MJO A;  5IZ1 A;  2FHY A;  5DW8 A;  4P56 A;  4F19 A;  2DE3 A;  4PAF A;  1FPK A;  2FIX A;  4I40 A;  2HHM A;  4H46 A;  3W9W A;  1RDZ A;  3D1R A;  4N81 A;  4OVP A;  1FSA A;  1LBV A;  4N8Y A;  2B4L A;  2XA5 A;  4N6K A;  3RPL B;  4N8G A;  2CZH A;  4PET A;  4MMP A;  4N17 A;  1FTA A;  5JK4 A;  5CM6 A;  1INP A;  4NQ8 A;  2R8T A;  4XF5 A;  5EQ8 A;  4MEV A;  2VPN A;  5T3J A;  1FBF A;  1YYZ A;  1DK4 A;  3MYU A;  4OA4 A;  4O7I A;  4PTK A;  1NI9 A;  4P1L A;  4HXV A;  4P47 A;  2OWZ A;  3IFA A;  2GQ1 A;  3BIH A;  4PC9 A;  2PFY A;  5ET6 A;  1FPE A;  2CZK A;  1QGX A;  5J16 A;  3KC0 A;  4PGN A;  1Q9D A;  1RDX A;  2FBP A;  2VPO A;  2VT5 A;  2BJI A;  1IMF A;  3ISP A;  4F1V A;  1LBX A;  4XEQ A;  3E79 A;  4NX1 A;  3T1B A;  3LV0 A;  1YZ0 A;  2F3B A;  4UAB A;  4PFR A;  4FBP A;  4AS4 A;  1NUY A;  2CEY A;  2OX3 A;  2XXK A;  4OAN A;  1FPJ A;  4NGU A;  4GBW A;  5EQA A;  5LDZ A;  1IMA A;  2MKZ A;  1NV6 A;  2V4C A;  4MCO A;  2CZI A;  2P3N A;  3MST A;  4OVT A;  3BIG A;  4GWY A;  2DDK A;  1LBW A;  4GX4 A;  3FBP A;  2WBD A;  4PF6 A;  2Y5L A;  5ET8 A;  4OVS A;  4PE3 A;  4P9K A;  1FBC A;  4YIC A;  4HE0 A;  2DVZ A;  2QFL A;  4AS5 A;  1YXI A;  5IGA A;  4JVD A;  3RPL A;  1FBP A;  2V3Q A;  4P8B A;  1FBD A;  2DE4 A;  2HPG A;  1RDY A;  4N15 A;  3NOH A;  5ET5 A;  2F3D A;  2XWK A;  4QBA A;  3EKI A;  1EYK A;  4GWZ A;  5ET7 A;  1FPD A;  4HE1 A;  4HCW A;  3HFU A;  4H45 A;  1JP4 A;  1NV7 A;  4PDD A;  5IZ3 A;  2HXR A;  5IZ3 B;  2PCR A;  2ZZW A;  4N4U A;  1LBY A;  4F18 A;  1XI6 A;  1DBZ A;  2P3V A;  3W9V A;  1NV4 A;  4I3E A;  2XWO A;  1KA1 A;  5F24 A;  1NUW A;  1LBZ A;  1FPF A;  3FXB A;  2QVV A;  2ZZV A;  4MNC A;  2WX9 A;  2QVR A;  1NV2 A;  4NAP A;  2HZL A;  4HE2 A;  3IFC A;  4GBV A;  1EYJ A;  1NUZ A;  4GWS A;  4DI4 B;  4GX6 A;  2KQZ A;  1KA0 A;  2B4M A;  4PFB A;  2XWV A;  4GWU A;  4MHF A;  4PFI A;  4JVC A;  5EYH A;  4QXD A;  2CEX A;  1IMC A;  5IM2 A;  2QPQ A;  5I5P A;  5I3S A;  4MNP A;  2JJK A;  3B8B A;  4X8R A;  5ESY A;  4MIJ A;  4N6D A;  2FIE A;  4XFE A;  1FJ6 A;  3CHG A;  1FBE A;  4PAI A;  2Y5K A;  4I3Y A;  1K9Y A;  1G0H A;  4PBH A;  3GYY A;  3T0J A;  2HZK A;  4JVI A;  4PGP A;  2ZZX A;  1NUX A;  5IZZ A;  1IME A;  1CNQ A;  1AWB A;  5A5L A;  1IMB A;  4OVQ A;  1FRP A;  4N91 A;  2WYK A;  2QVU A;  1BK4 A;  4OVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...