5I3SA

Crystal structure of staphylococcal impase-ii
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
272
structure length
262
Chain Sequence
MALYGFAQGLIQEAGIRIKQLMEQNLNDLVTNVDKATEDFIFDTILETYPNHQVLGEEGHDIDTSKGTVWVVDPIDGTLNFVHQQENFAISIGIYIDGKPYAGFVYDVMADVLYHAKVGEGAYRGSQPLKPLNDSNLRQSIIGINPNWLTKPILGEIFKEIVNDSRSARAYGSAALEIVSVATGNLEAYMTPRLQPWDFAGGLVILYEVNGQASNLLGEPLTISGPNSILVGNRGLHQEISNDYLEPHHDALIQLHEQRFKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal IMPase-II
rcsb
source organism Staphylococcus aureus (strain mssa476)
molecule tags Hydrolase
molecule keywords Inositol monophosphatase family protein
total genus 80
structure length 262
sequence length 272
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5i3sA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5i3sA02
1NUZA 2VT5A 1EYIA 1LBVA 5FBPA 1FBGA 4HXVA 1RDXA 2F3DA 1NV1A 1IMCA 3KBZA 3A29A 3B8BA 1FPDA 1FTAA 3LUZA 1VDWA 4I40A 1FRPA 1NV7A 5IZ1A 1FPBA 2GQ1A 2QFLA 1FBEA 4GX3A 2P3VA 5F24A 1AWBA 5I3SA 4AS5A 1NUXA 2WBBA 1G0HA 1LBWA 1NUWA 5ESYA 4I3EA 1JP4A 3BIHA 1FBHA 1FPLA 4QXDA 1FJ9A 2CZHA 1FPEA 1FSAA 1SPIA 2BJIA 4IR8A 4HE2A 5EQ8A 5EYHA 1FPKA 1Q9DA 5IZ3A 5IZ3B 4GBWA 1BK4A 2F3BA 2FIEA 5EQAA 1NV4A 4AS4A 2OX3A 2FHYA 4KXPA 5T3JA 5EQ9A 1NV6A 1QGXA 2QVUA 2Q74A 3RYDA 1G0IA 1KZ8A 1INPA 2CZIA 4GWYA 1FJ6A 5DW8A 4GX6A 1K9ZA 1DBZA 5ET5A 4GWUA 3FBPA 1FBCA 1FBFA 1FPJA 1NI9A 1YXIA 2WBDA 4G61A 4GWWA 3T0JA 1YZ0A 5ET7A 5A5LA 4H46A 1CNQA 2QVRA 1NV3A 1RDYA 1IMFA 3LV0A 3IFCA 4FBPA 1LBZA 2WEFA 1XI6A 1DK4A 1EYKA 2HHMA 1YYZA 2DDKA 4HE1A 5ET8A 1K9YA 1EYJA 4HE0A 4GX4A 3QMFA 2FBPA 1IMAA 1KA0A 3KC0A 3BIGA 3D1RA 2JJKA 2P3NA 3KC1A 4N81A 5EYGA 1FPFA 5J16A 1NV5A 2PCRA 1LEVA 4GBVA 4GWZA 4O7IA 1D9QA 4H45A 2CZKA 4PTKA 1NV2A 4MJOA 2OWZA 3ROJA 1LBYA 3RPLA 1FBPA 1FPGA 4GWSA 1DCUA 2FVZA 1FBDA 1NV0A 5EQ7A 5ET6A 1IMEA 2FIXA 2Y5KA 2Q8MA 3RPLB 2Y5LA 1KA1A 3IFAA 4I3YA 1FPIA 1IMDA 2QVVA 1NUYA 1RDZA 5LDZA 1IMBA 1LBXA 4GWXA 2R8TA
chains in the Genus database with same CATH superfamily
1EYIA 4NGUA 1PB7A 4YKKA 4PETA 2F36A 3A29A 2QS2A 4I1DA 4OHNA 4PAKA 2XXYA 2DE3A 3SEUA 4KCCA 4JVCA 3OSQA 3UP9A 3CIJA 3KN3A 2F78A 2OZZA 3Q28A 1LCTA 2I3WA 1Y3PA 4LP2B 4IR8A 2BJIA 3V5AA 5IZ3B 1YAEA 1ANFA 3PMVA 3OD7A 3EKIA 3T93B 4BDMA 1EU8A 5HPQA 2OK2A 2CEXA 5AA2D 3OSRA 3W9VA 3KOSA 3K2DA 5DW8A 1MQDA 2B3FA 4GOTA 4N17A 5B70A 1A40A 2I49A 2YLNA 3H4ZA 4QHQA 3QIMA 1IMFA 3K02A 2O7UA 3VFJA 1QUKA 3JZJA 4HE1A 5F1QA 3Q25A 2V25A 1N7XA 2QJEA 3D4GA 1GV8A 3LSLA 1A54A 2FBPA 3IOUA 4FE8A 3S9MC 4N81A 4Q0CA 2O51A 4JDFA 4QSDA 3B7DA 2NOOA 2V3TA 1BLFA 4MJOA 1XHYA 4OVRA 2VPOA 2ZYMA 4GWSA 2FVZA 1I6BA 5K2XA 5EQ7A 1MY0A 4OFLA 3PUXE 3A3CA 1JEUA 4JWXA 4X1DA 4N8YA 5H8SA 2DS9A 4THIA 3B8BA 3HCQA 2I0CA 5CMBA 4GVOA 1WVJA 1FBEA 3MZ9A 3ILUB 3TTKA 3IOTA 4MH5A 3OO6A 4P9KA 3ODBA 3KZGA 1MY4A 5L9MA 2CZHA 1MDP1 2D5WA 3JV9A 4GBWA 5TU0A 4BDOA 2FIEA 3TCGA 1J1NA 3MZ1A 1D9YA 1MH3A 5AA1A 1URDA 1FTKA 1LLSA 1LB9A 3SETA 4QF9A 1EZOA 4XFEA 3MJNA 5ET5A 1DPEA 1P1UA 1MY2A 2DOJA 3FBPA 3B6TA 2AL5A 2QVRA 2HHMA 3C34A 1VR5A 1UQWA 1R9QA 1VE4A 4P8BA 3A09A 1UIUA 3U65A 3KC0A 1MXZA 4F3BA 3TQWA 4L17A 4M1VA 1LAXA 4ZEDA 3QXMA 1MDQA 3H6VA 1BKAA 4GBVA 1POTA 3S9EA 3I5OA 3HO7A 4P1EA 5ITPA 2MKZA 4KYEA 3PPNA 4H6DA 5I7IA 3FD3A 1B1XA 1R6ZA 4GFRA 1IMEA 3IR1A 4R6YA 2Q2CA 2HAVA 2IA4A 2VD3A 1DPPA 4PFBA 2I3VA 1MXWA 1P1NA 4WXJA 4P0GA 3LSWA 5FBPA 1LBVA 3VVFA 2DQVA 1GGGA 1PB8A 3PV0E 5AA3A 4GWOA 4MNIA 1B52A 1M5DA 3VE1B 3E4RA 4H1XA 4OFOA 1H44A 2YPNA 3K6VA 2REGA 5F24A 5TP9A 3IO6A 5H8FB 2O6AA 5I3SA 4AS5A 3VDFA 1LAFE 2Q88A 4O3BA 2E0SA 4DCXA 2CMOA 1FSAA 3SEXA 5EQ8A 1R9LA 4FAJA 1MQJA 3IAZA 5H8HB 4F39A 5EQAA 4EUOA 4EF2A 2F6PA 3FUZA 1MY1A 5J1DA 3EPEA 1IXIA 4ESXA 4FECA 1LFHA 1MQGA 3FASA 1NI9A 5I2NA 1B7ZA 4JB7A 4RK9A 4QFNA 3QUJA 2CEYA 1XI6A 2KLFA 3C36A 3VVEA 3AXFA 4F18A 4QFKA 2I48A 3T96B 3D1RA 4F1UA 3FXRA 1ZTYA 3L6GA 4F1VA 4MNPA 2OJTA 1Z7ME 5H8NB 4OMBA 3TEPA 3UIFA 1I6AA 2QSXA 3ZS6A 4JXIA 2XD2A 1PBQA 3CI8A 4ONYA 1B2HA 3JYRA 2F7BA 3MVWA 5I2KA 3LUYA 3OXNA 4AQ4A 3RT8A 3K4UA 4ZEKA 2V3UA 5CMKA 1OLCA 2F8DA 4G8HA 3T22A 4GX3A 4H5GA 5I2KB 3IB0A 4OA4A 3N26A 3VXCA 4N6PA 5ICTA 4R6KA 3PPRA 4BDNA 3UGWA 1B1HA 1FPKA 2XXUA 4ELRA 2O84X 4PDHA 4EDPA 1FTJA 2Z8EA 4R72A 2HAUA 3RQTA 4UACA 1JVXA 1INPA 3DELB 3MP8A 3GZGA 1FW0A 3QK6A 4JWOA 2XX8A 4QFLA 1YTVA 4I9DA 2ZZWA 2NXOA 4U1ZA 4PF8A 3C9HA 4KYSA 1ZJLA 2IEEA 2FYIA 3MSTA 3TCHA 4Z7EA 3NOHA 2UVJA 3KC1A 3KN8A 2PT1A 3O66A 4POXA 1DOTA 2VD2A 4UABA 1JW4A 1N7WA 2AIXA 3SEVA 1NV2A 3ROJA 1LBYA 2QMXA 1XC1A 3T9HB 3FVOA 3HFUA 2OPEA 4FEBA 1FQBA 4OESA 1PDAA 1QJMA 4R6HA 3PUWE 3ONMA 3G3HA 1LBXA 2RC8A 1PBPA 4LA9A 4F29A 3G3KA 5I58A 1WDNA 4OENA 4OZ9A 5HM4B 1LAGE 4R2BA 4O7MA 1OVTA 2NVUB 5H8QA 1B5IA 4OVJA 4ZDMA 1B3FA 2F5XA 3MC2A 4KHZE 3CG3A 4AB5A 1TT1A 3RTWB 3K6XA 3V83A 1YPNA 1NFTA 5I56B 1B3EA 3FJGA 4TLMB 3N5LA 5I57A 3U1OA 1JP4A 2THIA 4PC9A 3PUYE 5H8QB 3MZBA 3TTRA 1Q9DA 2AL4A 2VHAA 5CM6A 4G8MA 4HW8A 5T3JA 3G3IA 4PCDA 4ECFA 1TFAA 4GWYA 1MQHA 3OO8A 1FTMA 2R9JA 3OELA 4E0XA 3QSLA 5FTHA 1ZMGA 4PAFA 3W15C 4JVIA 2WEFA 2YJPA 3BFTA 2DDKA 3O6IA 1B9JA 2RC7A 1OVBA 4QFPA 1IITA 3SDFA 2NWJA 4PFWA 4OYVA 5TPAB 3K0VA 1CB6A 3I3VA 1XS5A 4GF8A 5L9SA 3IK6B 5CC2A 3KG2A 4PFIA 4DCYA 4MCOA 2FIXA 4HCYA 3K1PA 2KQZA 4GLIA 1N3WA 2VT5A 1WODA 2PBWA 4MBPA 3T9VA 5CMCA 4E0WA 3PUVE 1H45A 1FPBA 3LC8A 4XIGQ 1MPDA 5H8NA 1B0HA 3KN7A 4PP0A 4ZE8A 3Q27A 5DEXB 4ZECA 4X8RA 2H99A 3T1BA 1FBHA 4QXDA 1O63A 2PT2A 5I59B 1O7TA 1NNFA 2B65A 5EYHA 3E78A 1Y9UA 3TPAA 2V4CA 1GR2A 1ELJA 2H5YA 4OVSA 4DI3D 4YKIA 1M5CA 1URGA 3VVDA 1B0LA 2ZNUA 4N91A 2V84A 4EQ7A 1K9ZA 1Y1MA 4QBAA 3N94A 2Y7IA 1NH7A 3SEWA 3LV0A 4OXVA 5KCJB 3PUZE 3O9PA 3DLNA 5BWJA 3W9WA 1SDXA 3FV2A 4NG7A 3BIGA 1B3GA 4PF6A 2RCAA 4ZEIA 5AA2B 4ZE9A 4RJZA 5KDTA 4LQ5A 4OVQA 2V3QA 1B7UA 4H67A 2QL3A 1FBDA 2PMSA 2Y7PA 1QUJA 3UORA 5DVIA 4PGPA 2F6GA 4OEUA 1LB8A 4P3LA 3EQ1A 2A5TA 4UA8A 4MHFA 4NWDA 4DLDA 1CE2A 2R8TA 4NF6A 5KDTB 4HXVA 4IY6A 4DI4B 1B4HA 3HV1A 4DZ1A 4KD5A 1Y4CA 1MXXA 4RA1A 5IZ1A 5KZTA 1FQAA 2R6GE 2P3VA 4HCWA 5CI5A 4YB6A 1AWBA 4GQOA 5ESYA 4JBZA 2V93A 1FPEA 4OEVA 4FJPA 3RN8A 3O29A 1VFEA 3IJXB 4MFIA 3G7WA 2Q74A 3V8XB 2Q8JA 2W7YA 4XXUA 4GIZA 4R2FA 4NQ8A 5I2NB 1YCJA 1N84A 1DMBA 4GWWA 2XX7A 4H46A 1SVXB 4YMBA 1OQGA 4MAGA 1SW2A 4ZEFA 1JNFA 1SQYA 4O8MA 5B7DA 1R1NA 1NNPA 1FPFA 1QW0A 4N4UA 3U94A 5I84A 1LEVA 5DT6A 5AE4A 2WKYA 2QMWA 2PFYA 4KFQA 1OIBA 1BTJA 1IEJA 3T9XB 2DWAA 2WYKA 4ELPA 4LZ8A 2Q8MA 2O1LA 2QVVA 4NAPA 3H06B 2UXAA 4C1TA 4X1BA 4N15A 3ZKLA 2D3IA 1B3HA 1NNKA 2Q89A 5FHMA 4GL0A 1URSA 5K2YA 3EHSA 4R73A 4KQPA 3UN6A 4LZ5A 4XKQA 1NUWA 3OEKA 3QAXA 1AIVA 4G77A 1LCFA 4NF5B 4JSDA 2REJA 1MS7A 3EHUA 3RPWA 1PEBA 3C31A 4AS4A 1F9BA 4KXPA 3IJOB 1NV6A 4HS7A 1KZ8A 4JSOA 3K6WA 1ZKBA 4H65A 1EH3A 3BFUA 4XEQA 2ZYOA 4Z0IA 3PMWA 4I8CA 1AL3A 5I59A 2ALUA 4X04A 3O97A 5FTIA 3FJ7A 3FATA 2G93A 3HPIA 4KCDA 1LBCA 4ZEBA 5IM2A 1SBPA 5IGAA 3TZAA 4DIGA 2HZKA 4G4PA 1AH5A 4YB7A 3S2VA 1O64A 1IXHA 5DVFA 4QFOA 1Y3QA 4PE3A 3D4CA 3IB1A 4OANA 1FTLA 3KSXA 4NE4A 1KA1A 4RK2A 2ZZXA 1IMDA 2H25A 3PGFA 3R6UA 4NTLA 3FJMA 4U1OA 5AA2A 2OPDA 4RXLA 1QUIA 4F2QA 3KBZA 3I6VA 3H6TA 2OWTA 5L8DA 1SYHA 2Q9TA 3IORA 3MYUA 3KJ7A 4MX6A 1KWHA 3HSTA 1HSJA 5I56A 4BLAA 2A5TB 4RPNA 1ATGA 1D3KA 3FVNA 4N8GA 2ABHA 4LATA 4HE2A 3FXUA 3HHGA 2F3BA 3UK4A 1SI0A 1MM6A 4EXKA 4EQBA 1NH8A 1FQDA 3GXAA 1G0IA 1D4NA 4FEDA 1S7YA 1N76A 1FPJA 2Q2AA 1HSLA 3R7XA 1LSTA 4F1YA 1DK4A 3MVXA 1VFDA 4F22A 5CRYA 4N07A 4LZ7A 4MLVA 2OLBA 1GTKA 2PCRA 5LTCA 3A3UA 1ZBMA 4O7IA 2Z23A 2PX1A 5L9OA 4KR5A 1GVCA 4PTKA 4NWCA 5AA4A 2H4IA 1FBPA 4C0RA 5DTBA 2ZNSA 2GHAA 4MLQA 3LSXA 1BIYA 5IZZA 1FPIA 1TFDA 1JETA 1P99A 4OVTA 2HZLA 1NUZA 4IY5A 1I6QA 5I58B 1RDXA 2DYXA 1TWYA 1NV1A 1FPDA 1A55A 1FRPA 5A5XB 3U72A 4DXBA 1HSEA 2HXRA 1M5EA 3FXBA 3K1NA 4TLLB 3IX1A 3H6UA 4FIMA 4G68B 5EYFA 3ISPA 4TQUQ 1FJ9A 1MXYA 3MUQA 4NF4A 4QRZA 4FORA 1BP5A 2XXTA 1II5A 2HXWA 3RGYA 1MXUA 1P1OA 1QGXA 1Y1ZA 2ZYKA 2DXRA 2CZIA 3THIA 2O69A 4GX6A 1DBZA 4MNCA 1SW4A 1MXVA 3H3GA 3FZVA 5ELVA 4LQ2A 2PYYA 4NF5A 5ET7A 1RDYA 4PBHA 5M2VA 3MWBA 2B4LA 3E79A 4ELOA 5TP9B 2P2AA 1B5JA 5TPAA 5LOMA 2NUVA 2ONSA 2P0SA 1DTZA 1NV5A 3FXQA 3HHFA 3TYHA 2B3BA 4XKPA 1FQEA 4Q5TA 3C32A 1FPGA 1XOCA 3RPLB 1IZ1A 4N13A 3FGSA 4IO6A 3DP8A 1B58A 4NEDA 1RKMA 5ICQA 1B40A 4MEVA 2I4BA 4BDLA 1UTBA 4EXLA 1FBGA 4N6DA 4JVDA 4KPTA 1USYH 1FTAA 1NKXA 1MPBA 4ISUA 2DWHA 3PPOA 2XWIA 1MH4A 1XVXA 2GQ1A 1B7HA 3DP4A 1UIVA 1B6HA 3MBPA 4PBQA 4U22A 3TODA 1TXFA 2ZXTA 1D9VA 1MPCA 2QS4A 4YKJA 4G8NA 3FV1A 5FHOA 1LGBC 1FQFA 3OO7A 1SPIA 4U4SA 3H03A 1BK4A 1XT8A 4NHBA 2OX3A 2FHYA 1QULA 2VP1A 3IO4A 4O3AA 1SW1A 2D21A 4QSCA 2XXWA 4RY1A 2F7CA 3GBBA 4OVPA 1EYKA 4LN5A 2FA7A 4RPOA 5I57B 2KR0A 1IMAA 3TQLA 1M5BA 4AB6A 4PQJA 3ILTB 4P47A 4OTEA 4R9FA 3PTYA 3DM0A 2F7AA 2F97A 3SEYA 1B5HA 5H8FA 2CZKA 2DVCA 4NF6B 2OCUA 4H5FA 4OERA 1MM7A 3KSJA 4XKNA 4YZZA 3VLVA 3TDJA 2HPGA 1B51A 2Y5KA 3H6WA 2Y5LA 2XA5A 3CFXA 2DE2A 3CSGA 5JTYA 1AMFA 4NF8B 3OMBA 3KJTA 2F3DA 1IMCA 5ITOA 4I40A 4H0WA 4P1LA 2XXIA 2O1MA 3WAEA 2BJJX 2DSFA 4BDRA 1T0KA 4QSEA 4F2OA 2XXVA 4NF8A 1NUXA 4O3CA 5IKBA 3Q26A 1FPLA 3EN3A 3K01A 5IZ3A 2UVGA 1M5FA 3MQ9A 3M3KA 2ESNA 2QVUA 2P1SA 2WX9A 3O6HA 2Z22A 1AOVA 3CG1A 3R26A 4X48A 2H98A 1S9TA 5JK4A 5BUUA 1YXIA 4G61A 4NMYA 3VXBA 3MP1A 4OETA 3IFCA 1YYZA 3MAMA 1SYIA 2XWKA 2XXKA 4MF3A 1EZPA 2ANJA 2XWVA 1A8FA 1ZIUA 3LR1A 3MP6A 4MMPA 1Y20A 2VOZA 2JJKA 2ZYNA 1S50A 4F3SA 3G3FA 3FVGA 4IO2A 1LAHE 1JEVA 4U2RA 2Z8DA 1Q1KA 3HN0A 4MIJA 2A5SA 2GFEA 1US5A 3IL1B 2XXRA 2X7PA 4OFJA 3IFAA 5CBRA 2XXHA 1VSOA 1B32A 2GHBA 1MY3A 2DP8A 1SI1A 3LUZA 1POY1 1USYE 2GRVA 2HQ0A 3U93A 2XXXA 4G2ZA 1FTOA 4DXUA 3E13X 4LUBA 2ZNTA 4POWA 4JWYA 2XD3A 2WBBA 3RUMA 2L5VA 3P7IA 3BIHA 4Q8RA 3C33A 3RY3A 2B4MA 2PFZA 2X26A 1UTBB 3TTNA 2ZZVA 3B6WA 2DE4A 3MPKA 2UVHA 1N0TA 1FJ6A 3M3FA 2HEUA 3RT6B 1NNTA 3OOAA 2FNCA 1DSNA 2QS1A 3PMXA 3IB2A 4PFTA 4FBPA 1SD3A 2OWSA 1N3XA 4KYDA 3OENA 3K1MA 2UYFA 3M8UA 4GX4A 1B46A 1B3LA 3VLWA 2E1SA 3SKPA 2GH9A 4F31B 2P3NA 5EYGA 5J16A 4GXSB 4P11A 4XTCQ 2PVUA 1FQCA 3SZPA 2QRYA 5EHSA 2M8CA 3CHGA 3O6GA 1DCUA 4NN3A 2VPNA 5DYHA 4YKPA 1FCKA 1MRPA 4PAIA 1L5TA 4IO4A 1NMUA 4P56A 1IMBA 3MVZA 5ISUA 2AYSA 4P0IA 3F11A 3TAJA 5IAIA 3KGCA 2Y84A 2DWJA 5A5XA 3EHTA 3GBAA 4ESWA 1XVYA 2HFBA 2Y7KA 4ZZAA 4LONB 2WYPA 4PFRA 3UA8A 4PE5B 1PC3A 2ONKE 3GLBA 1MG1A 3CRBA 4EF1A 3CR9A 5JEIA 4NF4B 1G0HA 5F7VA 1A7LA 1OQHA 2VGQA 1JW5A 3TELA 3EF7A 3KFMA 3RTFB 2I58A 3TTMA 3BKIB 4Q30B 5EQ9A 1A99A 1IXGA 5HBCA 3B6QA 2I6EA 2Y7WA 3PU5A 4RNSA 4LVQA 3DP6A 1DTGA 4PGNA 2XHDA 4C1UA 4OQOA 5H8HA 2QS3A 4IB2A 4OWDA 5A5LA 2RKMA 1YZ0A 4GL8A 1QVSA 4ELQA 2CZLA 1LFGA 2DXYA 4WKMA 3Q29A 2UYEA 3BBRA 3QMFA 3G3JA 4GXAA 3OO9A 3CFLA 4YICA 1OLAA 4U23A 3N6TA 3RNNA 2XXPA 1H76A 1P1WA 3PD9A 4PFYA 1ZU0A 4X9TA 2DWIA 1P1QA 5AA4B 4RYAA 1OMPA 3T9UA 3RPLA 2Z8FA 3U8QA 2ZMBA 4IO5A 1Z7NE 2QPQA 4I62A 1RDZA 5LDZA 3S4UA 1LBBA 3FVKA 3CVGA 3MVYA 1A8EA 3TTLA 4BDQA 2RC9A 4ND9A 4NX1A 2QFLA 3KBRA 1Y3NA 3H7MA 4H8IA 1NL5A 3VLUA 5KCJA 5DVJA 1EZ9A 2G29A 4HTGA 1H43A 3PD8A 3C35A 4I3EA 3MW0A 1UTHA 3GYYA 3PPPA 4PFUA 1LFIA 1Y4TA 3SESA 3TKDA 2F34A 3QUFA 1IXCA 4ZZEA 1NV4A 4ZS9A 2X7QA 3SERA 1QKAA 3S9LC 1B05A 3TFLA 1UTHB 1PB9A 4IGRA 4F19A 4IGTA 3S9NC 4YMAA 1FBFA 3T0JA 2DVZA 3LBSA 1H3DA 1NV3A 3N6UA 1K9YA 1EYJA 4HE0A 5CMMA 4DE8A 3O2AA 4GRKA 3OEMA 3C4MA 4FATA 1IIWA 3WAFA 3PPQA 3VV5A 3G3GA 3K6UA 4YAHX 4G68C 2XWOA 3CFZA 3ZSFA 2ONRA 3IOVA 2RINA 2O7IA 5DEXA 4M4GA 1IQ7A 5JTYB 5I5PA 5CBSA 2LAOA 3KOTA 1SW5A 2RF1A 3U92A 3MPLA 4K3FA 3FIRA 3O28A 1JQFA 2O68A 3LSFB 1VDWA 2H9BA 1NV7A 4R9GA 3TMGA 3E3KA 2I4CA 3B50A 3QYTA 2RCBA 3ZKKA 3KEIA 4O94A 3TUSA 2F35A 1US4A 2Y7RA 2R71A 4DXCA 1LBWA 4F3PA 4IO7A 5FHNA 4YB5A 2OBGA 3K00A 4R75A 4GD5A 4XKRA 1JW1A 4U4XA 4N6KA 1I69A 3RYDA 1B4ZA 1RYOA 4KI0E 4U21A 4XF5A 4H8JA 4DDDA 4GWUA 3TCFA 3USDA 3E9XA 1FBCA 4WEDA 2WBDA 4EQ9A 1CNQA 3ECRA 4NF0A 1LBZA 1N04A 5ET8A 2UVIA 4G68A 3RLFE 3L6HA 2I0BA 1KA0A 1MQIA 1ZLQA 3V89B 1Q35A 4F3GA 3M3LA 2XXQA 4TOZA 4PDDA 4GWZA 1D9QA 4YU0A 2HCAA 4H45A 2OWZA 2XX9A 4IO3A 1NV0A 5ET6A 1JVYA 3IOWA 3T66A 4I3YA 1QKBA 4R74A 1RYXA 3CSBA 5EHMA 1NUYA 1IUDA 4GWXA 4WEPA
chains in the Genus database with same CATH topology
1NUZA 2VT5A 1EYIA 1LBVA 5FBPA 4N8YA 4NAPA 4NGUA 1FBGA 4HXVA 4N6DA 4PFIA 1RDXA 2F3DA 4JVDA 4PAFA 4DI4B 4N15A 1NV1A 1IMCA 3KBZA 3A29A 3B8BA 1FPDA 4PETA 4MNIA 1FTAA 3LUZA 1VDWA 4I40A 4P1LA 4O7MA 1FRPA 1NV7A 2XWIA 5IZ1A 2WYPA 1FPBA 4NX1A 2GQ1A 4PAKA 4PFRA 2QFLA 1FBEA 2DE3A 3B50A 2Q9TA 2HXRA 3MYUA 4JVCA 4GX3A 3FXBA 2F5XA 4MX6A 2P3VA 4PBQA 4X8RA 5F24A 4HCWA 4P9KA 4O94A 4MIJA 4P56A 4OA4A 1AWBA 5I3SA 4AS5A 1NUXA 2WBBA 1G0HA 1LBWA 1NUWA 5ESYA 2L5VA 4I3EA 3ISPA 1JP4A 3BIHA 1FBHA 1FPLA 4N8GA 3T1BA 4QXDA 3GYYA 1FJ9A 4PC9A 2CZHA 1FPEA 1FSAA 1SPIA 2BJIA 4IR8A 4HE2A 5EQ8A 5EYHA 1FPKA 1Q9DA 5IZ3A 5IZ3B 2B4MA 3E78A 4GBWA 1BK4A 2F3BA 2PFZA 2FIEA 4NHBA 5EQAA 2V4CA 4PDHA 5CM6A 3EKIA 1NV4A 4N6KA 4AS4A 2OX3A 2FHYA 4KXPA 5T3JA 5EQ9A 1NV6A 2ZZVA 4OVSA 1QGXA 2DE4A 2QVUA 2Q74A 3RYDA 2CEXA 5J1DA 1G0IA 1KZ8A 4PCDA 2WX9A 3W9VA 1INPA 2CZIA 4GWYA 4XF5A 1FJ6A 5DW8A 4N91A 4GX6A 1K9ZA 1DBZA 5ET5A 4XFEA 4QBAA 4MNCA 4NQ8A 4GWUA 4PGNA 4XEQA 4F19A 5JK4A 3FBPA 1FBCA 2ZZWA 1FBFA 1FPJA 1NI9A 1YXIA 2WBDA 4G61A 4N17A 4GWWA 3T0JA 1YZ0A 5ET7A 5A5LA 4H46A 2DVZA 4OVPA 1CNQA 2QVRA 1NV3A 1RDYA 4NF0A 1IMFA 3LV0A 4JVIA 3IFCA 4FBPA 1LBZA 2WEFA 2CEYA 4PBHA 4PF8A 1XI6A 1DK4A 1EYKA 2HHMA 1YYZA 2DDKA 4HE1A 5ET8A 1K9YA 2B4LA 3E79A 4LN5A 1EYJA 4MAGA 5IM2A 4HE0A 4GX4A 2XWKA 4X04A 4P8BA 2XXKA 3W9WA 3QMFA 2KR0A 2XWVA 3U65A 2FBPA 4F18A 3MSTA 1IMAA 1KA0A 3KC0A 4NG7A 4O8MA 5IGAA 3NOHA 4MMPA 3BIGA 4M1VA 4YICA 3D1RA 2JJKA 2P3NA 3KC1A 4P47A 4N81A 3PTYA 4PF6A 5EYGA 2HZKA 4F1UA 1FPFA 5J16A 4PDDA 4N4UA 4DI3D 4F1VA 1NV5A 2PCRA 1LEVA 4GBVA 4GWZA 4O7IA 1D9QA 4MNPA 2XWOA 5LTCA 4UABA 4H45A 2CZKA 2PFYA 4OVQA 4PTKA 4X9TA 1NV2A 2V3QA 4P1EA 4MJOA 3SZPA 2OWZA 2MKZA 3ROJA 1LBYA 4OVRA 4PE3A 2VPOA 3RPLA 1FBPA 3CHGA 4YZZA 5I7IA 1FPGA 4GWSA 1DCUA 2FVZA 2HPGA 1FBDA 2WYKA 1NV0A 2VPNA 3HFUA 5EQ7A 4NN3A 5ET6A 4OANA 1IMEA 4MCOA 2FIXA 4PAIA 4PGPA 2Y5KA 4HCYA 2Q8MA 3RPLB 2Y5LA 5I5PA 2XA5A 5IZZA 1KA1A 3IFAA 4P3LA 4I3YA 1FPIA 2DE2A 2ZZXA 4PFBA 1IMDA 2QVVA 2QPQA 1NUYA 1RDZA 5LDZA 1IMBA 1LBXA 2HZLA 2KQZA 4MHFA 4OVTA 4GWXA 2R8TA 4MEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUZ A;  2VT5 A;  1EYI A;  1LBV A;  5FBP A;  1FBG A;  4HXV A;  1RDX A;  2F3D A;  1NV1 A;  1IMC A;  3KBZ A;  3A29 A;  3B8B A;  1FPD A;  1FTA A;  3LUZ A;  1VDW A;  4I40 A;  1FRP A;  1NV7 A;  5IZ1 A;  1FPB A;  2GQ1 A;  2QFL A;  1FBE A;  4GX3 A;  2P3V A;  5F24 A;  1AWB A;  5I3S A;  4AS5 A;  1NUX A;  2WBB A;  1G0H A;  1LBW A;  1NUW A;  5ESY A;  4I3E A;  1JP4 A;  3BIH A;  1FBH A;  1FPL A;  4QXD A;  1FJ9 A;  2CZH A;  1FPE A;  1FSA A;  1SPI A;  2BJI A;  4IR8 A;  4HE2 A;  5EQ8 A;  5EYH A;  1FPK A;  1Q9D A;  5IZ3 A;  5IZ3 B;  4GBW A;  1BK4 A;  2F3B A;  2FIE A;  5EQA A;  1NV4 A;  4AS4 A;  2OX3 A;  2FHY A;  4KXP A;  5T3J A;  5EQ9 A;  1NV6 A;  1QGX A;  2QVU A;  2Q74 A;  3RYD A;  1G0I A;  1KZ8 A;  1INP A;  2CZI A;  4GWY A;  1FJ6 A;  5DW8 A;  4GX6 A;  1K9Z A;  1DBZ A;  5ET5 A;  4GWU A;  3FBP A;  1FBC A;  1FBF A;  1FPJ A;  1NI9 A;  1YXI A;  2WBD A;  4G61 A;  4GWW A;  3T0J A;  1YZ0 A;  5ET7 A;  5A5L A;  4H46 A;  1CNQ A;  2QVR A;  1NV3 A;  1RDY A;  1IMF A;  3LV0 A;  3IFC A;  4FBP A;  1LBZ A;  2WEF A;  1XI6 A;  1DK4 A;  1EYK A;  2HHM A;  1YYZ A;  2DDK A;  4HE1 A;  5ET8 A;  1K9Y A;  1EYJ A;  4HE0 A;  4GX4 A;  3QMF A;  2FBP A;  1IMA A;  1KA0 A;  3KC0 A;  3BIG A;  3D1R A;  2JJK A;  2P3N A;  3KC1 A;  4N81 A;  5EYG A;  1FPF A;  5J16 A;  1NV5 A;  2PCR A;  1LEV A;  4GBV A;  4GWZ A;  4O7I A;  1D9Q A;  4H45 A;  2CZK A;  4PTK A;  1NV2 A;  4MJO A;  2OWZ A;  3ROJ A;  1LBY A;  3RPL A;  1FBP A;  1FPG A;  4GWS A;  1DCU A;  2FVZ A;  1FBD A;  1NV0 A;  5EQ7 A;  5ET6 A;  1IME A;  2FIX A;  2Y5K A;  2Q8M A;  3RPL B;  2Y5L A;  1KA1 A;  3IFA A;  4I3Y A;  1FPI A;  1IMD A;  2QVV A;  1NUY A;  1RDZ A;  5LDZ A;  1IMB A;  1LBX A;  4GWX A;  2R8T A; 
#chains in the Genus database with same CATH topology
 1EYI A;  4NGU A;  1PB7 A;  4YKK A;  4PET A;  2F36 A;  3A29 A;  2QS2 A;  4I1D A;  4OHN A;  4PAK A;  2XXY A;  2DE3 A;  3SEU A;  4KCC A;  4JVC A;  3OSQ A;  3UP9 A;  3CIJ A;  3KN3 A;  2F78 A;  2OZZ A;  3Q28 A;  1LCT A;  2I3W A;  1Y3P A;  4LP2 B;  4IR8 A;  2BJI A;  3V5A A;  5IZ3 B;  1YAE A;  1ANF A;  3PMV A;  3OD7 A;  3EKI A;  3T93 B;  4BDM A;  1EU8 A;  5HPQ A;  2OK2 A;  2CEX A;  5AA2 D;  3OSR A;  3W9V A;  3KOS A;  3K2D A;  5DW8 A;  1MQD A;  2B3F A;  4GOT A;  4N17 A;  5B70 A;  1A40 A;  2I49 A;  2YLN A;  3H4Z A;  4QHQ A;  3QIM A;  1IMF A;  3K02 A;  2O7U A;  3VFJ A;  1QUK A;  3JZJ A;  4HE1 A;  5F1Q A;  3Q25 A;  2V25 A;  1N7X A;  2QJE A;  3D4G A;  1GV8 A;  3LSL A;  1A54 A;  2FBP A;  3IOU A;  4FE8 A;  3S9M C;  4N81 A;  4Q0C A;  2O51 A;  4JDF A;  4QSD A;  3B7D A;  2NOO A;  2V3T A;  1BLF A;  4MJO A;  1XHY A;  4OVR A;  2VPO A;  2ZYM A;  4GWS A;  2FVZ A;  1I6B A;  5K2X A;  5EQ7 A;  1MY0 A;  4OFL A;  3PUX E;  3A3C A;  1JEU A;  4JWX A;  4X1D A;  4N8Y A;  5H8S A;  2DS9 A;  4THI A;  3B8B A;  3HCQ A;  2I0C A;  5CMB A;  4GVO A;  1WVJ A;  1FBE A;  3MZ9 A;  3ILU B;  3TTK A;  3IOT A;  4MH5 A;  3OO6 A;  4P9K A;  3ODB A;  3KZG A;  1MY4 A;  5L9M A;  2CZH A;  1MDP 1;  2D5W A;  3JV9 A;  4GBW A;  5TU0 A;  4BDO A;  2FIE A;  3TCG A;  1J1N A;  3MZ1 A;  1D9Y A;  1MH3 A;  5AA1 A;  1URD A;  1FTK A;  1LLS A;  1LB9 A;  3SET A;  4QF9 A;  1EZO A;  4XFE A;  3MJN A;  5ET5 A;  1DPE A;  1P1U A;  1MY2 A;  2DOJ A;  3FBP A;  3B6T A;  2AL5 A;  2QVR A;  2HHM A;  3C34 A;  1VR5 A;  1UQW A;  1R9Q A;  1VE4 A;  4P8B A;  3A09 A;  1UIU A;  3U65 A;  3KC0 A;  1MXZ A;  4F3B A;  3TQW A;  4L17 A;  4M1V A;  1LAX A;  4ZED A;  3QXM A;  1MDQ A;  3H6V A;  1BKA A;  4GBV A;  1POT A;  3S9E A;  3I5O A;  3HO7 A;  4P1E A;  5ITP A;  2MKZ A;  4KYE A;  3PPN A;  4H6D A;  5I7I A;  3FD3 A;  1B1X A;  1R6Z A;  4GFR A;  1IME A;  3IR1 A;  4R6Y A;  2Q2C A;  2HAV A;  2IA4 A;  2VD3 A;  1DPP A;  4PFB A;  2I3V A;  1MXW A;  1P1N A;  4WXJ A;  4P0G A;  3LSW A;  5FBP A;  1LBV A;  3VVF A;  2DQV A;  1GGG A;  1PB8 A;  3PV0 E;  5AA3 A;  4GWO A;  4MNI A;  1B52 A;  1M5D A;  3VE1 B;  3E4R A;  4H1X A;  4OFO A;  1H44 A;  2YPN A;  3K6V A;  2REG A;  5F24 A;  5TP9 A;  3IO6 A;  5H8F B;  2O6A A;  5I3S A;  4AS5 A;  3VDF A;  1LAF E;  2Q88 A;  4O3B A;  2E0S A;  4DCX A;  2CMO A;  1FSA A;  3SEX A;  5EQ8 A;  1R9L A;  4FAJ A;  1MQJ A;  3IAZ A;  5H8H B;  4F39 A;  5EQA A;  4EUO A;  4EF2 A;  2F6P A;  3FUZ A;  1MY1 A;  5J1D A;  3EPE A;  1IXI A;  4ESX A;  4FEC A;  1LFH A;  1MQG A;  3FAS A;  1NI9 A;  5I2N A;  1B7Z A;  4JB7 A;  4RK9 A;  4QFN A;  3QUJ A;  2CEY A;  1XI6 A;  2KLF A;  3C36 A;  3VVE A;  3AXF A;  4F18 A;  4QFK A;  2I48 A;  3T96 B;  3D1R A;  4F1U A;  3FXR A;  1ZTY A;  3L6G A;  4F1V A;  4MNP A;  2OJT A;  1Z7M E;  5H8N B;  4OMB A;  3TEP A;  3UIF A;  1I6A A;  2QSX A;  3ZS6 A;  4JXI A;  2XD2 A;  1PBQ A;  3CI8 A;  4ONY A;  1B2H A;  3JYR A;  2F7B A;  3MVW A;  5I2K A;  3LUY A;  3OXN A;  4AQ4 A;  3RT8 A;  3K4U A;  4ZEK A;  2V3U A;  5CMK A;  1OLC A;  2F8D A;  4G8H A;  3T22 A;  4GX3 A;  4H5G A;  5I2K B;  3IB0 A;  4OA4 A;  3N26 A;  3VXC A;  4N6P A;  5ICT A;  4R6K A;  3PPR A;  4BDN A;  3UGW A;  1B1H A;  1FPK A;  2XXU A;  4ELR A;  2O84 X;  4PDH A;  4EDP A;  1FTJ A;  2Z8E A;  4R72 A;  2HAU A;  3RQT A;  4UAC A;  1JVX A;  1INP A;  3DEL B;  3MP8 A;  3GZG A;  1FW0 A;  3QK6 A;  4JWO A;  2XX8 A;  4QFL A;  1YTV A;  4I9D A;  2ZZW A;  2NXO A;  4U1Z A;  4PF8 A;  3C9H A;  4KYS A;  1ZJL A;  2IEE A;  2FYI A;  3MST A;  3TCH A;  4Z7E A;  3NOH A;  2UVJ A;  3KC1 A;  3KN8 A;  2PT1 A;  3O66 A;  4POX A;  1DOT A;  2VD2 A;  4UAB A;  1JW4 A;  1N7W A;  2AIX A;  3SEV A;  1NV2 A;  3ROJ A;  1LBY A;  2QMX A;  1XC1 A;  3T9H B;  3FVO A;  3HFU A;  2OPE A;  4FEB A;  1FQB A;  4OES A;  1PDA A;  1QJM A;  4R6H A;  3PUW E;  3ONM A;  3G3H A;  1LBX A;  2RC8 A;  1PBP A;  4LA9 A;  4F29 A;  3G3K A;  5I58 A;  1WDN A;  4OEN A;  4OZ9 A;  5HM4 B;  1LAG E;  4R2B A;  4O7M A;  1OVT A;  2NVU B;  5H8Q A;  1B5I A;  4OVJ A;  4ZDM A;  1B3F A;  2F5X A;  3MC2 A;  4KHZ E;  3CG3 A;  4AB5 A;  1TT1 A;  3RTW B;  3K6X A;  3V83 A;  1YPN A;  1NFT A;  5I56 B;  1B3E A;  3FJG A;  4TLM B;  3N5L A;  5I57 A;  3U1O A;  1JP4 A;  2THI A;  4PC9 A;  3PUY E;  5H8Q B;  3MZB A;  3TTR A;  1Q9D A;  2AL4 A;  2VHA A;  5CM6 A;  4G8M A;  4HW8 A;  5T3J A;  3G3I A;  4PCD A;  4ECF A;  1TFA A;  4GWY A;  1MQH A;  3OO8 A;  1FTM A;  2R9J A;  3OEL A;  4E0X A;  3QSL A;  5FTH A;  1ZMG A;  4PAF A;  3W15 C;  4JVI A;  2WEF A;  2YJP A;  3BFT A;  2DDK A;  3O6I A;  1B9J A;  2RC7 A;  1OVB A;  4QFP A;  1IIT A;  3SDF A;  2NWJ A;  4PFW A;  4OYV A;  5TPA B;  3K0V A;  1CB6 A;  3I3V A;  1XS5 A;  4GF8 A;  5L9S A;  3IK6 B;  5CC2 A;  3KG2 A;  4PFI A;  4DCY A;  4MCO A;  2FIX A;  4HCY A;  3K1P A;  2KQZ A;  4GLI A;  1N3W A;  2VT5 A;  1WOD A;  2PBW A;  4MBP A;  3T9V A;  5CMC A;  4E0W A;  3PUV E;  1H45 A;  1FPB A;  3LC8 A;  4XIG Q;  1MPD A;  5H8N A;  1B0H A;  3KN7 A;  4PP0 A;  4ZE8 A;  3Q27 A;  5DEX B;  4ZEC A;  4X8R A;  2H99 A;  3T1B A;  1FBH A;  4QXD A;  1O63 A;  2PT2 A;  5I59 B;  1O7T A;  1NNF A;  2B65 A;  5EYH A;  3E78 A;  1Y9U A;  3TPA A;  2V4C A;  1GR2 A;  1ELJ A;  2H5Y A;  4OVS A;  4DI3 D;  4YKI A;  1M5C A;  1URG A;  3VVD A;  1B0L A;  2ZNU A;  4N91 A;  2V84 A;  4EQ7 A;  1K9Z A;  1Y1M A;  4QBA A;  3N94 A;  2Y7I A;  1NH7 A;  3SEW A;  3LV0 A;  4OXV A;  5KCJ B;  3PUZ E;  3O9P A;  3DLN A;  5BWJ A;  3W9W A;  1SDX A;  3FV2 A;  4NG7 A;  3BIG A;  1B3G A;  4PF6 A;  2RCA A;  4ZEI A;  5AA2 B;  4ZE9 A;  4RJZ A;  5KDT A;  4LQ5 A;  4OVQ A;  2V3Q A;  1B7U A;  4H67 A;  2QL3 A;  1FBD A;  2PMS A;  2Y7P A;  1QUJ A;  3UOR A;  5DVI A;  4PGP A;  2F6G A;  4OEU A;  1LB8 A;  4P3L A;  3EQ1 A;  2A5T A;  4UA8 A;  4MHF A;  4NWD A;  4DLD A;  1CE2 A;  2R8T A;  4NF6 A;  5KDT B;  4HXV A;  4IY6 A;  4DI4 B;  1B4H A;  3HV1 A;  4DZ1 A;  4KD5 A;  1Y4C A;  1MXX A;  4RA1 A;  5IZ1 A;  5KZT A;  1FQA A;  2R6G E;  2P3V A;  4HCW A;  5CI5 A;  4YB6 A;  1AWB A;  4GQO A;  5ESY A;  4JBZ A;  2V93 A;  1FPE A;  4OEV A;  4FJP A;  3RN8 A;  3O29 A;  1VFE A;  3IJX B;  4MFI A;  3G7W A;  2Q74 A;  3V8X B;  2Q8J A;  2W7Y A;  4XXU A;  4GIZ A;  4R2F A;  4NQ8 A;  5I2N B;  1YCJ A;  1N84 A;  1DMB A;  4GWW A;  2XX7 A;  4H46 A;  1SVX B;  4YMB A;  1OQG A;  4MAG A;  1SW2 A;  4ZEF A;  1JNF A;  1SQY A;  4O8M A;  5B7D A;  1R1N A;  1NNP A;  1FPF A;  1QW0 A;  4N4U A;  3U94 A;  5I84 A;  1LEV A;  5DT6 A;  5AE4 A;  2WKY A;  2QMW A;  2PFY A;  4KFQ A;  1OIB A;  1BTJ A;  1IEJ A;  3T9X B;  2DWA A;  2WYK A;  4ELP A;  4LZ8 A;  2Q8M A;  2O1L A;  2QVV A;  4NAP A;  3H06 B;  2UXA A;  4C1T A;  4X1B A;  4N15 A;  3ZKL A;  2D3I A;  1B3H A;  1NNK A;  2Q89 A;  5FHM A;  4GL0 A;  1URS A;  5K2Y A;  3EHS A;  4R73 A;  4KQP A;  3UN6 A;  4LZ5 A;  4XKQ A;  1NUW A;  3OEK A;  3QAX A;  1AIV A;  4G77 A;  1LCF A;  4NF5 B;  4JSD A;  2REJ A;  1MS7 A;  3EHU A;  3RPW A;  1PEB A;  3C31 A;  4AS4 A;  1F9B A;  4KXP A;  3IJO B;  1NV6 A;  4HS7 A;  1KZ8 A;  4JSO A;  3K6W A;  1ZKB A;  4H65 A;  1EH3 A;  3BFU A;  4XEQ A;  2ZYO A;  4Z0I A;  3PMW A;  4I8C A;  1AL3 A;  5I59 A;  2ALU A;  4X04 A;  3O97 A;  5FTI A;  3FJ7 A;  3FAT A;  2G93 A;  3HPI A;  4KCD A;  1LBC A;  4ZEB A;  5IM2 A;  1SBP A;  5IGA A;  3TZA A;  4DIG A;  2HZK A;  4G4P A;  1AH5 A;  4YB7 A;  3S2V A;  1O64 A;  1IXH A;  5DVF A;  4QFO A;  1Y3Q A;  4PE3 A;  3D4C A;  3IB1 A;  4OAN A;  1FTL A;  3KSX A;  4NE4 A;  1KA1 A;  4RK2 A;  2ZZX A;  1IMD A;  2H25 A;  3PGF A;  3R6U A;  4NTL A;  3FJM A;  4U1O A;  5AA2 A;  2OPD A;  4RXL A;  1QUI A;  4F2Q A;  3KBZ A;  3I6V A;  3H6T A;  2OWT A;  5L8D A;  1SYH A;  2Q9T A;  3IOR A;  3MYU A;  3KJ7 A;  4MX6 A;  1KWH A;  3HST A;  1HSJ A;  5I56 A;  4BLA A;  2A5T B;  4RPN A;  1ATG A;  1D3K A;  3FVN A;  4N8G A;  2ABH A;  4LAT A;  4HE2 A;  3FXU A;  3HHG A;  2F3B A;  3UK4 A;  1SI0 A;  1MM6 A;  4EXK A;  4EQB A;  1NH8 A;  1FQD A;  3GXA A;  1G0I A;  1D4N A;  4FED A;  1S7Y A;  1N76 A;  1FPJ A;  2Q2A A;  1HSL A;  3R7X A;  1LST A;  4F1Y A;  1DK4 A;  3MVX A;  1VFD A;  4F22 A;  5CRY A;  4N07 A;  4LZ7 A;  4MLV A;  2OLB A;  1GTK A;  2PCR A;  5LTC A;  3A3U A;  1ZBM A;  4O7I A;  2Z23 A;  2PX1 A;  5L9O A;  4KR5 A;  1GVC A;  4PTK A;  4NWC A;  5AA4 A;  2H4I A;  1FBP A;  4C0R A;  5DTB A;  2ZNS A;  2GHA A;  4MLQ A;  3LSX A;  1BIY A;  5IZZ A;  1FPI A;  1TFD A;  1JET A;  1P99 A;  4OVT A;  2HZL A;  1NUZ A;  4IY5 A;  1I6Q A;  5I58 B;  1RDX A;  2DYX A;  1TWY A;  1NV1 A;  1FPD A;  1A55 A;  1FRP A;  5A5X B;  3U72 A;  4DXB A;  1HSE A;  2HXR A;  1M5E A;  3FXB A;  3K1N A;  4TLL B;  3IX1 A;  3H6U A;  4FIM A;  4G68 B;  5EYF A;  3ISP A;  4TQU Q;  1FJ9 A;  1MXY A;  3MUQ A;  4NF4 A;  4QRZ A;  4FOR A;  1BP5 A;  2XXT A;  1II5 A;  2HXW A;  3RGY A;  1MXU A;  1P1O A;  1QGX A;  1Y1Z A;  2ZYK A;  2DXR A;  2CZI A;  3THI A;  2O69 A;  4GX6 A;  1DBZ A;  4MNC A;  1SW4 A;  1MXV A;  3H3G A;  3FZV A;  5ELV A;  4LQ2 A;  2PYY A;  4NF5 A;  5ET7 A;  1RDY A;  4PBH A;  5M2V A;  3MWB A;  2B4L A;  3E79 A;  4ELO A;  5TP9 B;  2P2A A;  1B5J A;  5TPA A;  5LOM A;  2NUV A;  2ONS A;  2P0S A;  1DTZ A;  1NV5 A;  3FXQ A;  3HHF A;  3TYH A;  2B3B A;  4XKP A;  1FQE A;  4Q5T A;  3C32 A;  1FPG A;  1XOC A;  3RPL B;  1IZ1 A;  4N13 A;  3FGS A;  4IO6 A;  3DP8 A;  1B58 A;  4NED A;  1RKM A;  5ICQ A;  1B40 A;  4MEV A;  2I4B A;  4BDL A;  1UTB A;  4EXL A;  1FBG A;  4N6D A;  4JVD A;  4KPT A;  1USY H;  1FTA A;  1NKX A;  1MPB A;  4ISU A;  2DWH A;  3PPO A;  2XWI A;  1MH4 A;  1XVX A;  2GQ1 A;  1B7H A;  3DP4 A;  1UIV A;  1B6H A;  3MBP A;  4PBQ A;  4U22 A;  3TOD A;  1TXF A;  2ZXT A;  1D9V A;  1MPC A;  2QS4 A;  4YKJ A;  4G8N A;  3FV1 A;  5FHO A;  1LGB C;  1FQF A;  3OO7 A;  1SPI A;  4U4S A;  3H03 A;  1BK4 A;  1XT8 A;  4NHB A;  2OX3 A;  2FHY A;  1QUL A;  2VP1 A;  3IO4 A;  4O3A A;  1SW1 A;  2D21 A;  4QSC A;  2XXW A;  4RY1 A;  2F7C A;  3GBB A;  4OVP A;  1EYK A;  4LN5 A;  2FA7 A;  4RPO A;  5I57 B;  2KR0 A;  1IMA A;  3TQL A;  1M5B A;  4AB6 A;  4PQJ A;  3ILT B;  4P47 A;  4OTE A;  4R9F A;  3PTY A;  3DM0 A;  2F7A A;  2F97 A;  3SEY A;  1B5H A;  5H8F A;  2CZK A;  2DVC A;  4NF6 B;  2OCU A;  4H5F A;  4OER A;  1MM7 A;  3KSJ A;  4XKN A;  4YZZ A;  3VLV A;  3TDJ A;  2HPG A;  1B51 A;  2Y5K A;  3H6W A;  2Y5L A;  2XA5 A;  3CFX A;  2DE2 A;  3CSG A;  5JTY A;  1AMF A;  4NF8 B;  3OMB A;  3KJT A;  2F3D A;  1IMC A;  5ITO A;  4I40 A;  4H0W A;  4P1L A;  2XXI A;  2O1M A;  3WAE A;  2BJJ X;  2DSF A;  4BDR A;  1T0K A;  4QSE A;  4F2O A;  2XXV A;  4NF8 A;  1NUX A;  4O3C A;  5IKB A;  3Q26 A;  1FPL A;  3EN3 A;  3K01 A;  5IZ3 A;  2UVG A;  1M5F A;  3MQ9 A;  3M3K A;  2ESN A;  2QVU A;  2P1S A;  2WX9 A;  3O6H A;  2Z22 A;  1AOV A;  3CG1 A;  3R26 A;  4X48 A;  2H98 A;  1S9T A;  5JK4 A;  5BUU A;  1YXI A;  4G61 A;  4NMY A;  3VXB A;  3MP1 A;  4OET A;  3IFC A;  1YYZ A;  3MAM A;  1SYI A;  2XWK A;  2XXK A;  4MF3 A;  1EZP A;  2ANJ A;  2XWV A;  1A8F A;  1ZIU A;  3LR1 A;  3MP6 A;  4MMP A;  1Y20 A;  2VOZ A;  2JJK A;  2ZYN A;  1S50 A;  4F3S A;  3G3F A;  3FVG A;  4IO2 A;  1LAH E;  1JEV A;  4U2R A;  2Z8D A;  1Q1K A;  3HN0 A;  4MIJ A;  2A5S A;  2GFE A;  1US5 A;  3IL1 B;  2XXR A;  2X7P A;  4OFJ A;  3IFA A;  5CBR A;  2XXH A;  1VSO A;  1B32 A;  2GHB A;  1MY3 A;  2DP8 A;  1SI1 A;  3LUZ A;  1POY 1;  1USY E;  2GRV A;  2HQ0 A;  3U93 A;  2XXX A;  4G2Z A;  1FTO A;  4DXU A;  3E13 X;  4LUB A;  2ZNT A;  4POW A;  4JWY A;  2XD3 A;  2WBB A;  3RUM A;  2L5V A;  3P7I A;  3BIH A;  4Q8R A;  3C33 A;  3RY3 A;  2B4M A;  2PFZ A;  2X26 A;  1UTB B;  3TTN A;  2ZZV A;  3B6W A;  2DE4 A;  3MPK A;  2UVH A;  1N0T A;  1FJ6 A;  3M3F A;  2HEU A;  3RT6 B;  1NNT A;  3OOA A;  2FNC A;  1DSN A;  2QS1 A;  3PMX A;  3IB2 A;  4PFT A;  4FBP A;  1SD3 A;  2OWS A;  1N3X A;  4KYD A;  3OEN A;  3K1M A;  2UYF A;  3M8U A;  4GX4 A;  1B46 A;  1B3L A;  3VLW A;  2E1S A;  3SKP A;  2GH9 A;  4F31 B;  2P3N A;  5EYG A;  5J16 A;  4GXS B;  4P11 A;  4XTC Q;  2PVU A;  1FQC A;  3SZP A;  2QRY A;  5EHS A;  2M8C A;  3CHG A;  3O6G A;  1DCU A;  4NN3 A;  2VPN A;  5DYH A;  4YKP A;  1FCK A;  1MRP A;  4PAI A;  1L5T A;  4IO4 A;  1NMU A;  4P56 A;  1IMB A;  3MVZ A;  5ISU A;  2AYS A;  4P0I A;  3F11 A;  3TAJ A;  5IAI A;  3KGC A;  2Y84 A;  2DWJ A;  5A5X A;  3EHT A;  3GBA A;  4ESW A;  1XVY A;  2HFB A;  2Y7K A;  4ZZA A;  4LON B;  2WYP A;  4PFR A;  3UA8 A;  4PE5 B;  1PC3 A;  2ONK E;  3GLB A;  1MG1 A;  3CRB A;  4EF1 A;  3CR9 A;  5JEI A;  4NF4 B;  1G0H A;  5F7V A;  1A7L A;  1OQH A;  2VGQ A;  1JW5 A;  3TEL A;  3EF7 A;  3KFM A;  3RTF B;  2I58 A;  3TTM A;  3BKI B;  4Q30 B;  5EQ9 A;  1A99 A;  1IXG A;  5HBC A;  3B6Q A;  2I6E A;  2Y7W A;  3PU5 A;  4RNS A;  4LVQ A;  3DP6 A;  1DTG A;  4PGN A;  2XHD A;  4C1U A;  4OQO A;  5H8H A;  2QS3 A;  4IB2 A;  4OWD A;  5A5L A;  2RKM A;  1YZ0 A;  4GL8 A;  1QVS A;  4ELQ A;  2CZL A;  1LFG A;  2DXY A;  4WKM A;  3Q29 A;  2UYE A;  3BBR A;  3QMF A;  3G3J A;  4GXA A;  3OO9 A;  3CFL A;  4YIC A;  1OLA A;  4U23 A;  3N6T A;  3RNN A;  2XXP A;  1H76 A;  1P1W A;  3PD9 A;  4PFY A;  1ZU0 A;  4X9T A;  2DWI A;  1P1Q A;  5AA4 B;  4RYA A;  1OMP A;  3T9U A;  3RPL A;  2Z8F A;  3U8Q A;  2ZMB A;  4IO5 A;  1Z7N E;  2QPQ A;  4I62 A;  1RDZ A;  5LDZ A;  3S4U A;  1LBB A;  3FVK A;  3CVG A;  3MVY A;  1A8E A;  3TTL A;  4BDQ A;  2RC9 A;  4ND9 A;  4NX1 A;  2QFL A;  3KBR A;  1Y3N A;  3H7M A;  4H8I A;  1NL5 A;  3VLU A;  5KCJ A;  5DVJ A;  1EZ9 A;  2G29 A;  4HTG A;  1H43 A;  3PD8 A;  3C35 A;  4I3E A;  3MW0 A;  1UTH A;  3GYY A;  3PPP A;  4PFU A;  1LFI A;  1Y4T A;  3SES A;  3TKD A;  2F34 A;  3QUF A;  1IXC A;  4ZZE A;  1NV4 A;  4ZS9 A;  2X7Q A;  3SER A;  1QKA A;  3S9L C;  1B05 A;  3TFL A;  1UTH B;  1PB9 A;  4IGR A;  4F19 A;  4IGT A;  3S9N C;  4YMA A;  1FBF A;  3T0J A;  2DVZ A;  3LBS A;  1H3D A;  1NV3 A;  3N6U A;  1K9Y A;  1EYJ A;  4HE0 A;  5CMM A;  4DE8 A;  3O2A A;  4GRK A;  3OEM A;  3C4M A;  4FAT A;  1IIW A;  3WAF A;  3PPQ A;  3VV5 A;  3G3G A;  3K6U A;  4YAH X;  4G68 C;  2XWO A;  3CFZ A;  3ZSF A;  2ONR A;  3IOV A;  2RIN A;  2O7I A;  5DEX A;  4M4G A;  1IQ7 A;  5JTY B;  5I5P A;  5CBS A;  2LAO A;  3KOT A;  1SW5 A;  2RF1 A;  3U92 A;  3MPL A;  4K3F A;  3FIR A;  3O28 A;  1JQF A;  2O68 A;  3LSF B;  1VDW A;  2H9B A;  1NV7 A;  4R9G A;  3TMG A;  3E3K A;  2I4C A;  3B50 A;  3QYT A;  2RCB A;  3ZKK A;  3KEI A;  4O94 A;  3TUS A;  2F35 A;  1US4 A;  2Y7R A;  2R71 A;  4DXC A;  1LBW A;  4F3P A;  4IO7 A;  5FHN A;  4YB5 A;  2OBG A;  3K00 A;  4R75 A;  4GD5 A;  4XKR A;  1JW1 A;  4U4X A;  4N6K A;  1I69 A;  3RYD A;  1B4Z A;  1RYO A;  4KI0 E;  4U21 A;  4XF5 A;  4H8J A;  4DDD A;  4GWU A;  3TCF A;  3USD A;  3E9X A;  1FBC A;  4WED A;  2WBD A;  4EQ9 A;  1CNQ A;  3ECR A;  4NF0 A;  1LBZ A;  1N04 A;  5ET8 A;  2UVI A;  4G68 A;  3RLF E;  3L6H A;  2I0B A;  1KA0 A;  1MQI A;  1ZLQ A;  3V89 B;  1Q35 A;  4F3G A;  3M3L A;  2XXQ A;  4TOZ A;  4PDD A;  4GWZ A;  1D9Q A;  4YU0 A;  2HCA A;  4H45 A;  2OWZ A;  2XX9 A;  4IO3 A;  1NV0 A;  5ET6 A;  1JVY A;  3IOW A;  3T66 A;  4I3Y A;  1QKB A;  4R74 A;  1RYX A;  3CSB A;  5EHM A;  1NUY A;  1IUD A;  4GWX A;  4WEP A; 
#chains in the Genus database with same CATH homology
 1NUZ A;  2VT5 A;  1EYI A;  1LBV A;  5FBP A;  4N8Y A;  4NAP A;  4NGU A;  1FBG A;  4HXV A;  4N6D A;  4PFI A;  1RDX A;  2F3D A;  4JVD A;  4PAF A;  4DI4 B;  4N15 A;  1NV1 A;  1IMC A;  3KBZ A;  3A29 A;  3B8B A;  1FPD A;  4PET A;  4MNI A;  1FTA A;  3LUZ A;  1VDW A;  4I40 A;  4P1L A;  4O7M A;  1FRP A;  1NV7 A;  2XWI A;  5IZ1 A;  2WYP A;  1FPB A;  4NX1 A;  2GQ1 A;  4PAK A;  4PFR A;  2QFL A;  1FBE A;  2DE3 A;  3B50 A;  2Q9T A;  2HXR A;  3MYU A;  4JVC A;  4GX3 A;  3FXB A;  2F5X A;  4MX6 A;  2P3V A;  4PBQ A;  4X8R A;  5F24 A;  4HCW A;  4P9K A;  4O94 A;  4MIJ A;  4P56 A;  4OA4 A;  1AWB A;  5I3S A;  4AS5 A;  1NUX A;  2WBB A;  1G0H A;  1LBW A;  1NUW A;  5ESY A;  2L5V A;  4I3E A;  3ISP A;  1JP4 A;  3BIH A;  1FBH A;  1FPL A;  4N8G A;  3T1B A;  4QXD A;  3GYY A;  1FJ9 A;  4PC9 A;  2CZH A;  1FPE A;  1FSA A;  1SPI A;  2BJI A;  4IR8 A;  4HE2 A;  5EQ8 A;  5EYH A;  1FPK A;  1Q9D A;  5IZ3 A;  5IZ3 B;  2B4M A;  3E78 A;  4GBW A;  1BK4 A;  2F3B A;  2PFZ A;  2FIE A;  4NHB A;  5EQA A;  2V4C A;  4PDH A;  5CM6 A;  3EKI A;  1NV4 A;  4N6K A;  4AS4 A;  2OX3 A;  2FHY A;  4KXP A;  5T3J A;  5EQ9 A;  1NV6 A;  2ZZV A;  4OVS A;  1QGX A;  2DE4 A;  2QVU A;  2Q74 A;  3RYD A;  2CEX A;  5J1D A;  1G0I A;  1KZ8 A;  4PCD A;  2WX9 A;  3W9V A;  1INP A;  2CZI A;  4GWY A;  4XF5 A;  1FJ6 A;  5DW8 A;  4N91 A;  4GX6 A;  1K9Z A;  1DBZ A;  5ET5 A;  4XFE A;  4QBA A;  4MNC A;  4NQ8 A;  4GWU A;  4PGN A;  4XEQ A;  4F19 A;  5JK4 A;  3FBP A;  1FBC A;  2ZZW A;  1FBF A;  1FPJ A;  1NI9 A;  1YXI A;  2WBD A;  4G61 A;  4N17 A;  4GWW A;  3T0J A;  1YZ0 A;  5ET7 A;  5A5L A;  4H46 A;  2DVZ A;  4OVP A;  1CNQ A;  2QVR A;  1NV3 A;  1RDY A;  4NF0 A;  1IMF A;  3LV0 A;  4JVI A;  3IFC A;  4FBP A;  1LBZ A;  2WEF A;  2CEY A;  4PBH A;  4PF8 A;  1XI6 A;  1DK4 A;  1EYK A;  2HHM A;  1YYZ A;  2DDK A;  4HE1 A;  5ET8 A;  1K9Y A;  2B4L A;  3E79 A;  4LN5 A;  1EYJ A;  4MAG A;  5IM2 A;  4HE0 A;  4GX4 A;  2XWK A;  4X04 A;  4P8B A;  2XXK A;  3W9W A;  3QMF A;  2KR0 A;  2XWV A;  3U65 A;  2FBP A;  4F18 A;  3MST A;  1IMA A;  1KA0 A;  3KC0 A;  4NG7 A;  4O8M A;  5IGA A;  3NOH A;  4MMP A;  3BIG A;  4M1V A;  4YIC A;  3D1R A;  2JJK A;  2P3N A;  3KC1 A;  4P47 A;  4N81 A;  3PTY A;  4PF6 A;  5EYG A;  2HZK A;  4F1U A;  1FPF A;  5J16 A;  4PDD A;  4N4U A;  4DI3 D;  4F1V A;  1NV5 A;  2PCR A;  1LEV A;  4GBV A;  4GWZ A;  4O7I A;  1D9Q A;  4MNP A;  2XWO A;  5LTC A;  4UAB A;  4H45 A;  2CZK A;  2PFY A;  4OVQ A;  4PTK A;  4X9T A;  1NV2 A;  2V3Q A;  4P1E A;  4MJO A;  3SZP A;  2OWZ A;  2MKZ A;  3ROJ A;  1LBY A;  4OVR A;  4PE3 A;  2VPO A;  3RPL A;  1FBP A;  3CHG A;  4YZZ A;  5I7I A;  1FPG A;  4GWS A;  1DCU A;  2FVZ A;  2HPG A;  1FBD A;  2WYK A;  1NV0 A;  2VPN A;  3HFU A;  5EQ7 A;  4NN3 A;  5ET6 A;  4OAN A;  1IME A;  4MCO A;  2FIX A;  4PAI A;  4PGP A;  2Y5K A;  4HCY A;  2Q8M A;  3RPL B;  2Y5L A;  5I5P A;  2XA5 A;  5IZZ A;  1KA1 A;  3IFA A;  4P3L A;  4I3Y A;  1FPI A;  2DE2 A;  2ZZX A;  4PFB A;  1IMD A;  2QVV A;  2QPQ A;  1NUY A;  1RDZ A;  5LDZ A;  1IMB A;  1LBX A;  2HZL A;  2KQZ A;  4MHF A;  4OVT A;  4GWX A;  2R8T A;  4MEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...