2VT5A

Fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate -1- phosphohydrolase) (e.c.3.1.3.11) complexed with a dual binding amp site inhibitor
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Fbpase Inhibitors Gain 10(5) Times in Potency When Simultaneously Binding Two Neighboring AMP Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords FRUCTOSE-1,6-BISPHOSPHATASE 1
total genus 106
structure length 319
sequence length 327
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2008-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2vt5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2vt5A02
1LEVA 2WBBA 3KBZA 5IZ3A 2OX3A 3BIGA 2JJKA 1KZ8A 2VT5A 5FBPA 2FIEA 1LBZA 1EYKA 1D9QA 2PCRA 4GWSA 1NI9A 1IMFA 1NV2A 1FBHA 1NV6A 1IMDA 1FPJA 1FPFA 2DDKA 5EYGA 2QVUA 3RPLA 4I40A 2HHMA 1RDYA 1EYIA 1IMEA 3LV0A 3RPLB 1JP4A 5EQ9A 2FHYA 4G61A 2P3VA 1VDWA 3IFAA 2CZIA 1IMBA 3KC1A 1KA1A 1FPEA 3ROJA 4GX3A 1YXIA 4N81A 2WEFA 5EQ8A 1CNQA 5EQAA 1FJ9A 1BK4A 1FSAA 1NV0A 1FPKA 1K9ZA 2F3BA 4GBWA 1FBDA 1LBWA 4HXVA 1FBEA 3FBPA 5ET8A 5IZ1A 1IMCA 2BJIA 1FJ6A 4GWWA 4GX6A 1INPA 1DK4A 4GWXA 2F3DA 4AS4A 1FPGA 2WBDA 1IMAA 4IR8A 3B8BA 1FPIA 1NUYA 2GQ1A 1FTAA 1LBVA 1EYJA 1RDZA 2CZKA 2QFLA 3D1RA 1G0HA 1NV3A 1FPBA 2P3NA 4I3EA 5DW8A 2Y5KA 4I3YA 1NV4A 4PTKA 3RYDA 1AWBA 1NV1A 3T0JA 1FBCA 5J16A 1RDXA 2OWZA 2FVZA 4GWZA 1FBGA 2FBPA 1FRPA 1FPDA 5I3SA 4HE2A 1SPIA 3QMFA 3IFCA 1K9YA 2Q74A 5ET6A 5EQ7A 4MJOA 2Q8MA 3KC0A 5F24A 4GBVA 5ESYA 4GX4A 5IZ3B 4H45A 1NV5A 4GWUA 4O7IA 4HE1A 2QVRA 2R8TA 1NV7A 1NUWA 1DBZA 2FIXA 1G0IA 3BIHA 1NUZA 4FBPA 1QGXA 2CZHA 1YZ0A 1NUXA 1Q9DA 2QVVA 4KXPA 5ET7A 1XI6A 5ET5A 5LDZA 1LBXA 3A29A 3LUZA 1DCUA 1FBFA 2Y5LA 5EYHA 4H46A 4HE0A 1FPLA 1KA0A 4QXDA 5T3JA 4AS5A 4GWYA 1LBYA 1FBPA 5A5LA 1YYZA
chains in the Genus database with same CATH superfamily
1O63A 1P99A 4ZZAA 4QSCA 2D5WA 3IOVA 4YKPA 4EDPA 1NI9A 4YICA 1FPJA 4I40A 4MLVA 3KJ7A 1RYXA 1US4A 2QS4A 2FHYA 2BJJX 4ELRA 4IO3A 1IMBA 1KA1A 1J1NA 2WEFA 4H5FA 1MQJA 3KSJA 3FATA 4BDLA 2F3BA 3UA8A 4YAHX 4IO7A 2P1SA 3TAJA 1RYOA 2DE2A 1IEJA 2VP1A 1WDNA 5FHNA 1SW1A 4Q0CA 4I3EA 5DW8A 2X7QA 1MDP1 1B2HA 2OWSA 1MM7A 4N6KA 2DWJA 3C34A 1POTA 1UTHB 2F6PA 4ZEFA 2NVUB 1BLFA 4MAGA 1Z7NE 1R1NA 2REGA 1SYIA 5L9SA 1B1HA 4LZ8A 4OFOA 1MQGA 1LAHE 1PBPA 3O6HA 1YZ0A 1PB8A 5JTYA 3FV2A 3IR1A 2PVUA 1A8EA 3DM0A 5ET5A 1Y3PA 4O8MA 3V8XB 4PFRA 1B46A 2NUVA 3B6QA 2FYIA 3OOAA 3PUXE 5I56A 1JW1A 4HW8A 3UORA 1XC1A 4G68B 5A5LA 3A3UA 4GIZA 4IB2A 1L5TA 2VT5A 3FASA 4MLQA 4LQ5A 2R6GE 2GHBA 4MNCA 3HHFA 4JVCA 3KFMA 1YCJA 2Q88A 5FTHA 1ZKBA 4GL0A 2I4CA 3VDFA 2OK2A 3MP6A 1XHYA 4JSOA 3G3FA 3F11A 4OETA 5I57A 4OVSA 1YXIA 4XKNA 1VFDA 2AYSA 4OZ9A 4FJPA 4GXAA 1FBEA 3SEXA 3SEVA 2BJIA 4ZE8A 5B7DA 4FAJA 2D3IA 2CZKA 3D4GA 3USDA 2B4MA 4IO5A 1D4NA 4C1TA 1LB8A 3IO4A 4QFNA 5ELVA 1DOTA 3LSLA 2OWZA 1MQHA 2GH9A 3KEIA 4ZEBA 1AL3A 2G29A 2Q8MA 3N5LA 3EHTA 4YZZA 1MXUA 2XX9A 1SBPA 3MBPA 1DBZA 3ZSFA 2F78A 4OTEA 2DQVA 3O97A 3PPRA 1MS7A 5LDZA 3VV5A 2CEYA 3JZJA 4TLLB 1IXHA 5EYHA 4KYSA 2AIXA 5T3JA 2DVZA 4G8NA 5I2KB 1Y4CA 1LAGE 1BIYA 3MQ9A 3FVGA 4PF6A 2F7AA 2O7UA 4PFWA 1EYIA 1SVXB 5EQ9A 2M8CA 2B3BA 5H8HB 4GX3A 2OWTA 3W15C 5TP9A 1CNQA 3I3VA 1H76A 4LATA 3OO8A 1NV0A 3HCQA 4P1EA 4THIA 4X8RA 3KJTA 4NWCA 4QSEA 4R9FA 4HXVA 3W9VA 1P1OA 4OHNA 1INPA 4O7MA 1CB6A 1MXWA 4N15A 3KBRA 4EF1A 1FTAA 3PD8A 1G0HA 2P3NA 4XXUA 4OVQA 4AB6A 3FIRA 3FJ7A 1II5A 5J1DA 4O3CA 1R6ZA 2P2AA 3RT8A 1DMBA 5CMKA 4QFOA 1A7LA 3GLBA 4ELPA 1HSEA 4P0GA 1JVXA 4MJOA 1PB9A 4U4SA 3TQLA 5JK4A 1URSA 1JQFA 4F1YA 2UVJA 3P7IA 3QIMA 1IUDA 3EKIA 2QVRA 3ILTB 4I9DA 4JBZA 1AMFA 1QGXA 1P1QA 1WODA 2Y7PA 4LZ5A 3ZKKA 4KR5A 4WKMA 3QK6A 1XI6A 2KLFA 4R73A 3LUZA 2PX1A 3M8UA 1Y4TA 4BDOA 5I58A 1D9YA 4QXDA 1JEVA 2H9BA 2NOOA 3LSWA 2THIA 1NNTA 3T9UA 3VLWA 5IZ3A 2VD2A 1A55A 1ZTYA 4KI0E 3B6WA 1TXFA 1Y1MA 3E79A 3N26A 3UP9A 1WVJA 4HCYA 5H8HA 3MVYA 1LFGA 3AXFA 4KCDA 2QJEA 1JP4A 5TP9B 2CZLA 1MPDA 4DLDA 3RGYA 3B7DA 1TFAA 3T93B 3G7WA 2Q2CA 3Q25A 1FPKA 1B0LA 4F2OA 4GBWA 3DLNA 2XWOA 4U2RA 1USYE 4MFIA 2F6GA 4LP2B 4GWWA 4M1VA 4L17A 5F7VA 3DP4A 4AS4A 3LSFB 1MXYA 2A5TB 4F22A 3RTWB 3KG2A 4G8MA 4GQOA 1SI1A 2Q2AA 3K6VA 2DXRA 4GVOA 3MPKA 3TTRA 3K6XA 3MSTA 4YU0A 1FPDA 3CG3A 3VE1B 2HAUA 4H8IA 5HM4B 2XD3A 3C4MA 3MVXA 5CRYA 4R75A 4EUOA 4DDDA 4FEDA 3VLUA 3GYYA 2D21A 3TELA 1MH3A 3OSQA 4F3GA 3IOWA 2V3TA 3H7MA 5HPQA 5DVFA 3KOSA 4KYDA 4F3PA 5AA2D 1B40A 1A40A 4OEUA 4U23A 2Y5LA 3CSBA 4G8HA 4RXLA 4OEVA 4NWDA 1OQGA 3KBZA 4KPTA 4OESA 3JV9A 4GWSA 2XWVA 3FVOA 4NF0A 4NX1A 4Q30B 1UTBB 4PBQA 4M4GA 2XWIA 1A8FA 1ZBMA 4EXKA 4ELQA 2REJA 3KN8A 1P1NA 2ZYKA 2QMWA 1Y3QA 2H5YA 5KDTB 3QXMA 2XX8A 4IR8A 4PFIA 4OENA 4N91A 5JTYB 2PT1A 3RYDA 4H65A 4PAFA 5EHMA 3MP1A 4BDNA 5I7IA 1FRPA 1XVXA 4MHFA 2ZNUA 2HZKA 2XXQA 4U21A 2V4CA 4H45A 4GWUA 1SI0A 3TCFA 1SYHA 3GBBA 2XXUA 3E9XA 4YB7A 3UGWA 4F39A 1B3FA 3FGSA 4MX6A 4OA4A 2F36A 3PPNA 4NTLA 1SW2A 2ZNTA 4IO6A 4NG7A 4PF8A 4WEDA 4N8GA 1FBFA 3I5OA 4H46A 4R6HA 4N13A 4MNIA 3C32A 3O9PA 3T1BA 1LBYA 1B5IA 1YYZA 3VXCA 3M3FA 4X04A 5A5XB 2HAVA 1PB7A 4N17A 3H6UA 3VXBA 3E3KA 1ATGA 4BLAA 2FNCA 1DSNA 3K2DA 3H3GA 1EU8A 1UIUA 4NF5A 3PUWE 4OVTA 3FV1A 2HCAA 4X1DA 4GRKA 1QVSA 5DEXB 4P8BA 3LV0A 4FECA 4MEVA 1BKAA 3RT6B 3TTMA 4N6PA 1M5CA 1IITA 1R9LA 3BKIB 1P1UA 4X9TA 3OEMA 1PEBA 3OENA 4XKPA 1IIWA 1IMCA 4R6YA 3V89B 2OBGA 4PCDA 2I0BA 1RDZA 4IO2A 1MDQA 4DIGA 1NV3A 4MF3A 1FTKA 4DCYA 5JEIA 2E0SA 1LCTA 4EQ9A 4FORA 1NH7A 3IAZA 3M3KA 5AE4A 1B3GA 4O94A 4POXA 1VSOA 3VVEA 2PT2A 5EYFA 4KHZE 3TKDA 5TPAB 3PPQA 1FQBA 2Q74A 1SQYA 2Q89A 4XKRA 2Z8FA 2DXYA 4NF6A 1QULA 3HN0A 2ANJA 5L9OA 1OQHA 4YB5A 4QF9A 2UXAA 1G0IA 4YMBA 1BP5A 2GRVA 3IL1B 5DT6A 1I69A 2ESNA 3MZ9A 2XXIA 3TTLA 4ZS9A 5AA3A 1OVTA 5A5XA 1A99A 3TTKA 4AS5A 3Q28A 5I56B 2ZNSA 1EZ9A 3A09A 4OYVA 2DWIA 1EYKA 1VE4A 3RTFB 4I8CA 3U94A 1NV6A 1IMDA 2DE3A 2ZYMA 5DEXA 3OEKA 3RPLA 1MY1A 4KYEA 3IO6A 3L6GA 4ECFA 1N84A 4QRZA 3KGCA 1EZPA 2CZIA 5H8QB 4Q8RA 2DYXA 4PFUA 4RNSA 1QUIA 4LONB 2VHAA 1MRPA 1K9ZA 5AA2B 1NNPA 4MBPA 4FIMA 3H6WA 1NH8A 2XXVA 2F35A 4PDHA 3U65A 3C36A 3E78A 5FTIA 4R6KA 3IB0A 3W9WA 2CEXA 4ELOA 3U1OA 4LA9A 3RLFE 1IZ1A 1JW5A 3TODA 4F3SA 2B65A 3RQTA 2DE4A 1ZU0A 2HZLA 2ZZVA 3MZ1A 3WAEA 2I6EA 5F24A 4Q5TA 4GBVA 3PUVE 5IZ3B 1B7HA 1QKBA 3K0VA 2P0SA 3IORA 4R74A 1B3EA 3RN8A 2FIXA 3SESA 2XD2A 1Q9DA 5ET7A 4C0RA 1LSTA 4KCCA 1S7YA 2IEEA 2V3UA 5H8NB 1FPLA 1KA0A 2HFBA 2Y7KA 4YMAA 3OO6A 5I5PA 1US5A 1B3HA 1N3XA 3T66A 1LBZA 1FTJA 1ANFA 1D9QA 2V93A 1NV2A 5ITPA 5I2KA 2F7CA 1FPFA 3CI8A 2OCUA 3IJOB 4H67A 1GV8A 4RA1A 1N04A 3KC1A 3QUFA 2DWHA 4G68A 4QFLA 1LAXA 1HSJA 4P47A 1B9JA 3EN3A 2DWAA 4NAPA 5ICTA 4P1LA 5IKBA 3DELB 5HBCA 3TCGA 1AOVA 5I2NA 5IZ1A 1JEUA 1T0KA 4OVRA 3R6UA 2YPNA 2VGQA 1IMAA 1UQWA 5LOMA 3SZPA 1KWHA 3DP8A 4FEBA 1LAFE 2E1SA 4EF2A 4G4PA 3TDJA 3LR1A 5I57B 1RDXA 1HSLA 2HXRA 3K00A 4GWZA 5K2XA 4JSDA 3BFTA 3QMFA 2I49A 5H8FA 5EQ7A 4PP0A 1QJMA 1I6AA 2Y84A 5CMMA 4PQJA 2KR0A 4O3BA 1NFTA 1ZJLA 3VVFA 3BIHA 1QW0A 5M2VA 4UABA 2HXWA 5I59A 3QUJA 1FTMA 4P11A 3C31A 1DPEA 2F7BA 3WAFA 3MAMA 4YKIA 2OLBA 3K6UA 2WBBA 3ZS6A 4OMBA 3BIGA 3HO7A 3C9HA 5DVJA 1M5BA 1I6QA 1GGGA 3PUZE 1DTGA 4QHQA 2RC7A 3U92A 1QUKA 5BUUA 3ODBA 5EYGA 2QVUA 1IXGA 4XEQA 3PMXA 4POWA 4U1OA 4ZEDA 4AQ4A 4KD5A 5CM6A 4G2ZA 3IFAA 4H5GA 4OXVA 4RYAA 1FPEA 2F97A 2WYPA 5I84A 1I6BA 3R26A 2I4BA 1MH4A 1N0TA 2O1LA 4R2BA 3FBPA 3HSTA 1JW4A 2PBWA 3EHUA 3S9EA 3C33A 1DK4A 5BWJA 3MYUA 1SD3A 4FATA 3PPOA 3L6HA 3Q26A 1FQEA 1FPBA 1AH5A 3OSRA 3UIFA 1FBCA 5H8SA 2HPGA 3N94A 1LCFA 2UVHA 1FBGA 3IK6B 1LGBC 2F34A 4E0WA 5CBRA 5ESYA 1B7ZA 5AA4A 1B05A 5DTBA 4OQOA 4NEDA 3OO9A 5CI5A 4PETA 4H8JA 4ZECA 2H98A 4FBPA 2AL4A 2CZHA 1TFDA 3IJXB 2QVVA 3K4UA 3U72A 1H45A 4XF5A 1JVYA 4OWDA 4PC9A 1DCUA 4QFPA 4P56A 1CE2A 1FTOA 3PMVA 3HHGA 1SW5A 3RY3A 3MJNA 2WX9A 4PAIA 1N7WA 4KFQA 1IQ7A 3ILUB 4G68C 2H99A 4I62A 1MQIA 2XWKA 3VVDA 2XHDA 1POY1 3CSGA 3BBRA 3OELA 1RDYA 2R9JA 1YAEA 3G3IA 1LBCA 1MY4A 1URGA 2RCBA 3ROJA 3G3GA 4RPOA 2HQ0A 2RINA 3VFJA 2H25A 3S9LC 1B4ZA 4H6DA 5TPAA 4F3BA 4UACA 1FBDA 4IGTA 5ET8A 3S9MC 4MIJA 2DOJA 2HEUA 2WYKA 2OPDA 1EH3A 1NUYA 4RK2A 1LBVA 3PD9A 4JWYA 2Y5KA 4U22A 4PTKA 4NF4B 1FQAA 4DI4B 4F1VA 1MXXA 3RPWA 4NQ8A 3FUZA 1Z7ME 1YPNA 4NHBA 1N76A 5AA4B 1LBBA 1SW4A 2ABHA 2DVCA 2O7IA 1MPCA 1NUWA 3S9NC 1B3LA 2ZYNA 4PGNA 3TMGA 4MNPA 4DZ1A 4HCWA 4O3AA 3ONMA 2A5SA 4RPNA 5IM2A 2OPEA 2MKZA 3ZKLA 2QPQA 3PGFA 4HTGA 5B70A 4P0IA 1LB9A 4ZDMA 3IB1A 1B58A 4NGUA 1FTLA 1IMFA 2XA5A 4GXSB 2RKMA 3T96B 4G77A 3T9VA 1S9TA 4YKJA 4P3LA 1VDWA 4EQ7A 2B3FA 1ELJA 5EQ8A 5KCJB 3PPPA 1F9BA 4ISUA 1UTHA 2RF1A 3N6TA 2ZZWA 2Z23A 3K02A 2O68A 4RY1A 3CFXA 5F1QA 4GWXA 2DP8A 2PMSA 1N7XA 4I3YA 1NV4A 4JWXA 3H4ZA 5ISUA 4JXIA 2O84X 4NN3A 2XXPA 2XXRA 4HE2A 4NF8A 2F5XA 2ZYOA 5CMCA 1BTJA 1FQCA 3C35A 5KDTA 1AIVA 4PE3A 4GX4A 4OFJA 3GXAA 3OD7A 1ZLQA 3U93A 2QS2A 3SDFA 2PFZA 3MZBA 3CG1A 4DXBA 1O64A 4Z7EA 4RK9A 2O6AA 1SDXA 2XX7A 1NKXA 4HS7A 3FXRA 2ZXTA 4R72A 1FCKA 4DE8A 2AL5A 4F18A 1Y1ZA 4GWOA 2JJKA 1KZ8A 5I2NB 2Q9TA 3KN3A 2YLNA 1B5HA 1TT1A 3FVKA 3CVGA 3CFZA 1B6HA 2Y7IA 3HPIA 3JYRA 1IMEA 4OANA 3KOTA 3RPLB 5KCJA 4G61A 3A3CA 2I3WA 1LLSA 3EQ1A 1FJ9A 5H8QA 4F2QA 2QS3A 4ONYA 5H8FB 4BDRA 4LN5A 4RJZA 5DVIA 4N4UA 1IXIA 1PBQA 5AA2A 3KZGA 3FZVA 4C1UA 3MVZA 3K6WA 2ONKE 1MY3A 2Z22A 1D9VA 3CR9A 4IO4A 4EXLA 3M3LA 4WXJA 1XVYA 4IY6A 3QAXA 4XTCQ 1K9YA 2QS1A 3CFLA 1JNFA 4IGRA 4PAKA 1NV5A 4K3FA 4O7IA 2DSFA 2B4LA 4GL8A 1NNKA 3O2AA 4PFTA 3G3JA 4ZEKA 5L9MA 2VD3A 4OFLA 1PC3A 3GZGA 3NOHA 4JVIA 4LVQA 3B50A 3CHGA 4DXUA 4NF6B 5FBPA 2XXWA 2Z8DA 3O66A 3D4CA 1P1WA 1MY0A 2UVGA 1B5JA 1A54A 2HHMA 3MP8A 4H0WA 3MC2A 2XXYA 2Y7WA 1OVBA 3O6GA 4MCOA 5CC2A 3PUYE 1NMUA 4PDDA 5EQAA 3Q29A 1BK4A 4GF8A 1B32A 5CMBA 3FXQA 4NMYA 1OLAA 2FA7A 2O1MA 1VFEA 2V84A 3DP6A 2WBDA 3FD3A 4R2FA 1B1XA 2GQ1A 4JB7A 3O29A 4OERA 3MVWA 3U8QA 1D3KA 2QL3A 1M5FA 2OJTA 4F31B 2VOZA 5FHOA 2FBPA 2G93A 3RNNA 4F1UA 2ZZXA 4F19A 3EF7A 3IOTA 3HFUA 4Z0IA 2V25A 2X26A 4H1XA 1ZIUA 4U4XA 3E4RA 3S4UA 1B7UA 4MH5A 3LC8A 3UN6A 1YTVA 2IA4A 4I1DA 3V5AA 1B52A 2X7PA 1FQDA 3ISPA 4TQUQ 4XIGQ 1NNFA 3CRBA 4ZZEA 1QUJA 1FQFA 3H03A 1VR5A 4HE0A 1B51A 5K2YA 4N6DA 3FVNA 4DI3D 5ITOA 2CMOA 1M5DA 2W7YA 3IX1A 1XOCA 2QSXA 2Q8JA 1DTZA 2DDKA 3PU5A 2VPNA 2DS9A 4NF4A 1N3WA 1M5EA 1MG1A 3SKPA 5H8NA 2XXHA 4QSDA 1FSAA 1MXVA 4U1ZA 1LBWA 2WKYA 4R9GA 1RKMA 3K1MA 4X48A 3S2VA 5ICQA 4TLMB 4TOZA 3EHSA 1XT8A 4PBHA 4PE5B 4XFEA 1Q35A 3T0JA 3TZAA 5J16A 2NWJA 3PV0E 5IAIA 3FJMA 2RCAA 4JVDA 2FVZA 1S50A 2RC9A 3OXNA 3CIJA 5ET6A 3T22A 4YB6A 3KC0A 4LZ7A 1NL5A 3K1NA 1QKAA 5IZZA 4PGPA 2RC8A 4DXCA 2ZMBA 1OMPA 3MW0A 4HE1A 4ESWA 3OMBA 4EQBA 1MM6A 5L8DA 3QYTA 1NUXA 1UTBA 1JETA 2H4IA 4KXPA 4N07A 5I58B 3T9XB 5KZTA 3E13X 4ZE9A 4JDFA 3SETA 1USYH 3MPLA 3VLVA 2R71A 4GWYA 1FBPA 2I3VA 1LEVA 3TYHA 2FIEA 4BDMA 2YJPA 3H6TA 3PMWA 1OIBA 3SEWA 3TTNA 1GTKA 2O69A 3THIA 1LFHA 3TUSA 5I59B 4N8YA 1MQDA 4QFKA 2P3VA 4GFRA 3EPEA 4N81A 1B0HA 2PFYA 3FJGA 5CBSA 1MY2A 3SERA 4QBAA 3KSXA 2I58A 2L5VA 5LTCA 3KN7A 2UVIA 2OZZA 1FJ6A 2PYYA 1O7TA 2F3DA 2GFEA 1H44A 2UYEA 2QFLA 3D1RA 1ZMGA 3SEYA 4OVPA 3H6VA 3BFUA 3OO7A 1GVCA 2VPOA 2XXKA 1AWBA 1NV1A 4GD5A 5DYHA 5TU0A 3RUMA 3PTYA 1PDAA 3T9HB 5I3SA 3IFCA 1LFIA 4MMPA 4FE8A 2O51A 2XXTA 4YKKA 2ONRA 2R8TA 5EHSA 3LBSA 4OVJA 3TCHA 3FXUA 4NF5B 4DCXA 1OLCA 1LBXA 3A29A 1Y20A 3G3KA 4IY5A 3SEUA 2Z8EA 1TWYA 4ND9A 2Y7RA 3Q27A 4E0XA 3LUYA 3TPAA 3IOUA 2OX3A 1XS5A 3O6IA 1H3DA 4XKQA 2I48A 3FXBA 2PCRA 2NXOA 1FBHA 3G3HA 3UK4A 3MWBA 4AB5A 3TFLA 2UYFA 1FW0A 2F8DA 3LSXA 3V83A 1GR2A 3GBAA 1H43A 3O28A 5IGAA 1IXCA 4KQPA 2LAOA 3K1PA 3N6UA 4WEPA 1URDA 4GX6A 4F29A 1DPPA 2I0CA 4LUBA 1FPGA 1EZOA 4NE4A 3B8BA 4PFYA 5AA1A 1FPIA 1B4HA 1EYJA 3R7XA 4ESXA 2XXXA 4GLIA 3IB2A 3TQWA 4UA8A 2V3QA 1Q1KA 3MUQA 2QRYA 4BDQA 4X1BA 1SPIA 4PFBA 4P9KA 2QMXA 1Y9UA 3QSLA 1R9QA 4NF8B 4LQ2A 3B6TA 3I6VA 1NV7A 3HV1A 2KQZA 4JWOA 2A5TA 3K01A 1UIVA 2ONSA 1NUZA 2GHAA 1MXZA 4GOTA 3TEPA 1Y3NA 5FHMA 3H06B 1MPBA 3ECRA 2ALUA 4ZEIA
chains in the Genus database with same CATH topology
4X04A 1LEVA 2WBBA 3NOHA 3KBZA 5IZ3A 4JVIA 3B50A 4F18A 3CHGA 4DI3D 2OX3A 2WX9A 3BIGA 2JJKA 1KZ8A 2VT5A 5FBPA 4N17A 2Q9TA 4PAIA 2FIEA 1LBZA 1EYKA 4NGUA 1D9QA 3FXBA 2PCRA 4GWSA 2XWVA 1NI9A 4MNCA 4YICA 1IMFA 2XA5A 1NV2A 4JVCA 4PF6A 1FBHA 3E79A 1NV6A 4NF0A 2XWKA 1IMDA 1FPJA 2DE3A 4NX1A 4OVTA 1FPFA 2DDKA 5EYGA 2QVUA 3RPLA 4I40A 2VPNA 2HHMA 4XEQA 4HCYA 4PBQA 4P3LA 1RDYA 1EYIA 4N8YA 1IMEA 4OANA 3LV0A 3RPLB 1JP4A 2XWIA 4MCOA 4P8BA 5EQ9A 2FHYA 4G61A 2P3VA 5CM6A 1VDWA 3IFAA 2CZIA 4MEVA 1IMBA 3KC1A 1KA1A 1FPEA 3ROJA 4GX3A 4OVSA 1YXIA 2WYPA 4N81A 2PFYA 2WEFA 5EQ8A 1CNQA 4PDDA 5EQAA 4QBAA 1FJ9A 1BK4A 1FSAA 1NV0A 5IGAA 1FPKA 4X9TA 4P1EA 2L5VA 4P47A 4NAPA 1K9ZA 2F3BA 4X8RA 4GBWA 1FBDA 4P1LA 5LTCA 1LBWA 2XWOA 4HXVA 3W9VA 1FBEA 3FBPA 4LN5A 5ET8A 5IZ1A 1IMCA 2ZZWA 3U65A 2BJIA 4MIJA 1FJ6A 4GWWA 4M1VA 4GX6A 4OVRA 1INPA 4N4UA 1DK4A 2DE2A 4GWXA 2F3DA 2WYKA 4AS4A 1FPGA 2WBDA 1IMAA 3MYUA 4IR8A 4N15A 4O7MA 4PCDA 4PDHA 4PFIA 3B8BA 3E78A 1FPIA 1NUYA 2GQ1A 1FTAA 1LBVA 1EYJA 1RDZA 2CZKA 2QFLA 3D1RA 3SZPA 1G0HA 2B4MA 1NV3A 1FPBA 2P3NA 4I3EA 5DW8A 4OVPA 2Y5KA 4N91A 3W9WA 4OVQA 4I3YA 1NV4A 4PTKA 2CEXA 4PBHA 2VPOA 4DI4B 4XFEA 4F1VA 2V3QA 2XXKA 3RYDA 4NQ8A 5J1DA 1AWBA 4PAFA 1NV1A 3T0JA 1FBCA 5J16A 1RDXA 4O94A 4N6KA 2OWZA 2HPGA 2HXRA 4JVDA 4NN3A 2DE4A 2FVZA 3PTYA 4GWZA 3MSTA 2HZLA 1FBGA 2FBPA 1FRPA 2ZZVA 1FPDA 4NHBA 5I7IA 5I3SA 4HE2A 4MHFA 1SPIA 3QMFA 2F5XA 3IFCA 1K9YA 2Q74A 5ET6A 5EQ7A 2HZKA 4MJOA 4PFBA 2ZZXA 4MMPA 2Q8MA 3KC0A 5F24A 4F19A 4P9KA 5JK4A 4GBVA 4PE3A 5ESYA 4GX4A 5IZ3B 2V4CA 4YZZA 4F1UA 5IZZA 4H45A 4PGPA 4MAGA 4PAKA 2KR0A 1NV5A 4GWUA 3HFUA 4O7IA 4HE1A 3EKIA 2QVRA 2R8TA 1NV7A 1NUWA 2KQZA 1DBZA 3GYYA 2FIXA 4PGNA 4PETA 1G0IA 3BIHA 2B4LA 4MNPA 1NUZA 4FBPA 1QGXA 4MX6A 2CZHA 4HCWA 4OA4A 1YZ0A 1NUXA 2PFZA 4UABA 3ISPA 1Q9DA 2QVVA 4KXPA 5ET7A 1XI6A 5ET5A 4NG7A 5LDZA 4PF8A 4XF5A 5IM2A 4N8GA 1LBXA 3A29A 2CEYA 4O8MA 4PC9A 2MKZA 3LUZA 1DCUA 1FBFA 4PFRA 4P56A 2Y5LA 5EYHA 2QPQA 4H46A 4HE0A 1FPLA 1KA0A 4QXDA 4MNIA 5T3JA 3T1BA 4AS5A 4GWYA 1LBYA 1FBPA 5A5LA 4N6DA 5I5PA 1YYZA 2DVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LEV A;  2WBB A;  3KBZ A;  5IZ3 A;  2OX3 A;  3BIG A;  2JJK A;  1KZ8 A;  2VT5 A;  5FBP A;  2FIE A;  1LBZ A;  1EYK A;  1D9Q A;  2PCR A;  4GWS A;  1NI9 A;  1IMF A;  1NV2 A;  1FBH A;  1NV6 A;  1IMD A;  1FPJ A;  1FPF A;  2DDK A;  5EYG A;  2QVU A;  3RPL A;  4I40 A;  2HHM A;  1RDY A;  1EYI A;  1IME A;  3LV0 A;  3RPL B;  1JP4 A;  5EQ9 A;  2FHY A;  4G61 A;  2P3V A;  1VDW A;  3IFA A;  2CZI A;  1IMB A;  3KC1 A;  1KA1 A;  1FPE A;  3ROJ A;  4GX3 A;  1YXI A;  4N81 A;  2WEF A;  5EQ8 A;  1CNQ A;  5EQA A;  1FJ9 A;  1BK4 A;  1FSA A;  1NV0 A;  1FPK A;  1K9Z A;  2F3B A;  4GBW A;  1FBD A;  1LBW A;  4HXV A;  1FBE A;  3FBP A;  5ET8 A;  5IZ1 A;  1IMC A;  2BJI A;  1FJ6 A;  4GWW A;  4GX6 A;  1INP A;  1DK4 A;  4GWX A;  2F3D A;  4AS4 A;  1FPG A;  2WBD A;  1IMA A;  4IR8 A;  3B8B A;  1FPI A;  1NUY A;  2GQ1 A;  1FTA A;  1LBV A;  1EYJ A;  1RDZ A;  2CZK A;  2QFL A;  3D1R A;  1G0H A;  1NV3 A;  1FPB A;  2P3N A;  4I3E A;  5DW8 A;  2Y5K A;  4I3Y A;  1NV4 A;  4PTK A;  3RYD A;  1AWB A;  1NV1 A;  3T0J A;  1FBC A;  5J16 A;  1RDX A;  2OWZ A;  2FVZ A;  4GWZ A;  1FBG A;  2FBP A;  1FRP A;  1FPD A;  5I3S A;  4HE2 A;  1SPI A;  3QMF A;  3IFC A;  1K9Y A;  2Q74 A;  5ET6 A;  5EQ7 A;  4MJO A;  2Q8M A;  3KC0 A;  5F24 A;  4GBV A;  5ESY A;  4GX4 A;  5IZ3 B;  4H45 A;  1NV5 A;  4GWU A;  4O7I A;  4HE1 A;  2QVR A;  2R8T A;  1NV7 A;  1NUW A;  1DBZ A;  2FIX A;  1G0I A;  3BIH A;  1NUZ A;  4FBP A;  1QGX A;  2CZH A;  1YZ0 A;  1NUX A;  1Q9D A;  2QVV A;  4KXP A;  5ET7 A;  1XI6 A;  5ET5 A;  5LDZ A;  1LBX A;  3A29 A;  3LUZ A;  1DCU A;  1FBF A;  2Y5L A;  5EYH A;  4H46 A;  4HE0 A;  1FPL A;  1KA0 A;  4QXD A;  5T3J A;  4AS5 A;  4GWY A;  1LBY A;  1FBP A;  5A5L A;  1YYZ A; 
#chains in the Genus database with same CATH topology
 1O63 A;  1P99 A;  4ZZA A;  4QSC A;  2D5W A;  3IOV A;  4YKP A;  4EDP A;  1NI9 A;  4YIC A;  1FPJ A;  4I40 A;  4MLV A;  3KJ7 A;  1RYX A;  1US4 A;  2QS4 A;  2FHY A;  2BJJ X;  4ELR A;  4IO3 A;  1IMB A;  1KA1 A;  1J1N A;  2WEF A;  4H5F A;  1MQJ A;  3KSJ A;  3FAT A;  4BDL A;  2F3B A;  3UA8 A;  4YAH X;  4IO7 A;  2P1S A;  3TAJ A;  1RYO A;  2DE2 A;  1IEJ A;  2VP1 A;  1WDN A;  5FHN A;  1SW1 A;  4Q0C A;  4I3E A;  5DW8 A;  2X7Q A;  1MDP 1;  1B2H A;  2OWS A;  1MM7 A;  4N6K A;  2DWJ A;  3C34 A;  1POT A;  1UTH B;  2F6P A;  4ZEF A;  2NVU B;  1BLF A;  4MAG A;  1Z7N E;  1R1N A;  2REG A;  1SYI A;  5L9S A;  1B1H A;  4LZ8 A;  4OFO A;  1MQG A;  1LAH E;  1PBP A;  3O6H A;  1YZ0 A;  1PB8 A;  5JTY A;  3FV2 A;  3IR1 A;  2PVU A;  1A8E A;  3DM0 A;  5ET5 A;  1Y3P A;  4O8M A;  3V8X B;  4PFR A;  1B46 A;  2NUV A;  3B6Q A;  2FYI A;  3OOA A;  3PUX E;  5I56 A;  1JW1 A;  4HW8 A;  3UOR A;  1XC1 A;  4G68 B;  5A5L A;  3A3U A;  4GIZ A;  4IB2 A;  1L5T A;  2VT5 A;  3FAS A;  4MLQ A;  4LQ5 A;  2R6G E;  2GHB A;  4MNC A;  3HHF A;  4JVC A;  3KFM A;  1YCJ A;  2Q88 A;  5FTH A;  1ZKB A;  4GL0 A;  2I4C A;  3VDF A;  2OK2 A;  3MP6 A;  1XHY A;  4JSO A;  3G3F A;  3F11 A;  4OET A;  5I57 A;  4OVS A;  1YXI A;  4XKN A;  1VFD A;  2AYS A;  4OZ9 A;  4FJP A;  4GXA A;  1FBE A;  3SEX A;  3SEV A;  2BJI A;  4ZE8 A;  5B7D A;  4FAJ A;  2D3I A;  2CZK A;  3D4G A;  3USD A;  2B4M A;  4IO5 A;  1D4N A;  4C1T A;  1LB8 A;  3IO4 A;  4QFN A;  5ELV A;  1DOT A;  3LSL A;  2OWZ A;  1MQH A;  2GH9 A;  3KEI A;  4ZEB A;  1AL3 A;  2G29 A;  2Q8M A;  3N5L A;  3EHT A;  4YZZ A;  1MXU A;  2XX9 A;  1SBP A;  3MBP A;  1DBZ A;  3ZSF A;  2F78 A;  4OTE A;  2DQV A;  3O97 A;  3PPR A;  1MS7 A;  5LDZ A;  3VV5 A;  2CEY A;  3JZJ A;  4TLL B;  1IXH A;  5EYH A;  4KYS A;  2AIX A;  5T3J A;  2DVZ A;  4G8N A;  5I2K B;  1Y4C A;  1LAG E;  1BIY A;  3MQ9 A;  3FVG A;  4PF6 A;  2F7A A;  2O7U A;  4PFW A;  1EYI A;  1SVX B;  5EQ9 A;  2M8C A;  2B3B A;  5H8H B;  4GX3 A;  2OWT A;  3W15 C;  5TP9 A;  1CNQ A;  3I3V A;  1H76 A;  4LAT A;  3OO8 A;  1NV0 A;  3HCQ A;  4P1E A;  4THI A;  4X8R A;  3KJT A;  4NWC A;  4QSE A;  4R9F A;  4HXV A;  3W9V A;  1P1O A;  4OHN A;  1INP A;  4O7M A;  1CB6 A;  1MXW A;  4N15 A;  3KBR A;  4EF1 A;  1FTA A;  3PD8 A;  1G0H A;  2P3N A;  4XXU A;  4OVQ A;  4AB6 A;  3FIR A;  3FJ7 A;  1II5 A;  5J1D A;  4O3C A;  1R6Z A;  2P2A A;  3RT8 A;  1DMB A;  5CMK A;  4QFO A;  1A7L A;  3GLB A;  4ELP A;  1HSE A;  4P0G A;  1JVX A;  4MJO A;  1PB9 A;  4U4S A;  3TQL A;  5JK4 A;  1URS A;  1JQF A;  4F1Y A;  2UVJ A;  3P7I A;  3QIM A;  1IUD A;  3EKI A;  2QVR A;  3ILT B;  4I9D A;  4JBZ A;  1AMF A;  1QGX A;  1P1Q A;  1WOD A;  2Y7P A;  4LZ5 A;  3ZKK A;  4KR5 A;  4WKM A;  3QK6 A;  1XI6 A;  2KLF A;  4R73 A;  3LUZ A;  2PX1 A;  3M8U A;  1Y4T A;  4BDO A;  5I58 A;  1D9Y A;  4QXD A;  1JEV A;  2H9B A;  2NOO A;  3LSW A;  2THI A;  1NNT A;  3T9U A;  3VLW A;  5IZ3 A;  2VD2 A;  1A55 A;  1ZTY A;  4KI0 E;  3B6W A;  1TXF A;  1Y1M A;  3E79 A;  3N26 A;  3UP9 A;  1WVJ A;  4HCY A;  5H8H A;  3MVY A;  1LFG A;  3AXF A;  4KCD A;  2QJE A;  1JP4 A;  5TP9 B;  2CZL A;  1MPD A;  4DLD A;  3RGY A;  3B7D A;  1TFA A;  3T93 B;  3G7W A;  2Q2C A;  3Q25 A;  1FPK A;  1B0L A;  4F2O A;  4GBW A;  3DLN A;  2XWO A;  4U2R A;  1USY E;  4MFI A;  2F6G A;  4LP2 B;  4GWW A;  4M1V A;  4L17 A;  5F7V A;  3DP4 A;  4AS4 A;  3LSF B;  1MXY A;  2A5T B;  4F22 A;  3RTW B;  3KG2 A;  4G8M A;  4GQO A;  1SI1 A;  2Q2A A;  3K6V A;  2DXR A;  4GVO A;  3MPK A;  3TTR A;  3K6X A;  3MST A;  4YU0 A;  1FPD A;  3CG3 A;  3VE1 B;  2HAU A;  4H8I A;  5HM4 B;  2XD3 A;  3C4M A;  3MVX A;  5CRY A;  4R75 A;  4EUO A;  4DDD A;  4FED A;  3VLU A;  3GYY A;  2D21 A;  3TEL A;  1MH3 A;  3OSQ A;  4F3G A;  3IOW A;  2V3T A;  3H7M A;  5HPQ A;  5DVF A;  3KOS A;  4KYD A;  4F3P A;  5AA2 D;  1B40 A;  1A40 A;  4OEU A;  4U23 A;  2Y5L A;  3CSB A;  4G8H A;  4RXL A;  4OEV A;  4NWD A;  1OQG A;  3KBZ A;  4KPT A;  4OES A;  3JV9 A;  4GWS A;  2XWV A;  3FVO A;  4NF0 A;  4NX1 A;  4Q30 B;  1UTB B;  4PBQ A;  4M4G A;  2XWI A;  1A8F A;  1ZBM A;  4EXK A;  4ELQ A;  2REJ A;  3KN8 A;  1P1N A;  2ZYK A;  2QMW A;  1Y3Q A;  2H5Y A;  5KDT B;  3QXM A;  2XX8 A;  4IR8 A;  4PFI A;  4OEN A;  4N91 A;  5JTY B;  2PT1 A;  3RYD A;  4H65 A;  4PAF A;  5EHM A;  3MP1 A;  4BDN A;  5I7I A;  1FRP A;  1XVX A;  4MHF A;  2ZNU A;  2HZK A;  2XXQ A;  4U21 A;  2V4C A;  4H45 A;  4GWU A;  1SI0 A;  3TCF A;  1SYH A;  3GBB A;  2XXU A;  3E9X A;  4YB7 A;  3UGW A;  4F39 A;  1B3F A;  3FGS A;  4MX6 A;  4OA4 A;  2F36 A;  3PPN A;  4NTL A;  1SW2 A;  2ZNT A;  4IO6 A;  4NG7 A;  4PF8 A;  4WED A;  4N8G A;  1FBF A;  3I5O A;  4H46 A;  4R6H A;  4N13 A;  4MNI A;  3C32 A;  3O9P A;  3T1B A;  1LBY A;  1B5I A;  1YYZ A;  3VXC A;  3M3F A;  4X04 A;  5A5X B;  2HAV A;  1PB7 A;  4N17 A;  3H6U A;  3VXB A;  3E3K A;  1ATG A;  4BLA A;  2FNC A;  1DSN A;  3K2D A;  3H3G A;  1EU8 A;  1UIU A;  4NF5 A;  3PUW E;  4OVT A;  3FV1 A;  2HCA A;  4X1D A;  4GRK A;  1QVS A;  5DEX B;  4P8B A;  3LV0 A;  4FEC A;  4MEV A;  1BKA A;  3RT6 B;  3TTM A;  4N6P A;  1M5C A;  1IIT A;  1R9L A;  3BKI B;  1P1U A;  4X9T A;  3OEM A;  1PEB A;  3OEN A;  4XKP A;  1IIW A;  1IMC A;  4R6Y A;  3V89 B;  2OBG A;  4PCD A;  2I0B A;  1RDZ A;  4IO2 A;  1MDQ A;  4DIG A;  1NV3 A;  4MF3 A;  1FTK A;  4DCY A;  5JEI A;  2E0S A;  1LCT A;  4EQ9 A;  4FOR A;  1NH7 A;  3IAZ A;  3M3K A;  5AE4 A;  1B3G A;  4O94 A;  4POX A;  1VSO A;  3VVE A;  2PT2 A;  5EYF A;  4KHZ E;  3TKD A;  5TPA B;  3PPQ A;  1FQB A;  2Q74 A;  1SQY A;  2Q89 A;  4XKR A;  2Z8F A;  2DXY A;  4NF6 A;  1QUL A;  3HN0 A;  2ANJ A;  5L9O A;  1OQH A;  4YB5 A;  4QF9 A;  2UXA A;  1G0I A;  4YMB A;  1BP5 A;  2GRV A;  3IL1 B;  5DT6 A;  1I69 A;  2ESN A;  3MZ9 A;  2XXI A;  3TTL A;  4ZS9 A;  5AA3 A;  1OVT A;  5A5X A;  1A99 A;  3TTK A;  4AS5 A;  3Q28 A;  5I56 B;  2ZNS A;  1EZ9 A;  3A09 A;  4OYV A;  2DWI A;  1EYK A;  1VE4 A;  3RTF B;  4I8C A;  3U94 A;  1NV6 A;  1IMD A;  2DE3 A;  2ZYM A;  5DEX A;  3OEK A;  3RPL A;  1MY1 A;  4KYE A;  3IO6 A;  3L6G A;  4ECF A;  1N84 A;  4QRZ A;  3KGC A;  1EZP A;  2CZI A;  5H8Q B;  4Q8R A;  2DYX A;  4PFU A;  4RNS A;  1QUI A;  4LON B;  2VHA A;  1MRP A;  1K9Z A;  5AA2 B;  1NNP A;  4MBP A;  4FIM A;  3H6W A;  1NH8 A;  2XXV A;  2F35 A;  4PDH A;  3U65 A;  3C36 A;  3E78 A;  5FTI A;  4R6K A;  3IB0 A;  3W9W A;  2CEX A;  4ELO A;  3U1O A;  4LA9 A;  3RLF E;  1IZ1 A;  1JW5 A;  3TOD A;  4F3S A;  2B65 A;  3RQT A;  2DE4 A;  1ZU0 A;  2HZL A;  2ZZV A;  3MZ1 A;  3WAE A;  2I6E A;  5F24 A;  4Q5T A;  4GBV A;  3PUV E;  5IZ3 B;  1B7H A;  1QKB A;  3K0V A;  2P0S A;  3IOR A;  4R74 A;  1B3E A;  3RN8 A;  2FIX A;  3SES A;  2XD2 A;  1Q9D A;  5ET7 A;  4C0R A;  1LST A;  4KCC A;  1S7Y A;  2IEE A;  2V3U A;  5H8N B;  1FPL A;  1KA0 A;  2HFB A;  2Y7K A;  4YMA A;  3OO6 A;  5I5P A;  1US5 A;  1B3H A;  1N3X A;  3T66 A;  1LBZ A;  1FTJ A;  1ANF A;  1D9Q A;  2V93 A;  1NV2 A;  5ITP A;  5I2K A;  2F7C A;  1FPF A;  3CI8 A;  2OCU A;  3IJO B;  4H67 A;  1GV8 A;  4RA1 A;  1N04 A;  3KC1 A;  3QUF A;  2DWH A;  4G68 A;  4QFL A;  1LAX A;  1HSJ A;  4P47 A;  1B9J A;  3EN3 A;  2DWA A;  4NAP A;  5ICT A;  4P1L A;  5IKB A;  3DEL B;  5HBC A;  3TCG A;  1AOV A;  5I2N A;  5IZ1 A;  1JEU A;  1T0K A;  4OVR A;  3R6U A;  2YPN A;  2VGQ A;  1IMA A;  1UQW A;  5LOM A;  3SZP A;  1KWH A;  3DP8 A;  4FEB A;  1LAF E;  2E1S A;  4EF2 A;  4G4P A;  3TDJ A;  3LR1 A;  5I57 B;  1RDX A;  1HSL A;  2HXR A;  3K00 A;  4GWZ A;  5K2X A;  4JSD A;  3BFT A;  3QMF A;  2I49 A;  5H8F A;  5EQ7 A;  4PP0 A;  1QJM A;  1I6A A;  2Y84 A;  5CMM A;  4PQJ A;  2KR0 A;  4O3B A;  1NFT A;  1ZJL A;  3VVF A;  3BIH A;  1QW0 A;  5M2V A;  4UAB A;  2HXW A;  5I59 A;  3QUJ A;  1FTM A;  4P11 A;  3C31 A;  1DPE A;  2F7B A;  3WAF A;  3MAM A;  4YKI A;  2OLB A;  3K6U A;  2WBB A;  3ZS6 A;  4OMB A;  3BIG A;  3HO7 A;  3C9H A;  5DVJ A;  1M5B A;  1I6Q A;  1GGG A;  3PUZ E;  1DTG A;  4QHQ A;  2RC7 A;  3U92 A;  1QUK A;  5BUU A;  3ODB A;  5EYG A;  2QVU A;  1IXG A;  4XEQ A;  3PMX A;  4POW A;  4U1O A;  4ZED A;  4AQ4 A;  4KD5 A;  5CM6 A;  4G2Z A;  3IFA A;  4H5G A;  4OXV A;  4RYA A;  1FPE A;  2F97 A;  2WYP A;  5I84 A;  1I6B A;  3R26 A;  2I4B A;  1MH4 A;  1N0T A;  2O1L A;  4R2B A;  3FBP A;  3HST A;  1JW4 A;  2PBW A;  3EHU A;  3S9E A;  3C33 A;  1DK4 A;  5BWJ A;  3MYU A;  1SD3 A;  4FAT A;  3PPO A;  3L6H A;  3Q26 A;  1FQE A;  1FPB A;  1AH5 A;  3OSR A;  3UIF A;  1FBC A;  5H8S A;  2HPG A;  3N94 A;  1LCF A;  2UVH A;  1FBG A;  3IK6 B;  1LGB C;  2F34 A;  4E0W A;  5CBR A;  5ESY A;  1B7Z A;  5AA4 A;  1B05 A;  5DTB A;  4OQO A;  4NED A;  3OO9 A;  5CI5 A;  4PET A;  4H8J A;  4ZEC A;  2H98 A;  4FBP A;  2AL4 A;  2CZH A;  1TFD A;  3IJX B;  2QVV A;  3K4U A;  3U72 A;  1H45 A;  4XF5 A;  1JVY A;  4OWD A;  4PC9 A;  1DCU A;  4QFP A;  4P56 A;  1CE2 A;  1FTO A;  3PMV A;  3HHG A;  1SW5 A;  3RY3 A;  3MJN A;  2WX9 A;  4PAI A;  1N7W A;  4KFQ A;  1IQ7 A;  3ILU B;  4G68 C;  2H99 A;  4I62 A;  1MQI A;  2XWK A;  3VVD A;  2XHD A;  1POY 1;  3CSG A;  3BBR A;  3OEL A;  1RDY A;  2R9J A;  1YAE A;  3G3I A;  1LBC A;  1MY4 A;  1URG A;  2RCB A;  3ROJ A;  3G3G A;  4RPO A;  2HQ0 A;  2RIN A;  3VFJ A;  2H25 A;  3S9L C;  1B4Z A;  4H6D A;  5TPA A;  4F3B A;  4UAC A;  1FBD A;  4IGT A;  5ET8 A;  3S9M C;  4MIJ A;  2DOJ A;  2HEU A;  2WYK A;  2OPD A;  1EH3 A;  1NUY A;  4RK2 A;  1LBV A;  3PD9 A;  4JWY A;  2Y5K A;  4U22 A;  4PTK A;  4NF4 B;  1FQA A;  4DI4 B;  4F1V A;  1MXX A;  3RPW A;  4NQ8 A;  3FUZ A;  1Z7M E;  1YPN A;  4NHB A;  1N76 A;  5AA4 B;  1LBB A;  1SW4 A;  2ABH A;  2DVC A;  2O7I A;  1MPC A;  1NUW A;  3S9N C;  1B3L A;  2ZYN A;  4PGN A;  3TMG A;  4MNP A;  4DZ1 A;  4HCW A;  4O3A A;  3ONM A;  2A5S A;  4RPN A;  5IM2 A;  2OPE A;  2MKZ A;  3ZKL A;  2QPQ A;  3PGF A;  4HTG A;  5B70 A;  4P0I A;  1LB9 A;  4ZDM A;  3IB1 A;  1B58 A;  4NGU A;  1FTL A;  1IMF A;  2XA5 A;  4GXS B;  2RKM A;  3T96 B;  4G77 A;  3T9V A;  1S9T A;  4YKJ A;  4P3L A;  1VDW A;  4EQ7 A;  2B3F A;  1ELJ A;  5EQ8 A;  5KCJ B;  3PPP A;  1F9B A;  4ISU A;  1UTH A;  2RF1 A;  3N6T A;  2ZZW A;  2Z23 A;  3K02 A;  2O68 A;  4RY1 A;  3CFX A;  5F1Q A;  4GWX A;  2DP8 A;  2PMS A;  1N7X A;  4I3Y A;  1NV4 A;  4JWX A;  3H4Z A;  5ISU A;  4JXI A;  2O84 X;  4NN3 A;  2XXP A;  2XXR A;  4HE2 A;  4NF8 A;  2F5X A;  2ZYO A;  5CMC A;  1BTJ A;  1FQC A;  3C35 A;  5KDT A;  1AIV A;  4PE3 A;  4GX4 A;  4OFJ A;  3GXA A;  3OD7 A;  1ZLQ A;  3U93 A;  2QS2 A;  3SDF A;  2PFZ A;  3MZB A;  3CG1 A;  4DXB A;  1O64 A;  4Z7E A;  4RK9 A;  2O6A A;  1SDX A;  2XX7 A;  1NKX A;  4HS7 A;  3FXR A;  2ZXT A;  4R72 A;  1FCK A;  4DE8 A;  2AL5 A;  4F18 A;  1Y1Z A;  4GWO A;  2JJK A;  1KZ8 A;  5I2N B;  2Q9T A;  3KN3 A;  2YLN A;  1B5H A;  1TT1 A;  3FVK A;  3CVG A;  3CFZ A;  1B6H A;  2Y7I A;  3HPI A;  3JYR A;  1IME A;  4OAN A;  3KOT A;  3RPL B;  5KCJ A;  4G61 A;  3A3C A;  2I3W A;  1LLS A;  3EQ1 A;  1FJ9 A;  5H8Q A;  4F2Q A;  2QS3 A;  4ONY A;  5H8F B;  4BDR A;  4LN5 A;  4RJZ A;  5DVI A;  4N4U A;  1IXI A;  1PBQ A;  5AA2 A;  3KZG A;  3FZV A;  4C1U A;  3MVZ A;  3K6W A;  2ONK E;  1MY3 A;  2Z22 A;  1D9V A;  3CR9 A;  4IO4 A;  4EXL A;  3M3L A;  4WXJ A;  1XVY A;  4IY6 A;  3QAX A;  4XTC Q;  1K9Y A;  2QS1 A;  3CFL A;  1JNF A;  4IGR A;  4PAK A;  1NV5 A;  4K3F A;  4O7I A;  2DSF A;  2B4L A;  4GL8 A;  1NNK A;  3O2A A;  4PFT A;  3G3J A;  4ZEK A;  5L9M A;  2VD3 A;  4OFL A;  1PC3 A;  3GZG A;  3NOH A;  4JVI A;  4LVQ A;  3B50 A;  3CHG A;  4DXU A;  4NF6 B;  5FBP A;  2XXW A;  2Z8D A;  3O66 A;  3D4C A;  1P1W A;  1MY0 A;  2UVG A;  1B5J A;  1A54 A;  2HHM A;  3MP8 A;  4H0W A;  3MC2 A;  2XXY A;  2Y7W A;  1OVB A;  3O6G A;  4MCO A;  5CC2 A;  3PUY E;  1NMU A;  4PDD A;  5EQA A;  3Q29 A;  1BK4 A;  4GF8 A;  1B32 A;  5CMB A;  3FXQ A;  4NMY A;  1OLA A;  2FA7 A;  2O1M A;  1VFE A;  2V84 A;  3DP6 A;  2WBD A;  3FD3 A;  4R2F A;  1B1X A;  2GQ1 A;  4JB7 A;  3O29 A;  4OER A;  3MVW A;  3U8Q A;  1D3K A;  2QL3 A;  1M5F A;  2OJT A;  4F31 B;  2VOZ A;  5FHO A;  2FBP A;  2G93 A;  3RNN A;  4F1U A;  2ZZX A;  4F19 A;  3EF7 A;  3IOT A;  3HFU A;  4Z0I A;  2V25 A;  2X26 A;  4H1X A;  1ZIU A;  4U4X A;  3E4R A;  3S4U A;  1B7U A;  4MH5 A;  3LC8 A;  3UN6 A;  1YTV A;  2IA4 A;  4I1D A;  3V5A A;  1B52 A;  2X7P A;  1FQD A;  3ISP A;  4TQU Q;  4XIG Q;  1NNF A;  3CRB A;  4ZZE A;  1QUJ A;  1FQF A;  3H03 A;  1VR5 A;  4HE0 A;  1B51 A;  5K2Y A;  4N6D A;  3FVN A;  4DI3 D;  5ITO A;  2CMO A;  1M5D A;  2W7Y A;  3IX1 A;  1XOC A;  2QSX A;  2Q8J A;  1DTZ A;  2DDK A;  3PU5 A;  2VPN A;  2DS9 A;  4NF4 A;  1N3W A;  1M5E A;  1MG1 A;  3SKP A;  5H8N A;  2XXH A;  4QSD A;  1FSA A;  1MXV A;  4U1Z A;  1LBW A;  2WKY A;  4R9G A;  1RKM A;  3K1M A;  4X48 A;  3S2V A;  5ICQ A;  4TLM B;  4TOZ A;  3EHS A;  1XT8 A;  4PBH A;  4PE5 B;  4XFE A;  1Q35 A;  3T0J A;  3TZA A;  5J16 A;  2NWJ A;  3PV0 E;  5IAI A;  3FJM A;  2RCA A;  4JVD A;  2FVZ A;  1S50 A;  2RC9 A;  3OXN A;  3CIJ A;  5ET6 A;  3T22 A;  4YB6 A;  3KC0 A;  4LZ7 A;  1NL5 A;  3K1N A;  1QKA A;  5IZZ A;  4PGP A;  2RC8 A;  4DXC A;  2ZMB A;  1OMP A;  3MW0 A;  4HE1 A;  4ESW A;  3OMB A;  4EQB A;  1MM6 A;  5L8D A;  3QYT A;  1NUX A;  1UTB A;  1JET A;  2H4I A;  4KXP A;  4N07 A;  5I58 B;  3T9X B;  5KZT A;  3E13 X;  4ZE9 A;  4JDF A;  3SET A;  1USY H;  3MPL A;  3VLV A;  2R71 A;  4GWY A;  1FBP A;  2I3V A;  1LEV A;  3TYH A;  2FIE A;  4BDM A;  2YJP A;  3H6T A;  3PMW A;  1OIB A;  3SEW A;  3TTN A;  1GTK A;  2O69 A;  3THI A;  1LFH A;  3TUS A;  5I59 B;  4N8Y A;  1MQD A;  4QFK A;  2P3V A;  4GFR A;  3EPE A;  4N81 A;  1B0H A;  2PFY A;  3FJG A;  5CBS A;  1MY2 A;  3SER A;  4QBA A;  3KSX A;  2I58 A;  2L5V A;  5LTC A;  3KN7 A;  2UVI A;  2OZZ A;  1FJ6 A;  2PYY A;  1O7T A;  2F3D A;  2GFE A;  1H44 A;  2UYE A;  2QFL A;  3D1R A;  1ZMG A;  3SEY A;  4OVP A;  3H6V A;  3BFU A;  3OO7 A;  1GVC A;  2VPO A;  2XXK A;  1AWB A;  1NV1 A;  4GD5 A;  5DYH A;  5TU0 A;  3RUM A;  3PTY A;  1PDA A;  3T9H B;  5I3S A;  3IFC A;  1LFI A;  4MMP A;  4FE8 A;  2O51 A;  2XXT A;  4YKK A;  2ONR A;  2R8T A;  5EHS A;  3LBS A;  4OVJ A;  3TCH A;  3FXU A;  4NF5 B;  4DCX A;  1OLC A;  1LBX A;  3A29 A;  1Y20 A;  3G3K A;  4IY5 A;  3SEU A;  2Z8E A;  1TWY A;  4ND9 A;  2Y7R A;  3Q27 A;  4E0X A;  3LUY A;  3TPA A;  3IOU A;  2OX3 A;  1XS5 A;  3O6I A;  1H3D A;  4XKQ A;  2I48 A;  3FXB A;  2PCR A;  2NXO A;  1FBH A;  3G3H A;  3UK4 A;  3MWB A;  4AB5 A;  3TFL A;  2UYF A;  1FW0 A;  2F8D A;  3LSX A;  3V83 A;  1GR2 A;  3GBA A;  1H43 A;  3O28 A;  5IGA A;  1IXC A;  4KQP A;  2LAO A;  3K1P A;  3N6U A;  4WEP A;  1URD A;  4GX6 A;  4F29 A;  1DPP A;  2I0C A;  4LUB A;  1FPG A;  1EZO A;  4NE4 A;  3B8B A;  4PFY A;  5AA1 A;  1FPI A;  1B4H A;  1EYJ A;  3R7X A;  4ESX A;  2XXX A;  4GLI A;  3IB2 A;  3TQW A;  4UA8 A;  2V3Q A;  1Q1K A;  3MUQ A;  2QRY A;  4BDQ A;  4X1B A;  1SPI A;  4PFB A;  4P9K A;  2QMX A;  1Y9U A;  3QSL A;  1R9Q A;  4NF8 B;  4LQ2 A;  3B6T A;  3I6V A;  1NV7 A;  3HV1 A;  2KQZ A;  4JWO A;  2A5T A;  3K01 A;  1UIV A;  2ONS A;  1NUZ A;  2GHA A;  1MXZ A;  4GOT A;  3TEP A;  1Y3N A;  5FHM A;  3H06 B;  1MPB A;  3ECR A;  2ALU A;  4ZEI A; 
#chains in the Genus database with same CATH homology
 4X04 A;  1LEV A;  2WBB A;  3NOH A;  3KBZ A;  5IZ3 A;  4JVI A;  3B50 A;  4F18 A;  3CHG A;  4DI3 D;  2OX3 A;  2WX9 A;  3BIG A;  2JJK A;  1KZ8 A;  2VT5 A;  5FBP A;  4N17 A;  2Q9T A;  4PAI A;  2FIE A;  1LBZ A;  1EYK A;  4NGU A;  1D9Q A;  3FXB A;  2PCR A;  4GWS A;  2XWV A;  1NI9 A;  4MNC A;  4YIC A;  1IMF A;  2XA5 A;  1NV2 A;  4JVC A;  4PF6 A;  1FBH A;  3E79 A;  1NV6 A;  4NF0 A;  2XWK A;  1IMD A;  1FPJ A;  2DE3 A;  4NX1 A;  4OVT A;  1FPF A;  2DDK A;  5EYG A;  2QVU A;  3RPL A;  4I40 A;  2VPN A;  2HHM A;  4XEQ A;  4HCY A;  4PBQ A;  4P3L A;  1RDY A;  1EYI A;  4N8Y A;  1IME A;  4OAN A;  3LV0 A;  3RPL B;  1JP4 A;  2XWI A;  4MCO A;  4P8B A;  5EQ9 A;  2FHY A;  4G61 A;  2P3V A;  5CM6 A;  1VDW A;  3IFA A;  2CZI A;  4MEV A;  1IMB A;  3KC1 A;  1KA1 A;  1FPE A;  3ROJ A;  4GX3 A;  4OVS A;  1YXI A;  2WYP A;  4N81 A;  2PFY A;  2WEF A;  5EQ8 A;  1CNQ A;  4PDD A;  5EQA A;  4QBA A;  1FJ9 A;  1BK4 A;  1FSA A;  1NV0 A;  5IGA A;  1FPK A;  4X9T A;  4P1E A;  2L5V A;  4P47 A;  4NAP A;  1K9Z A;  2F3B A;  4X8R A;  4GBW A;  1FBD A;  4P1L A;  5LTC A;  1LBW A;  2XWO A;  4HXV A;  3W9V A;  1FBE A;  3FBP A;  4LN5 A;  5ET8 A;  5IZ1 A;  1IMC A;  2ZZW A;  3U65 A;  2BJI A;  4MIJ A;  1FJ6 A;  4GWW A;  4M1V A;  4GX6 A;  4OVR A;  1INP A;  4N4U A;  1DK4 A;  2DE2 A;  4GWX A;  2F3D A;  2WYK A;  4AS4 A;  1FPG A;  2WBD A;  1IMA A;  3MYU A;  4IR8 A;  4N15 A;  4O7M A;  4PCD A;  4PDH A;  4PFI A;  3B8B A;  3E78 A;  1FPI A;  1NUY A;  2GQ1 A;  1FTA A;  1LBV A;  1EYJ A;  1RDZ A;  2CZK A;  2QFL A;  3D1R A;  3SZP A;  1G0H A;  2B4M A;  1NV3 A;  1FPB A;  2P3N A;  4I3E A;  5DW8 A;  4OVP A;  2Y5K A;  4N91 A;  3W9W A;  4OVQ A;  4I3Y A;  1NV4 A;  4PTK A;  2CEX A;  4PBH A;  2VPO A;  4DI4 B;  4XFE A;  4F1V A;  2V3Q A;  2XXK A;  3RYD A;  4NQ8 A;  5J1D A;  1AWB A;  4PAF A;  1NV1 A;  3T0J A;  1FBC A;  5J16 A;  1RDX A;  4O94 A;  4N6K A;  2OWZ A;  2HPG A;  2HXR A;  4JVD A;  4NN3 A;  2DE4 A;  2FVZ A;  3PTY A;  4GWZ A;  3MST A;  2HZL A;  1FBG A;  2FBP A;  1FRP A;  2ZZV A;  1FPD A;  4NHB A;  5I7I A;  5I3S A;  4HE2 A;  4MHF A;  1SPI A;  3QMF A;  2F5X A;  3IFC A;  1K9Y A;  2Q74 A;  5ET6 A;  5EQ7 A;  2HZK A;  4MJO A;  4PFB A;  2ZZX A;  4MMP A;  2Q8M A;  3KC0 A;  5F24 A;  4F19 A;  4P9K A;  5JK4 A;  4GBV A;  4PE3 A;  5ESY A;  4GX4 A;  5IZ3 B;  2V4C A;  4YZZ A;  4F1U A;  5IZZ A;  4H45 A;  4PGP A;  4MAG A;  4PAK A;  2KR0 A;  1NV5 A;  4GWU A;  3HFU A;  4O7I A;  4HE1 A;  3EKI A;  2QVR A;  2R8T A;  1NV7 A;  1NUW A;  2KQZ A;  1DBZ A;  3GYY A;  2FIX A;  4PGN A;  4PET A;  1G0I A;  3BIH A;  2B4L A;  4MNP A;  1NUZ A;  4FBP A;  1QGX A;  4MX6 A;  2CZH A;  4HCW A;  4OA4 A;  1YZ0 A;  1NUX A;  2PFZ A;  4UAB A;  3ISP A;  1Q9D A;  2QVV A;  4KXP A;  5ET7 A;  1XI6 A;  5ET5 A;  4NG7 A;  5LDZ A;  4PF8 A;  4XF5 A;  5IM2 A;  4N8G A;  1LBX A;  3A29 A;  2CEY A;  4O8M A;  4PC9 A;  2MKZ A;  3LUZ A;  1DCU A;  1FBF A;  4PFR A;  4P56 A;  2Y5L A;  5EYH A;  2QPQ A;  4H46 A;  4HE0 A;  1FPL A;  1KA0 A;  4QXD A;  4MNI A;  5T3J A;  3T1B A;  4AS5 A;  4GWY A;  1LBY A;  1FBP A;  5A5L A;  4N6D A;  5I5P A;  1YYZ A;  2DVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...