4QXDA

Crystal structure of inositol polyphosphate 1-phosphatase from entamoeba histolytica
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
MQTSLFEFANVLITAVKEASYSISKFKEEVEIKYKSDGSEVTQVDTQSQQIIFSIIKNKYPTINIIGEEDVENGIPDNQLPTITQLSFGSLENKIININDIIIYVDPLDGTDCYTHKQYDSVCVLVGVTYKGKPMIGIVSKPFYNNEITFAIENYISSISLQPLNDKIIFVCSKKNDIQHLIKSFPDPYEVKYKGGSGAKMMAIIHQEADIYYHPLIQSCTWDTLAAQVILEAQGGIVCDIYGNPLCYPSSKKESMRHKKGVLCLSPRAKKYLPYMLSISKTILLLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase, putative
publication title Structure-based identification of inositol polyphosphate 1-phosphatase from Entamoeba histolytica
pubmed doi rcsb
source organism Entamoeba histolytica hm-1:imss
total genus 85
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.1.3.57: Inositol-1,4-bisphosphate 1-phosphatase.
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4qxdA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4qxdA02
2FVZA 2WBBA 4GWYA 4AS4A 4I40A 4G61A 4KXPA 4H45A 2CZIA 1IMFA 2P3NA 1FPEA 5ET8A 5ESYA 3T0JA 4GX3A 4I3YA 5J16A 1KA0A 1RDXA 1KA1A 1XI6A 5EQ7A 1LBYA 1FBEA 3FBPA 4QXDA 2VT5A 2Y5LA 4GBVA 3LV0A 1RDZA 4IR8A 5EQ9A 1FPBA 1K9ZA 4FBPA 1FPJA 1G0HA 4GWSA 2Q74A 1NUZA 1DBZA 1FPDA 4N81A 5EQ8A 1Q9DA 2FHYA 1FPFA 3BIHA 1D9QA 2WBDA 1YYZA 1FBDA 3D1RA 3RPLA 1DK4A 4GWUA 1NUYA 3RYDA 1FBHA 1NUXA 2DDKA 1BK4A 2CZHA 4GWWA 1YXIA 1KZ8A 2QVVA 5F24A 1NUWA 1LBVA 1FPLA 2P3VA 5EYHA 3KC0A 1LBWA 2F3BA 5IZ3A 2FBPA 1LBZA 4O7IA 1JP4A 4GWXA 1G0IA 3RPLB 1EYKA 3LUZA 3KC1A 1NV1A 4HE0A 4HE2A 2Y5KA 3A29A 5I3SA 5FBPA 2HHMA 1FPKA 1NV6A 2PCRA 1QGXA 1K9YA 1YZ0A 3B8BA 1FRPA 1NV2A 3QMFA 1SPIA 1NV7A 4PTKA 1FBFA 1FJ6A 3BIGA 5ET7A 1FSAA 1FJ9A 1CNQA 1NV3A 4HXVA 4H46A 5IZ3B 4I3EA 2FIXA 2QVRA 1IMAA 2FIEA 1NV4A 2F3DA 1IMEA 4HE1A 1INPA 4GBWA 2R8TA 3KBZA 2GQ1A 1NV5A 3IFCA 1LEVA 1LBXA 2JJKA 1IMCA 1EYIA 2OX3A 5IZ1A 4GWZA 2Q8MA 1IMBA 1FBCA 1FTAA 5ET6A 5DW8A 1NI9A 1VDWA 1EYJA 2QFLA 5T3JA 1IMDA 3IFAA 4GX4A 5EQAA 1DCUA 1FPIA 2OWZA 1RDYA 4GX6A 2CZKA 4MJOA 3ROJA 4AS5A 5EYGA 1FBPA 5A5LA 1FBGA 1FPGA 2WEFA 1NV0A 5ET5A 2BJIA 5LDZA 2QVUA 1AWBA
chains in the Genus database with same CATH superfamily
2F78A 4QFPA 3V83A 5KDTB 4OEVA 4N4UA 4LN5A 5B70A 1QVSA 3IOUA 4ZS9A 4ECFA 5CC2A 4JWOA 4F1VA 1B4ZA 1DPPA 4N6PA 3THIA 4AB6A 1B1XA 4GWUA 3U65A 1FBHA 1ZKBA 1PDAA 1MPBA 4IGTA 5I2NA 1FQAA 1HSJA 4EXLA 1RYXA 4OVJA 1PB9A 1O7TA 2PYYA 2Y84A 5LOMA 4GL0A 4UACA 3A3CA 1H76A 3M8UA 4GIZA 1TFAA 3HHGA 2WX9A 2PCRA 1ZMGA 5F7VA 1NH8A 2UXAA 3K00A 1USYE 2V93A 1QKAA 5IZZA 1SI1A 1URDA 4HXVA 1B9JA 1MXYA 2UVHA 3T66A 3IFCA 5IZ1A 1IMCA 1EYIA 1IITA 3A09A 1NI9A 4LQ5A 1SI0A 4H1XA 4PAIA 4XKPA 1B0HA 1Q1KA 3VVDA 4M4GA 4R9GA 4DXCA 2WEFA 4F2QA 4WKMA 1B3FA 4ZZAA 1HSEA 1Y3PA 1II5A 3I3VA 2Q2CA 4F3BA 3LBSA 2RC7A 4DIGA 3EQ1A 5I59A 3SZPA 4GVOA 3BIHA 4O8MA 2RC8A 2DWAA 5CBSA 2HXRA 5AA2D 2DYXA 2XXTA 4QFKA 2CZHA 3MZ9A 4H5FA 2D3IA 1OQGA 1P99A 4P0IA 1I6AA 1FPLA 2P3VA 2XXQA 4R6KA 2Q9TA 4RA1A 3MQ9A 1SD3A 4IO5A 4QFOA 2XD3A 2DE2A 3KSJA 1S7YA 2Y5KA 4GRKA 5BUUA 2DWJA 1H45A 4HS7A 1NV2A 3FXUA 1FTKA 2RCAA 4XKQA 2DVZA 3MYUA 2OPEA 2RC9A 5ICQA 5TP9A 3DP8A 4NMYA 1A55A 2V25A 1SYIA 3MP1A 2F3DA 1IMEA 3TTNA 1R9LA 1ATGA 3SEYA 3USDA 3MVYA 4G8MA 1VDWA 4C0RA 1MY2A 1D4NA 4X1DA 4GQOA 4GX4A 4YU0A 1DCUA 1JVXA 5CMMA 4IO7A 4MJOA 5L9MA 1MPDA 5AA2B 5A5LA 2DXRA 1FPGA 5LDZA 3OO6A 4G4PA 3OELA 3TTMA 4MNIA 2I6EA 3W9VA 4I8CA 1TT1A 2PFZA 5H8FB 4I3YA 1XC1A 3S9EA 1XHYA 1KA0A 3QSLA 1RDXA 2F7CA 5K2YA 2ZNSA 2PT1A 4H0WA 4KCCA 3SEUA 5TU0A 2PT2A 4POXA 1P1WA 4RYAA 3CR9A 4TQUQ 1FTJA 1B7UA 5EQ8A 4PFBA 4FJPA 4MH5A 1I69A 1M5DA 3OO8A 1DTGA 1US5A 1NUYA 1NUXA 1MXZA 3ILTB 3PGFA 4PCDA 2DDKA 2OLBA 3C34A 2DVCA 1MQJA 2Q88A 1A40A 1IEJA 1NFTA 3TCHA 3AXFA 3MP6A 4ESXA 5AA2A 3FATA 4NX1A 1GR2A 4MCOA 5DYHA 1N7WA 3IO4A 3M3LA 4DI3D 3PTYA 3LUZA 4K3FA 3IL1B 3A29A 3MVWA 3BFUA 1Y4CA 2GRVA 2UYFA 4JXIA 3PV0E 4NF4A 5IZ3B 1SDXA 4F31B 2QS2A 3IB0A 3PPNA 4NF6B 4RY1A 4I9DA 2VPNA 1RYOA 1NV5A 3U92A 3Q25A 4TLMB 1T0KA 1JEVA 2V4CA 2F34A 3Q28A 3OXNA 3S4UA 5H8HB 3PU5A 4ZZEA 2B4LA 4OZ9A 1JW1A 2XX9A 3W15C 1POTA 3UORA 4AS4A 4F3SA 3H7MA 3FXQA 3T9HB 2ZYOA 4FATA 1A99A 1FPEA 3HN0A 3N26A 3W9WA 1KA1A 3TZAA 4U4XA 3OMBA 4YKIA 4HTGA 4NE4A 4NG7A 3T93B 3RPWA 4QSDA 1FQDA 3V5AA 1SW2A 3IJXB 4BDNA 1OMPA 3RNNA 3HSTA 4OTEA 4GWWA 1B7HA 3K6UA 5H8HA 4KYSA 1LBVA 1XVYA 3O29A 1SBPA 3QAXA 3H6WA 3NOHA 3VXCA 3DP6A 4DDDA 3IJOB 1QUJA 3N6TA 3QUJA 5I3SA 1OVBA 1N76A 4IO2A 1VFDA 1FRPA 3QUFA 4XKNA 3EKIA 4KR5A 3ZKLA 5ITPA 1NV3A 2OBGA 3JV9A 4H46A 1FQFA 4MLQA 4I3EA 2QVRA 2O1MA 1IMAA 3UK4A 4OENA 2V3UA 3KG2A 3FV1A 2CEXA 3VDFA 3IFAA 5JTYB 2F35A 1POY1 2MKZA 1RDYA 2FA7A 3K1MA 3K6VA 2BJIA 1D9VA 1Y3NA 4H8IA 3C36A 2CZIA 3SEWA 3C33A 3MW0A 3MWBA 4N6KA 5EQ7A 1NNPA 4NEDA 3LSWA 2REJA 3HPIA 2XWIA 3FXRA 3TCGA 2ZZVA 5DVFA 4IY5A 1ZU0A 3CI8A 3D1RA 4O7MA 1WVJA 1MH3A 4Q30B 4PFIA 4P1LA 5JTYA 2H9BA 3FJ7A 2BJJX 3TDJA 4MIJA 1SVXB 3U72A 5I58B 2HXWA 4GLIA 5LTCA 2VPOA 4BDLA 4H6DA 4OVQA 4Z0IA 1DOTA 4PGNA 4TOZA 3DM0A 4O7IA 3EN3A 4XIGQ 2Y7RA 4RJZA 2HZLA 3LSLA 4YMBA 2B65A 2O84X 1B6HA 4M1VA 3K4UA 4PC9A 1LFGA 4EQ7A 1SW1A 1SPIA 3IR1A 4MLVA 1OLAA 2RKMA 1AL3A 3L6GA 1FTLA 1MQGA 4HE1A 5I7IA 5TPAB 3G3JA 4N8YA 4XFEA 4DCYA 1MPCA 3S9LC 4F1YA 1GVCA 3JYRA 5IKBA 3D4CA 1YTVA 1FTAA 3CRBA 4OWDA 1NL5A 1OQHA 1H3DA 4OETA 5I58A 2E0SA 2M8CA 4JVDA 4LUBA 3OEMA 3MBPA 4XTCQ 2PBWA 3KOTA 3PMVA 4O3AA 1B3GA 3VLUA 5ET8A 3Q29A 5AA4A 3R6UA 1B2HA 4POWA 4H5GA 1EZ9A 3B6QA 4YB6A 4GBVA 3CG1A 1IZ1A 2QMXA 1PB7A 3KFMA 4FBPA 2RCBA 3MSTA 4LVQA 3RT8A 1A54A 4F29A 5TPAA 2X7PA 1QUKA 2I3WA 3K01A 4LZ8A 2E1SA 4ZEBA 2Q89A 4LATA 4Q5TA 2B3FA 1XOCA 4G8NA 4R75A 3MAMA 3SESA 2QPQA 4F19A 4GWXA 2O1LA 1URGA 3KC1A 4KPTA 4HE0A 4HE2A 3PPPA 3TEPA 1A8FA 5A5XB 4EQ9A 5ICTA 5ET7A 1FJ6A 5I57B 2REGA 4O3CA 1P1UA 3MP8A 4XKRA 1B4HA 3HCQA 2VD2A 4GWZA 5KDTA 3H6UA 2I58A 4QFNA 3WAEA 5I2KB 1VR5A 4JWYA 4PAFA 3FD3A 2PX1A 4I62A 4FORA 4I1DA 4YICA 4G68C 1FTOA 1B0LA 5DVJA 2ABHA 5EYGA 1N3XA 4O3BA 1AWBA 3VFJA 3HO7A 3MPKA 3O28A 4LZ5A 4DCXA 3UIFA 4KCDA 4U21A 3S2VA 3IO6A 4ZEFA 4IR8A 2Z22A 3MVZA 5H8NB 1FPBA 5HBCA 1K9ZA 2Y7KA 1G0HA 1PEBA 1TXFA 1S50A 4IO6A 4FEDA 2Y7PA 3UN6A 1DK4A 1R6ZA 4R9FA 3RYDA 2VD3A 4IY6A 1R1NA 5I2KA 1BK4A 2XXRA 5FHNA 4IO3A 2QVVA 2G29A 3T1BA 2F3BA 4R72A 3RTWB 4BDOA 3VLVA 2R6GE 3O2AA 3PPOA 1EYKA 3SEXA 1PB8A 2HHMA 3VV5A 3LSFB 2P2AA 3T9XB 3FASA 3BBRA 3Q27A 5H8NA 3CFZA 5I56B 3G3GA 3UA8A 4R6YA 3LC8A 1B5JA 4OFOA 3B6TA 2GQ1A 4YB7A 3IOTA 1FQCA 1YPNA 1IXIA 3PD8A 4OANA 3LR1A 3HFUA 1MM7A 2OWZA 3G3KA 2P0SA 2VP1A 1MXVA 3IB2A 1D9YA 4PP0A 3SEVA 1IXGA 3FJGA 2AYSA 4Z7EA 4TLLB 4KFQA 2ONSA 1LAGE 4ZDMA 1JW4A 4EF2A 4NF5B 4R6HA 2ESNA 2F6GA 3IORA 3T96B 1B3LA 1MG1A 2P3NA 4PE3A 2KQZA 2QJEA 2DOJA 3E4RA 3GLBA 4DI4B 3RN8A 1B7ZA 2VT5A 1LSTA 3O6HA 4WEDA 1UIUA 3FJMA 2F8DA 3E79A 4N81A 1MY3A 2X7QA 3PUVE 1MY0A 4WEPA 2OK2A 4PQJA 1LB8A 3PUWE 4QSCA 1LBCA 4HCYA 2I4CA 1IXCA 3TPAA 3VLWA 1TWYA 2ONKE 5IAIA 2XXXA 1P1NA 3B50A 4EXKA 1XT8A 4OVSA 1MQHA 1P1QA 1ZLQA 1BKAA 2B3BA 2VGQA 3KJ7A 3KEIA 4LZ7A 1MM6A 2B4MA 1Z7NE 4FEBA 3KN8A 4F1UA 3KZGA 1FPKA 3V89B 5IGAA 1NV7A 4NHBA 4PFWA 4PTKA 3GXAA 2H99A 3S9NC 1FSAA 2H25A 1DPEA 5L9SA 3ZSFA 1YCJA 1JW5A 3H6TA 1GGGA 3IOWA 3PUYE 4BLAA 1EYJA 5H8FA 3E13X 5EQAA 3K02A 5AE4A 3T9VA 3TCFA 2I0CA 3TODA 2H5YA 1IXHA 4YZZA 5L9OA 1FBPA 1I6BA 1IUDA 5ET5A 2Q8JA 2XA5A 3LUYA 2WBBA 2LAOA 3TQWA 4NN3A 4C1TA 4KQPA 4MNCA 4NWDA 1YAEA 4JSOA 2VHAA 5JK4A 2DS9A 2QS1A 1FBEA 3KBRA 5EHMA 1P1OA 5BWJA 1H44A 2F6PA 3QK6A 2WYPA 5EHSA 1QULA 1N0TA 2CEYA 3E3KA 3FVOA 1FW0A 5M2VA 4BDQA 5EYHA 1UIVA 1N3WA 2NXOA 5IZ3A 1MQIA 4OQOA 4RK9A 2ZMBA 2FBPA 4NF6A 4ELRA 4PFTA 3RPLB 2OCUA 4QF9A 4F18A 3H6VA 1LLSA 1MXWA 4G77A 5AA1A 4BDRA 5CBRA 1JQFA 1VFEA 4ELPA 1FJ9A 4UA8A 1XS5A 3M3FA 1B3EA 1UTHB 2KLFA 2IA4A 4C1UA 3KBZA 3F11A 5AA3A 1IMBA 4AQ4A 1Y20A 4PF6A 3PMWA 1LAXA 2A5SA 2XD2A 4PF8A 2I48A 2O7UA 4ZEIA 1I6QA 4I40A 4MAGA 1EZOA 3H06B 1MS7A 1NKXA 2XXWA 2H4IA 2O51A 2XWOA 3OSRA 4YKJA 3FUZA 4ZE9A 5CMKA 5FHOA 5CRYA 3SERA 3G3IA 1A8EA 4PFUA 2FHYA 1UQWA 4XXUA 3CG3A 4NAPA 1KWHA 2ONRA 3O9PA 4OESA 4X9TA 2CMOA 4ELQA 5CI5A 4P3LA 4PBQA 5DTBA 1KZ8A 1AMFA 2XXPA 5F24A 3MVXA 3LSXA 1NUWA 3V8XB 4N17A 2XXYA 5CMCA 3FIRA 3U8QA 3IK6B 1LBZA 3FXBA 1O64A 1O63A 3K2DA 1ANFA 3JZJA 4YB5A 3H3GA 1DMBA 2ZXTA 1K9YA 3OOAA 2UVIA 3EHTA 2UYEA 4DLDA 5I5PA 2I3VA 3TMGA 2V3TA 3K6WA 1QW0A 1MXUA 4P11A 1IIWA 4P1EA 2GFEA 4U1OA 4XEQA 3G3FA 1EH3A 3EHSA 4JVIA 2ZYKA 1MH4A 4QBAA 1NNFA 3DELB 3RT6B 2F7AA 4X1BA 1AIVA 1Y3QA 3SDFA 1MDP1 1N84A 2CZKA 3P7IA 4F3GA 2D21A 2FVZA 4GWYA 2RINA 4P0GA 5DEXB 4NF0A 1DSNA 2I0BA 3O66A 4U22A 4MNPA 3U93A 3K1NA 3R26A 4JWXA 4THIA 1LBYA 1UTBB 4QXDA 2Y5LA 3S9MC 4PFYA 2KR0A 4P56A 4PBHA 2Q74A 2THIA 4G68B 1NUZA 2AL5A 2O6AA 3PD9A 4P8BA 2AIXA 1B1HA 3PPRA 4N13A 3RUMA 4YKPA 4MMPA 4GF8A 5DVIA 3B6WA 2Z23A 3GZGA 3PMXA 3MZBA 4Q8RA 1MQDA 2ZZXA 4HW8A 5DEXA 4OVRA 2XX7A 4BDMA 5B7DA 1YZ0A 2W7YA 3QMFA 1UTBA 3OEKA 2ZZWA 2CZLA 3WAFA 4EQBA 3C35A 4G68A 1USYH 1H43A 4RK2A 3UGWA 1INPA 1PBQA 1HSLA 2DXYA 2R8TA 4GOTA 4DZ1A 3KN3A 4MHFA 4QFLA 4OFLA 4OVTA 1A7LA 4L17A 4MEVA 1MDQA 5IM2A 4E0XA 3Q26A 4EUOA 5HM4B 4MBPA 2DE4A 1B3HA 3N94A 4GFRA 3FVGA 3GYYA 2G93A 2IEEA 4KD5A 4H45A 1ZBMA 3OD7A 1WODA 3BFTA 2D5WA 4GX3A 4PE5B 3CVGA 1LCTA 3BKIB 3ECRA 1FCKA 4U2RA 3FBPA 4R2FA 3MC2A 1NMUA 4P47A 1Z7ME 4OERA 3KJTA 3D4GA 2GHAA 1BP5A 3IOVA 1LCFA 1D9QA 4MF3A 4ONYA 2I4BA 4GXSB 2XHDA 3MPLA 1FQEA 4GXAA 5A5XA 2GHBA 2Y7IA 1M5BA 4U4SA 3H4ZA 1PC3A 5I57A 2YJPA 4GD5A 3PPQA 5FHMA 3EPEA 3KC0A 5I59B 2V84A 4KI0E 1JP4A 4GWOA 2WKYA 1MY4A 1SQYA 4NQ8A 2NWJA 4IO4A 2YPNA 5CM6A 5K2XA 1B51A 2XXIA 1URSA 1VSOA 5F1QA 2OX3A 2DP8A 2Q8MA 4FE8A 2OZZA 3G3HA 5T3JA 4F39A 1RKMA 4R73A 1LAFE 1L5TA 3MZ1A 3TKDA 5TP9B 2R9JA 5EYFA 4X04A 4ZECA 3GBBA 2DWHA 3VXBA 2XXHA 3KOSA 3KSXA 4E0WA 4F22A 4OXVA 1B58A 2F97A 2XX8A 3DLNA 3TTLA 4U23A 5ISUA 1Q9DA 3K1PA 5ITOA 2OJTA 2OWTA 5H8SA 3IB1A 3CIJA 3RY3A 1B40A 4H67A 2XXVA 3TYHA 3E9XA 4FECA 4DE8A 2DQVA 3C32A 3ODBA 1LBWA 4RPNA 5I56A 5DT6A 2OPDA 4FIMA 1G0IA 3FVKA 2L5VA 1EU8A 2HZKA 1NV6A 3B8BA 4P9KA 3TAJA 4HCWA 4XF5A 1OLCA 2HFBA 3BIGA 2DE3A 2HPGA 1N04A 3SETA 4F3PA 3M3KA 1J1NA 1AOVA 4OFJA 4ZEDA 4NF5A 1B32A 3B7DA 1B5IA 1OVTA 1TFDA 2Z8DA 5ET6A 3G7WA 1B05A 3EHUA 1Y4TA 3FV2A 5KZTA 1FPIA 4QHQA 2A5TB 3QIMA 4ELOA 1ZJLA 4NF4B 4QSEA 3ROJA 4AS5A 2XXUA 1OIBA 3TQLA 4PETA 1Q35A 3C31A 4G2ZA 5HPQA 4G61A 2DSFA 3QYTA 1EZPA 4OMBA 2PFYA 4EDPA 5I84A 5ESYA 3OO9A 1LB9A 2FYIA 5J16A 3CHGA 3VVFA 4U1ZA 3RLFE 3E78A 2QMWA 1LBBA 1ZIUA 3LV0A 1LFHA 1MY1A 2UVJA 4IGRA 1NH7A 1DBZA 4RXLA 1FPDA 1US4A 2PMSA 1FBDA 3VVEA 4AB5A 3FGSA 3O97A 4LA9A 4JVCA 4OYVA 1IQ7A 4PDDA 1SW4A 2ANJA 4R74A 2A5TA 3H03A 4PAKA 3SKPA 4MFIA 2QSXA 5L8DA 4DXUA 2XWKA 2ALUA 4WXJA 1ZTYA 3C4MA 3MUQA 2QL3A 1QKBA 4MX6A 1GV8A 1QGXA 3IAZA 4Q0CA 4ZEKA 1FBFA 1LFIA 4R2BA 1B46A 5KCJB 2VOZA 2ZYNA 2F5XA 2FIXA 2H98A 3PUZE 3ZKKA 4PDHA 1M5EA 1LEVA 1LBXA 2FNCA 1LAHE 4KYEA 4N07A 1FBCA 1FTMA 3ILUB 3O6IA 1F9BA 1QUIA 4LQ2A 5ELVA 1IMDA 1B52A 4PGPA 3OENA 1VE4A 2P1SA 1ELJA 1DTZA 3OO7A 1FBGA 1FQBA 2I49A 5CMBA 1BLFA 3A3UA 2Z8FA 4NGUA 4KXPA 3CSGA 2GH9A 1IMFA 4KHZE 2HCAA 1Y1ZA 4YMAA 3T0JA 1SYHA 4PFRA 4IB2A 1JVYA 5KCJA 2Z8EA 4G8HA 2ZYMA 1FPJA 3OSQA 4OVPA 3N5LA 1CE2A 2HEUA 1YYZA 5H8QB 3RPLA 4H8JA 4JSDA 3HV1A 1NNTA 3ZS6A 4JB7A 4RNSA 3GBAA 4UABA 3ONMA 4N8GA 4N6DA 1B5HA 2UVGA 4H65A 2DWIA 2Q2AA 1M5CA 3FZVA 3U1OA 3RQTA 1UTHA 2R71A 3PUXE 4ESWA 3CFXA 1R9QA 2XXKA 2PVUA 4LP2B 1NV1A 4O94A 1XVXA 2QS3A 5FBPA 2NUVA 2AL4A 3TTKA 2RF1A 2HAUA 4RPOA 3VE1B 3DP4A 1JEUA 4OHNA 4OA4A 3TTRA 4X48A 4NWCA 5H8QA 1QJMA 4X8RA 2JJKA 2HAVA 2YLNA 3RTFB 4YAHX 5DW8A 4N15A 4LONB 1M5FA 1N7XA 3O6GA 1NV0A 4NF8B 1Y1MA 2QVUA 4N91A 4JBZA 4JDFA 1JNFA 3L6HA 3CSBA 1CB6A 2F36A 4KYDA 1D3KA 2ZNUA 4ISUA 1XI6A 1GTKA 5JEIA 1RDZA 5EQ9A 2QS4A 2X26A 4GWSA 3TFLA 1PBPA 4OEUA 1WDNA 3TELA 1FPFA 2WBDA 1MRPA 2NVUB 3FVNA 5AA4B 4YKKA 4QRZA 1BIYA 1Y9UA 3TUSA 1YXIA 2F7BA 2HQ0A 3T22A 1MXXA 3ISPA 2O69A 2V3QA 1SW5A 2OWSA 4NF8A 3I6VA 4F2OA 3HHFA 3IX1A 3KN7A 3EF7A 1NNKA 2NOOA 4DXBA 3QXMA 3T9UA 1JETA 3K0VA 1BTJA 4ND9A 2O7IA 1CNQA 3CFLA 4NTLA 2FIEA 1NV4A 2Y7WA 2ZNTA 4GBWA 2XWVA 2O68A 1S9TA 4EF1A 1AH5A 3MJNA 2QFLA 4FAJA 3K6XA 3U94A 4ZE8A 1LGBC 3KGCA 5I2NB 3I5OA 5FTHA 3R7XA 4GX6A 2WYKA 2QRYA 4GL8A 3UP9A 3N6UA 5FTIA 3RGYA 5J1DA 3C9HA
chains in the Genus database with same CATH topology
2XA5A 2WBBA 4NN3A 2CZIA 4MNCA 4N6KA 4N4UA 4LN5A 5JK4A 5EQ7A 1FBEA 2XWIA 4F1VA 2ZZVA 1Q9DA 3D1RA 4GWUA 2WYPA 4O7MA 3U65A 1FBHA 2CEYA 4PFIA 4P1LA 4MIJA 5LTCA 2VPOA 5EYHA 4OVQA 1LBWA 5IZ3A 4PGNA 2FBPA 4O7IA 1G0IA 2HZLA 3RPLB 2L5VA 4F18A 2WX9A 2HZKA 1NV6A 2PCRA 4M1VA 4PC9A 3B8BA 4P9KA 1SPIA 5IZZA 4HCWA 4XF5A 3BIGA 1FJ9A 2DE3A 2HPGA 4HXVA 4HE1A 5I7IA 3KBZA 3IFCA 4N8YA 5IZ1A 4XFEA 1IMCA 1EYIA 1IMBA 1FTAA 5ET6A 1NI9A 4PF6A 4PAIA 1FPIA 4PF8A 4JVDA 3ROJA 4AS5A 2WEFA 4PETA 4I40A 4G61A 4MAGA 2PFYA 5ESYA 5ET8A 5J16A 3CHGA 2XWOA 3E78A 4GBVA 3LV0A 4FBPA 1DBZA 3MSTA 1FPDA 3SZPA 2FHYA 3BIHA 4O8MA 4NAPA 1FBDA 4JVCA 2HXRA 4PDDA 4X9TA 2CZHA 4P3LA 4PBQA 1KZ8A 4PAKA 5F24A 1NUWA 1FPLA 2P3VA 4N17A 2Q9TA 2QPQA 1LBZA 4F19A 4GWXA 2XWKA 3FXBA 2DE2A 3KC1A 4HE0A 4HE2A 2Y5KA 4MX6A 1QGXA 1K9YA 1NV2A 2DVZA 1FBFA 1FJ6A 5ET7A 3MYUA 5I5PA 2F5XA 2FIXA 4P1EA 2F3DA 1IMEA 4PDHA 4XEQA 1LEVA 1LBXA 4JVIA 4GWZA 1FBCA 4QBAA 1VDWA 1IMDA 4PAFA 4GX4A 1DCUA 4PGPA 4YICA 2CZKA 4MJOA 5EYGA 5A5LA 1FBGA 1FPGA 5LDZA 1AWBA 2FVZA 4GWYA 4NGUA 4KXPA 1IMFA 4MNIA 4NF0A 3W9VA 3T0JA 2PFZA 4MNPA 4I3YA 1KA0A 1RDXA 1LBYA 4PFRA 4QXDA 2Y5LA 4IR8A 2KR0A 1FPBA 4P56A 1K9ZA 4PBHA 1FPJA 1G0HA 2Q74A 1NUZA 4OVPA 5EQ8A 4PFBA 1YYZA 3RPLA 1DK4A 4P8BA 1NUYA 3RYDA 1NUXA 4PCDA 2DDKA 4UABA 1BK4A 4N8GA 4N6DA 4MMPA 2QVVA 3T1BA 2F3BA 4NX1A 2ZZXA 4MCOA 2XXKA 4DI3D 1EYKA 3PTYA 3LUZA 4OVRA 1NV1A 4O94A 3A29A 5FBPA 2HHMA 1YZ0A 3QMFA 2ZZWA 5IZ3B 4OA4A 2VPNA 1INPA 2R8TA 2GQ1A 1NV5A 4X8RA 2JJKA 4MHFA 4OVTA 4MEVA 5DW8A 4OANA 2V4CA 4N15A 5IM2A 3HFUA 2OWZA 2DE4A 3GYYA 2B4LA 1NV0A 2QVUA 4N91A 4AS4A 4H45A 2P3NA 1FPEA 4PE3A 2KQZA 4GX3A 3W9WA 1KA1A 1XI6A 4DI4B 3FBPA 2VT5A 1RDZA 5EQ9A 4P47A 4GWSA 3E79A 4NG7A 4N81A 1FPFA 1D9QA 2WBDA 4HCYA 3B50A 4OVSA 4GWWA 1YXIA 1LBVA 3ISPA 2V3QA 3KC0A 3NOHA 1JP4A 2B4MA 2BJIA 5I3SA 4F1UA 1FPKA 1FRPA 5IGAA 1NV7A 4NQ8A 4NHBA 4PTKA 3EKIA 1FSAA 1CNQA 5CM6A 1NV3A 4H46A 4I3EA 2QVRA 1IMAA 2FIEA 1NV4A 4GBWA 2XWVA 2OX3A 2Q8MA 2CEXA 1EYJA 2QFLA 5T3JA 3IFAA 5EQAA 2MKZA 1RDYA 4GX6A 4YZZA 2WYKA 1FBPA 5J1DA 5ET5A 4X04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVZ A;  2WBB A;  4GWY A;  4AS4 A;  4I40 A;  4G61 A;  4KXP A;  4H45 A;  2CZI A;  1IMF A;  2P3N A;  1FPE A;  5ET8 A;  5ESY A;  3T0J A;  4GX3 A;  4I3Y A;  5J16 A;  1KA0 A;  1RDX A;  1KA1 A;  1XI6 A;  5EQ7 A;  1LBY A;  1FBE A;  3FBP A;  4QXD A;  2VT5 A;  2Y5L A;  4GBV A;  3LV0 A;  1RDZ A;  4IR8 A;  5EQ9 A;  1FPB A;  1K9Z A;  4FBP A;  1FPJ A;  1G0H A;  4GWS A;  2Q74 A;  1NUZ A;  1DBZ A;  1FPD A;  4N81 A;  5EQ8 A;  1Q9D A;  2FHY A;  1FPF A;  3BIH A;  1D9Q A;  2WBD A;  1YYZ A;  1FBD A;  3D1R A;  3RPL A;  1DK4 A;  4GWU A;  1NUY A;  3RYD A;  1FBH A;  1NUX A;  2DDK A;  1BK4 A;  2CZH A;  4GWW A;  1YXI A;  1KZ8 A;  2QVV A;  5F24 A;  1NUW A;  1LBV A;  1FPL A;  2P3V A;  5EYH A;  3KC0 A;  1LBW A;  2F3B A;  5IZ3 A;  2FBP A;  1LBZ A;  4O7I A;  1JP4 A;  4GWX A;  1G0I A;  3RPL B;  1EYK A;  3LUZ A;  3KC1 A;  1NV1 A;  4HE0 A;  4HE2 A;  2Y5K A;  3A29 A;  5I3S A;  5FBP A;  2HHM A;  1FPK A;  1NV6 A;  2PCR A;  1QGX A;  1K9Y A;  1YZ0 A;  3B8B A;  1FRP A;  1NV2 A;  3QMF A;  1SPI A;  1NV7 A;  4PTK A;  1FBF A;  1FJ6 A;  3BIG A;  5ET7 A;  1FSA A;  1FJ9 A;  1CNQ A;  1NV3 A;  4HXV A;  4H46 A;  5IZ3 B;  4I3E A;  2FIX A;  2QVR A;  1IMA A;  2FIE A;  1NV4 A;  2F3D A;  1IME A;  4HE1 A;  1INP A;  4GBW A;  2R8T A;  3KBZ A;  2GQ1 A;  1NV5 A;  3IFC A;  1LEV A;  1LBX A;  2JJK A;  1IMC A;  1EYI A;  2OX3 A;  5IZ1 A;  4GWZ A;  2Q8M A;  1IMB A;  1FBC A;  1FTA A;  5ET6 A;  5DW8 A;  1NI9 A;  1VDW A;  1EYJ A;  2QFL A;  5T3J A;  1IMD A;  3IFA A;  4GX4 A;  5EQA A;  1DCU A;  1FPI A;  2OWZ A;  1RDY A;  4GX6 A;  2CZK A;  4MJO A;  3ROJ A;  4AS5 A;  5EYG A;  1FBP A;  5A5L A;  1FBG A;  1FPG A;  2WEF A;  1NV0 A;  5ET5 A;  2BJI A;  5LDZ A;  2QVU A;  1AWB A; 
#chains in the Genus database with same CATH topology
 2F78 A;  4QFP A;  3V83 A;  5KDT B;  4OEV A;  4N4U A;  4LN5 A;  5B70 A;  1QVS A;  3IOU A;  4ZS9 A;  4ECF A;  5CC2 A;  4JWO A;  4F1V A;  1B4Z A;  1DPP A;  4N6P A;  3THI A;  4AB6 A;  1B1X A;  4GWU A;  3U65 A;  1FBH A;  1ZKB A;  1PDA A;  1MPB A;  4IGT A;  5I2N A;  1FQA A;  1HSJ A;  4EXL A;  1RYX A;  4OVJ A;  1PB9 A;  1O7T A;  2PYY A;  2Y84 A;  5LOM A;  4GL0 A;  4UAC A;  3A3C A;  1H76 A;  3M8U A;  4GIZ A;  1TFA A;  3HHG A;  2WX9 A;  2PCR A;  1ZMG A;  5F7V A;  1NH8 A;  2UXA A;  3K00 A;  1USY E;  2V93 A;  1QKA A;  5IZZ A;  1SI1 A;  1URD A;  4HXV A;  1B9J A;  1MXY A;  2UVH A;  3T66 A;  3IFC A;  5IZ1 A;  1IMC A;  1EYI A;  1IIT A;  3A09 A;  1NI9 A;  4LQ5 A;  1SI0 A;  4H1X A;  4PAI A;  4XKP A;  1B0H A;  1Q1K A;  3VVD A;  4M4G A;  4R9G A;  4DXC A;  2WEF A;  4F2Q A;  4WKM A;  1B3F A;  4ZZA A;  1HSE A;  1Y3P A;  1II5 A;  3I3V A;  2Q2C A;  4F3B A;  3LBS A;  2RC7 A;  4DIG A;  3EQ1 A;  5I59 A;  3SZP A;  4GVO A;  3BIH A;  4O8M A;  2RC8 A;  2DWA A;  5CBS A;  2HXR A;  5AA2 D;  2DYX A;  2XXT A;  4QFK A;  2CZH A;  3MZ9 A;  4H5F A;  2D3I A;  1OQG A;  1P99 A;  4P0I A;  1I6A A;  1FPL A;  2P3V A;  2XXQ A;  4R6K A;  2Q9T A;  4RA1 A;  3MQ9 A;  1SD3 A;  4IO5 A;  4QFO A;  2XD3 A;  2DE2 A;  3KSJ A;  1S7Y A;  2Y5K A;  4GRK A;  5BUU A;  2DWJ A;  1H45 A;  4HS7 A;  1NV2 A;  3FXU A;  1FTK A;  2RCA A;  4XKQ A;  2DVZ A;  3MYU A;  2OPE A;  2RC9 A;  5ICQ A;  5TP9 A;  3DP8 A;  4NMY A;  1A55 A;  2V25 A;  1SYI A;  3MP1 A;  2F3D A;  1IME A;  3TTN A;  1R9L A;  1ATG A;  3SEY A;  3USD A;  3MVY A;  4G8M A;  1VDW A;  4C0R A;  1MY2 A;  1D4N A;  4X1D A;  4GQO A;  4GX4 A;  4YU0 A;  1DCU A;  1JVX A;  5CMM A;  4IO7 A;  4MJO A;  5L9M A;  1MPD A;  5AA2 B;  5A5L A;  2DXR A;  1FPG A;  5LDZ A;  3OO6 A;  4G4P A;  3OEL A;  3TTM A;  4MNI A;  2I6E A;  3W9V A;  4I8C A;  1TT1 A;  2PFZ A;  5H8F B;  4I3Y A;  1XC1 A;  3S9E A;  1XHY A;  1KA0 A;  3QSL A;  1RDX A;  2F7C A;  5K2Y A;  2ZNS A;  2PT1 A;  4H0W A;  4KCC A;  3SEU A;  5TU0 A;  2PT2 A;  4POX A;  1P1W A;  4RYA A;  3CR9 A;  4TQU Q;  1FTJ A;  1B7U A;  5EQ8 A;  4PFB A;  4FJP A;  4MH5 A;  1I69 A;  1M5D A;  3OO8 A;  1DTG A;  1US5 A;  1NUY A;  1NUX A;  1MXZ A;  3ILT B;  3PGF A;  4PCD A;  2DDK A;  2OLB A;  3C34 A;  2DVC A;  1MQJ A;  2Q88 A;  1A40 A;  1IEJ A;  1NFT A;  3TCH A;  3AXF A;  3MP6 A;  4ESX A;  5AA2 A;  3FAT A;  4NX1 A;  1GR2 A;  4MCO A;  5DYH A;  1N7W A;  3IO4 A;  3M3L A;  4DI3 D;  3PTY A;  3LUZ A;  4K3F A;  3IL1 B;  3A29 A;  3MVW A;  3BFU A;  1Y4C A;  2GRV A;  2UYF A;  4JXI A;  3PV0 E;  4NF4 A;  5IZ3 B;  1SDX A;  4F31 B;  2QS2 A;  3IB0 A;  3PPN A;  4NF6 B;  4RY1 A;  4I9D A;  2VPN A;  1RYO A;  1NV5 A;  3U92 A;  3Q25 A;  4TLM B;  1T0K A;  1JEV A;  2V4C A;  2F34 A;  3Q28 A;  3OXN A;  3S4U A;  5H8H B;  3PU5 A;  4ZZE A;  2B4L A;  4OZ9 A;  1JW1 A;  2XX9 A;  3W15 C;  1POT A;  3UOR A;  4AS4 A;  4F3S A;  3H7M A;  3FXQ A;  3T9H B;  2ZYO A;  4FAT A;  1A99 A;  1FPE A;  3HN0 A;  3N26 A;  3W9W A;  1KA1 A;  3TZA A;  4U4X A;  3OMB A;  4YKI A;  4HTG A;  4NE4 A;  4NG7 A;  3T93 B;  3RPW A;  4QSD A;  1FQD A;  3V5A A;  1SW2 A;  3IJX B;  4BDN A;  1OMP A;  3RNN A;  3HST A;  4OTE A;  4GWW A;  1B7H A;  3K6U A;  5H8H A;  4KYS A;  1LBV A;  1XVY A;  3O29 A;  1SBP A;  3QAX A;  3H6W A;  3NOH A;  3VXC A;  3DP6 A;  4DDD A;  3IJO B;  1QUJ A;  3N6T A;  3QUJ A;  5I3S A;  1OVB A;  1N76 A;  4IO2 A;  1VFD A;  1FRP A;  3QUF A;  4XKN A;  3EKI A;  4KR5 A;  3ZKL A;  5ITP A;  1NV3 A;  2OBG A;  3JV9 A;  4H46 A;  1FQF A;  4MLQ A;  4I3E A;  2QVR A;  2O1M A;  1IMA A;  3UK4 A;  4OEN A;  2V3U A;  3KG2 A;  3FV1 A;  2CEX A;  3VDF A;  3IFA A;  5JTY B;  2F35 A;  1POY 1;  2MKZ A;  1RDY A;  2FA7 A;  3K1M A;  3K6V A;  2BJI A;  1D9V A;  1Y3N A;  4H8I A;  3C36 A;  2CZI A;  3SEW A;  3C33 A;  3MW0 A;  3MWB A;  4N6K A;  5EQ7 A;  1NNP A;  4NED A;  3LSW A;  2REJ A;  3HPI A;  2XWI A;  3FXR A;  3TCG A;  2ZZV A;  5DVF A;  4IY5 A;  1ZU0 A;  3CI8 A;  3D1R A;  4O7M A;  1WVJ A;  1MH3 A;  4Q30 B;  4PFI A;  4P1L A;  5JTY A;  2H9B A;  3FJ7 A;  2BJJ X;  3TDJ A;  4MIJ A;  1SVX B;  3U72 A;  5I58 B;  2HXW A;  4GLI A;  5LTC A;  2VPO A;  4BDL A;  4H6D A;  4OVQ A;  4Z0I A;  1DOT A;  4PGN A;  4TOZ A;  3DM0 A;  4O7I A;  3EN3 A;  4XIG Q;  2Y7R A;  4RJZ A;  2HZL A;  3LSL A;  4YMB A;  2B65 A;  2O84 X;  1B6H A;  4M1V A;  3K4U A;  4PC9 A;  1LFG A;  4EQ7 A;  1SW1 A;  1SPI A;  3IR1 A;  4MLV A;  1OLA A;  2RKM A;  1AL3 A;  3L6G A;  1FTL A;  1MQG A;  4HE1 A;  5I7I A;  5TPA B;  3G3J A;  4N8Y A;  4XFE A;  4DCY A;  1MPC A;  3S9L C;  4F1Y A;  1GVC A;  3JYR A;  5IKB A;  3D4C A;  1YTV A;  1FTA A;  3CRB A;  4OWD A;  1NL5 A;  1OQH A;  1H3D A;  4OET A;  5I58 A;  2E0S A;  2M8C A;  4JVD A;  4LUB A;  3OEM A;  3MBP A;  4XTC Q;  2PBW A;  3KOT A;  3PMV A;  4O3A A;  1B3G A;  3VLU A;  5ET8 A;  3Q29 A;  5AA4 A;  3R6U A;  1B2H A;  4POW A;  4H5G A;  1EZ9 A;  3B6Q A;  4YB6 A;  4GBV A;  3CG1 A;  1IZ1 A;  2QMX A;  1PB7 A;  3KFM A;  4FBP A;  2RCB A;  3MST A;  4LVQ A;  3RT8 A;  1A54 A;  4F29 A;  5TPA A;  2X7P A;  1QUK A;  2I3W A;  3K01 A;  4LZ8 A;  2E1S A;  4ZEB A;  2Q89 A;  4LAT A;  4Q5T A;  2B3F A;  1XOC A;  4G8N A;  4R75 A;  3MAM A;  3SES A;  2QPQ A;  4F19 A;  4GWX A;  2O1L A;  1URG A;  3KC1 A;  4KPT A;  4HE0 A;  4HE2 A;  3PPP A;  3TEP A;  1A8F A;  5A5X B;  4EQ9 A;  5ICT A;  5ET7 A;  1FJ6 A;  5I57 B;  2REG A;  4O3C A;  1P1U A;  3MP8 A;  4XKR A;  1B4H A;  3HCQ A;  2VD2 A;  4GWZ A;  5KDT A;  3H6U A;  2I58 A;  4QFN A;  3WAE A;  5I2K B;  1VR5 A;  4JWY A;  4PAF A;  3FD3 A;  2PX1 A;  4I62 A;  4FOR A;  4I1D A;  4YIC A;  4G68 C;  1FTO A;  1B0L A;  5DVJ A;  2ABH A;  5EYG A;  1N3X A;  4O3B A;  1AWB A;  3VFJ A;  3HO7 A;  3MPK A;  3O28 A;  4LZ5 A;  4DCX A;  3UIF A;  4KCD A;  4U21 A;  3S2V A;  3IO6 A;  4ZEF A;  4IR8 A;  2Z22 A;  3MVZ A;  5H8N B;  1FPB A;  5HBC A;  1K9Z A;  2Y7K A;  1G0H A;  1PEB A;  1TXF A;  1S50 A;  4IO6 A;  4FED A;  2Y7P A;  3UN6 A;  1DK4 A;  1R6Z A;  4R9F A;  3RYD A;  2VD3 A;  4IY6 A;  1R1N A;  5I2K A;  1BK4 A;  2XXR A;  5FHN A;  4IO3 A;  2QVV A;  2G29 A;  3T1B A;  2F3B A;  4R72 A;  3RTW B;  4BDO A;  3VLV A;  2R6G E;  3O2A A;  3PPO A;  1EYK A;  3SEX A;  1PB8 A;  2HHM A;  3VV5 A;  3LSF B;  2P2A A;  3T9X B;  3FAS A;  3BBR A;  3Q27 A;  5H8N A;  3CFZ A;  5I56 B;  3G3G A;  3UA8 A;  4R6Y A;  3LC8 A;  1B5J A;  4OFO A;  3B6T A;  2GQ1 A;  4YB7 A;  3IOT A;  1FQC A;  1YPN A;  1IXI A;  3PD8 A;  4OAN A;  3LR1 A;  3HFU A;  1MM7 A;  2OWZ A;  3G3K A;  2P0S A;  2VP1 A;  1MXV A;  3IB2 A;  1D9Y A;  4PP0 A;  3SEV A;  1IXG A;  3FJG A;  2AYS A;  4Z7E A;  4TLL B;  4KFQ A;  2ONS A;  1LAG E;  4ZDM A;  1JW4 A;  4EF2 A;  4NF5 B;  4R6H A;  2ESN A;  2F6G A;  3IOR A;  3T96 B;  1B3L A;  1MG1 A;  2P3N A;  4PE3 A;  2KQZ A;  2QJE A;  2DOJ A;  3E4R A;  3GLB A;  4DI4 B;  3RN8 A;  1B7Z A;  2VT5 A;  1LST A;  3O6H A;  4WED A;  1UIU A;  3FJM A;  2F8D A;  3E79 A;  4N81 A;  1MY3 A;  2X7Q A;  3PUV E;  1MY0 A;  4WEP A;  2OK2 A;  4PQJ A;  1LB8 A;  3PUW E;  4QSC A;  1LBC A;  4HCY A;  2I4C A;  1IXC A;  3TPA A;  3VLW A;  1TWY A;  2ONK E;  5IAI A;  2XXX A;  1P1N A;  3B50 A;  4EXK A;  1XT8 A;  4OVS A;  1MQH A;  1P1Q A;  1ZLQ A;  1BKA A;  2B3B A;  2VGQ A;  3KJ7 A;  3KEI A;  4LZ7 A;  1MM6 A;  2B4M A;  1Z7N E;  4FEB A;  3KN8 A;  4F1U A;  3KZG A;  1FPK A;  3V89 B;  5IGA A;  1NV7 A;  4NHB A;  4PFW A;  4PTK A;  3GXA A;  2H99 A;  3S9N C;  1FSA A;  2H25 A;  1DPE A;  5L9S A;  3ZSF A;  1YCJ A;  1JW5 A;  3H6T A;  1GGG A;  3IOW A;  3PUY E;  4BLA A;  1EYJ A;  5H8F A;  3E13 X;  5EQA A;  3K02 A;  5AE4 A;  3T9V A;  3TCF A;  2I0C A;  3TOD A;  2H5Y A;  1IXH A;  4YZZ A;  5L9O A;  1FBP A;  1I6B A;  1IUD A;  5ET5 A;  2Q8J A;  2XA5 A;  3LUY A;  2WBB A;  2LAO A;  3TQW A;  4NN3 A;  4C1T A;  4KQP A;  4MNC A;  4NWD A;  1YAE A;  4JSO A;  2VHA A;  5JK4 A;  2DS9 A;  2QS1 A;  1FBE A;  3KBR A;  5EHM A;  1P1O A;  5BWJ A;  1H44 A;  2F6P A;  3QK6 A;  2WYP A;  5EHS A;  1QUL A;  1N0T A;  2CEY A;  3E3K A;  3FVO A;  1FW0 A;  5M2V A;  4BDQ A;  5EYH A;  1UIV A;  1N3W A;  2NXO A;  5IZ3 A;  1MQI A;  4OQO A;  4RK9 A;  2ZMB A;  2FBP A;  4NF6 A;  4ELR A;  4PFT A;  3RPL B;  2OCU A;  4QF9 A;  4F18 A;  3H6V A;  1LLS A;  1MXW A;  4G77 A;  5AA1 A;  4BDR A;  5CBR A;  1JQF A;  1VFE A;  4ELP A;  1FJ9 A;  4UA8 A;  1XS5 A;  3M3F A;  1B3E A;  1UTH B;  2KLF A;  2IA4 A;  4C1U A;  3KBZ A;  3F11 A;  5AA3 A;  1IMB A;  4AQ4 A;  1Y20 A;  4PF6 A;  3PMW A;  1LAX A;  2A5S A;  2XD2 A;  4PF8 A;  2I48 A;  2O7U A;  4ZEI A;  1I6Q A;  4I40 A;  4MAG A;  1EZO A;  3H06 B;  1MS7 A;  1NKX A;  2XXW A;  2H4I A;  2O51 A;  2XWO A;  3OSR A;  4YKJ A;  3FUZ A;  4ZE9 A;  5CMK A;  5FHO A;  5CRY A;  3SER A;  3G3I A;  1A8E A;  4PFU A;  2FHY A;  1UQW A;  4XXU A;  3CG3 A;  4NAP A;  1KWH A;  2ONR A;  3O9P A;  4OES A;  4X9T A;  2CMO A;  4ELQ A;  5CI5 A;  4P3L A;  4PBQ A;  5DTB A;  1KZ8 A;  1AMF A;  2XXP A;  5F24 A;  3MVX A;  3LSX A;  1NUW A;  3V8X B;  4N17 A;  2XXY A;  5CMC A;  3FIR A;  3U8Q A;  3IK6 B;  1LBZ A;  3FXB A;  1O64 A;  1O63 A;  3K2D A;  1ANF A;  3JZJ A;  4YB5 A;  3H3G A;  1DMB A;  2ZXT A;  1K9Y A;  3OOA A;  2UVI A;  3EHT A;  2UYE A;  4DLD A;  5I5P A;  2I3V A;  3TMG A;  2V3T A;  3K6W A;  1QW0 A;  1MXU A;  4P11 A;  1IIW A;  4P1E A;  2GFE A;  4U1O A;  4XEQ A;  3G3F A;  1EH3 A;  3EHS A;  4JVI A;  2ZYK A;  1MH4 A;  4QBA A;  1NNF A;  3DEL B;  3RT6 B;  2F7A A;  4X1B A;  1AIV A;  1Y3Q A;  3SDF A;  1MDP 1;  1N84 A;  2CZK A;  3P7I A;  4F3G A;  2D21 A;  2FVZ A;  4GWY A;  2RIN A;  4P0G A;  5DEX B;  4NF0 A;  1DSN A;  2I0B A;  3O66 A;  4U22 A;  4MNP A;  3U93 A;  3K1N A;  3R26 A;  4JWX A;  4THI A;  1LBY A;  1UTB B;  4QXD A;  2Y5L A;  3S9M C;  4PFY A;  2KR0 A;  4P56 A;  4PBH A;  2Q74 A;  2THI A;  4G68 B;  1NUZ A;  2AL5 A;  2O6A A;  3PD9 A;  4P8B A;  2AIX A;  1B1H A;  3PPR A;  4N13 A;  3RUM A;  4YKP A;  4MMP A;  4GF8 A;  5DVI A;  3B6W A;  2Z23 A;  3GZG A;  3PMX A;  3MZB A;  4Q8R A;  1MQD A;  2ZZX A;  4HW8 A;  5DEX A;  4OVR A;  2XX7 A;  4BDM A;  5B7D A;  1YZ0 A;  2W7Y A;  3QMF A;  1UTB A;  3OEK A;  2ZZW A;  2CZL A;  3WAF A;  4EQB A;  3C35 A;  4G68 A;  1USY H;  1H43 A;  4RK2 A;  3UGW A;  1INP A;  1PBQ A;  1HSL A;  2DXY A;  2R8T A;  4GOT A;  4DZ1 A;  3KN3 A;  4MHF A;  4QFL A;  4OFL A;  4OVT A;  1A7L A;  4L17 A;  4MEV A;  1MDQ A;  5IM2 A;  4E0X A;  3Q26 A;  4EUO A;  5HM4 B;  4MBP A;  2DE4 A;  1B3H A;  3N94 A;  4GFR A;  3FVG A;  3GYY A;  2G93 A;  2IEE A;  4KD5 A;  4H45 A;  1ZBM A;  3OD7 A;  1WOD A;  3BFT A;  2D5W A;  4GX3 A;  4PE5 B;  3CVG A;  1LCT A;  3BKI B;  3ECR A;  1FCK A;  4U2R A;  3FBP A;  4R2F A;  3MC2 A;  1NMU A;  4P47 A;  1Z7M E;  4OER A;  3KJT A;  3D4G A;  2GHA A;  1BP5 A;  3IOV A;  1LCF A;  1D9Q A;  4MF3 A;  4ONY A;  2I4B A;  4GXS B;  2XHD A;  3MPL A;  1FQE A;  4GXA A;  5A5X A;  2GHB A;  2Y7I A;  1M5B A;  4U4S A;  3H4Z A;  1PC3 A;  5I57 A;  2YJP A;  4GD5 A;  3PPQ A;  5FHM A;  3EPE A;  3KC0 A;  5I59 B;  2V84 A;  4KI0 E;  1JP4 A;  4GWO A;  2WKY A;  1MY4 A;  1SQY A;  4NQ8 A;  2NWJ A;  4IO4 A;  2YPN A;  5CM6 A;  5K2X A;  1B51 A;  2XXI A;  1URS A;  1VSO A;  5F1Q A;  2OX3 A;  2DP8 A;  2Q8M A;  4FE8 A;  2OZZ A;  3G3H A;  5T3J A;  4F39 A;  1RKM A;  4R73 A;  1LAF E;  1L5T A;  3MZ1 A;  3TKD A;  5TP9 B;  2R9J A;  5EYF A;  4X04 A;  4ZEC A;  3GBB A;  2DWH A;  3VXB A;  2XXH A;  3KOS A;  3KSX A;  4E0W A;  4F22 A;  4OXV A;  1B58 A;  2F97 A;  2XX8 A;  3DLN A;  3TTL A;  4U23 A;  5ISU A;  1Q9D A;  3K1P A;  5ITO A;  2OJT A;  2OWT A;  5H8S A;  3IB1 A;  3CIJ A;  3RY3 A;  1B40 A;  4H67 A;  2XXV A;  3TYH A;  3E9X A;  4FEC A;  4DE8 A;  2DQV A;  3C32 A;  3ODB A;  1LBW A;  4RPN A;  5I56 A;  5DT6 A;  2OPD A;  4FIM A;  1G0I A;  3FVK A;  2L5V A;  1EU8 A;  2HZK A;  1NV6 A;  3B8B A;  4P9K A;  3TAJ A;  4HCW A;  4XF5 A;  1OLC A;  2HFB A;  3BIG A;  2DE3 A;  2HPG A;  1N04 A;  3SET A;  4F3P A;  3M3K A;  1J1N A;  1AOV A;  4OFJ A;  4ZED A;  4NF5 A;  1B32 A;  3B7D A;  1B5I A;  1OVT A;  1TFD A;  2Z8D A;  5ET6 A;  3G7W A;  1B05 A;  3EHU A;  1Y4T A;  3FV2 A;  5KZT A;  1FPI A;  4QHQ A;  2A5T B;  3QIM A;  4ELO A;  1ZJL A;  4NF4 B;  4QSE A;  3ROJ A;  4AS5 A;  2XXU A;  1OIB A;  3TQL A;  4PET A;  1Q35 A;  3C31 A;  4G2Z A;  5HPQ A;  4G61 A;  2DSF A;  3QYT A;  1EZP A;  4OMB A;  2PFY A;  4EDP A;  5I84 A;  5ESY A;  3OO9 A;  1LB9 A;  2FYI A;  5J16 A;  3CHG A;  3VVF A;  4U1Z A;  3RLF E;  3E78 A;  2QMW A;  1LBB A;  1ZIU A;  3LV0 A;  1LFH A;  1MY1 A;  2UVJ A;  4IGR A;  1NH7 A;  1DBZ A;  4RXL A;  1FPD A;  1US4 A;  2PMS A;  1FBD A;  3VVE A;  4AB5 A;  3FGS A;  3O97 A;  4LA9 A;  4JVC A;  4OYV A;  1IQ7 A;  4PDD A;  1SW4 A;  2ANJ A;  4R74 A;  2A5T A;  3H03 A;  4PAK A;  3SKP A;  4MFI A;  2QSX A;  5L8D A;  4DXU A;  2XWK A;  2ALU A;  4WXJ A;  1ZTY A;  3C4M A;  3MUQ A;  2QL3 A;  1QKB A;  4MX6 A;  1GV8 A;  1QGX A;  3IAZ A;  4Q0C A;  4ZEK A;  1FBF A;  1LFI A;  4R2B A;  1B46 A;  5KCJ B;  2VOZ A;  2ZYN A;  2F5X A;  2FIX A;  2H98 A;  3PUZ E;  3ZKK A;  4PDH A;  1M5E A;  1LEV A;  1LBX A;  2FNC A;  1LAH E;  4KYE A;  4N07 A;  1FBC A;  1FTM A;  3ILU B;  3O6I A;  1F9B A;  1QUI A;  4LQ2 A;  5ELV A;  1IMD A;  1B52 A;  4PGP A;  3OEN A;  1VE4 A;  2P1S A;  1ELJ A;  1DTZ A;  3OO7 A;  1FBG A;  1FQB A;  2I49 A;  5CMB A;  1BLF A;  3A3U A;  2Z8F A;  4NGU A;  4KXP A;  3CSG A;  2GH9 A;  1IMF A;  4KHZ E;  2HCA A;  1Y1Z A;  4YMA A;  3T0J A;  1SYH A;  4PFR A;  4IB2 A;  1JVY A;  5KCJ A;  2Z8E A;  4G8H A;  2ZYM A;  1FPJ A;  3OSQ A;  4OVP A;  3N5L A;  1CE2 A;  2HEU A;  1YYZ A;  5H8Q B;  3RPL A;  4H8J A;  4JSD A;  3HV1 A;  1NNT A;  3ZS6 A;  4JB7 A;  4RNS A;  3GBA A;  4UAB A;  3ONM A;  4N8G A;  4N6D A;  1B5H A;  2UVG A;  4H65 A;  2DWI A;  2Q2A A;  1M5C A;  3FZV A;  3U1O A;  3RQT A;  1UTH A;  2R71 A;  3PUX E;  4ESW A;  3CFX A;  1R9Q A;  2XXK A;  2PVU A;  4LP2 B;  1NV1 A;  4O94 A;  1XVX A;  2QS3 A;  5FBP A;  2NUV A;  2AL4 A;  3TTK A;  2RF1 A;  2HAU A;  4RPO A;  3VE1 B;  3DP4 A;  1JEU A;  4OHN A;  4OA4 A;  3TTR A;  4X48 A;  4NWC A;  5H8Q A;  1QJM A;  4X8R A;  2JJK A;  2HAV A;  2YLN A;  3RTF B;  4YAH X;  5DW8 A;  4N15 A;  4LON B;  1M5F A;  1N7X A;  3O6G A;  1NV0 A;  4NF8 B;  1Y1M A;  2QVU A;  4N91 A;  4JBZ A;  4JDF A;  1JNF A;  3L6H A;  3CSB A;  1CB6 A;  2F36 A;  4KYD A;  1D3K A;  2ZNU A;  4ISU A;  1XI6 A;  1GTK A;  5JEI A;  1RDZ A;  5EQ9 A;  2QS4 A;  2X26 A;  4GWS A;  3TFL A;  1PBP A;  4OEU A;  1WDN A;  3TEL A;  1FPF A;  2WBD A;  1MRP A;  2NVU B;  3FVN A;  5AA4 B;  4YKK A;  4QRZ A;  1BIY A;  1Y9U A;  3TUS A;  1YXI A;  2F7B A;  2HQ0 A;  3T22 A;  1MXX A;  3ISP A;  2O69 A;  2V3Q A;  1SW5 A;  2OWS A;  4NF8 A;  3I6V A;  4F2O A;  3HHF A;  3IX1 A;  3KN7 A;  3EF7 A;  1NNK A;  2NOO A;  4DXB A;  3QXM A;  3T9U A;  1JET A;  3K0V A;  1BTJ A;  4ND9 A;  2O7I A;  1CNQ A;  3CFL A;  4NTL A;  2FIE A;  1NV4 A;  2Y7W A;  2ZNT A;  4GBW A;  2XWV A;  2O68 A;  1S9T A;  4EF1 A;  1AH5 A;  3MJN A;  2QFL A;  4FAJ A;  3K6X A;  3U94 A;  4ZE8 A;  1LGB C;  3KGC A;  5I2N B;  3I5O A;  5FTH A;  3R7X A;  4GX6 A;  2WYK A;  2QRY A;  4GL8 A;  3UP9 A;  3N6U A;  5FTI A;  3RGY A;  5J1D A;  3C9H A; 
#chains in the Genus database with same CATH homology
 2XA5 A;  2WBB A;  4NN3 A;  2CZI A;  4MNC A;  4N6K A;  4N4U A;  4LN5 A;  5JK4 A;  5EQ7 A;  1FBE A;  2XWI A;  4F1V A;  2ZZV A;  1Q9D A;  3D1R A;  4GWU A;  2WYP A;  4O7M A;  3U65 A;  1FBH A;  2CEY A;  4PFI A;  4P1L A;  4MIJ A;  5LTC A;  2VPO A;  5EYH A;  4OVQ A;  1LBW A;  5IZ3 A;  4PGN A;  2FBP A;  4O7I A;  1G0I A;  2HZL A;  3RPL B;  2L5V A;  4F18 A;  2WX9 A;  2HZK A;  1NV6 A;  2PCR A;  4M1V A;  4PC9 A;  3B8B A;  4P9K A;  1SPI A;  5IZZ A;  4HCW A;  4XF5 A;  3BIG A;  1FJ9 A;  2DE3 A;  2HPG A;  4HXV A;  4HE1 A;  5I7I A;  3KBZ A;  3IFC A;  4N8Y A;  5IZ1 A;  4XFE A;  1IMC A;  1EYI A;  1IMB A;  1FTA A;  5ET6 A;  1NI9 A;  4PF6 A;  4PAI A;  1FPI A;  4PF8 A;  4JVD A;  3ROJ A;  4AS5 A;  2WEF A;  4PET A;  4I40 A;  4G61 A;  4MAG A;  2PFY A;  5ESY A;  5ET8 A;  5J16 A;  3CHG A;  2XWO A;  3E78 A;  4GBV A;  3LV0 A;  4FBP A;  1DBZ A;  3MST A;  1FPD A;  3SZP A;  2FHY A;  3BIH A;  4O8M A;  4NAP A;  1FBD A;  4JVC A;  2HXR A;  4PDD A;  4X9T A;  2CZH A;  4P3L A;  4PBQ A;  1KZ8 A;  4PAK A;  5F24 A;  1NUW A;  1FPL A;  2P3V A;  4N17 A;  2Q9T A;  2QPQ A;  1LBZ A;  4F19 A;  4GWX A;  2XWK A;  3FXB A;  2DE2 A;  3KC1 A;  4HE0 A;  4HE2 A;  2Y5K A;  4MX6 A;  1QGX A;  1K9Y A;  1NV2 A;  2DVZ A;  1FBF A;  1FJ6 A;  5ET7 A;  3MYU A;  5I5P A;  2F5X A;  2FIX A;  4P1E A;  2F3D A;  1IME A;  4PDH A;  4XEQ A;  1LEV A;  1LBX A;  4JVI A;  4GWZ A;  1FBC A;  4QBA A;  1VDW A;  1IMD A;  4PAF A;  4GX4 A;  1DCU A;  4PGP A;  4YIC A;  2CZK A;  4MJO A;  5EYG A;  5A5L A;  1FBG A;  1FPG A;  5LDZ A;  1AWB A;  2FVZ A;  4GWY A;  4NGU A;  4KXP A;  1IMF A;  4MNI A;  4NF0 A;  3W9V A;  3T0J A;  2PFZ A;  4MNP A;  4I3Y A;  1KA0 A;  1RDX A;  1LBY A;  4PFR A;  4QXD A;  2Y5L A;  4IR8 A;  2KR0 A;  1FPB A;  4P56 A;  1K9Z A;  4PBH A;  1FPJ A;  1G0H A;  2Q74 A;  1NUZ A;  4OVP A;  5EQ8 A;  4PFB A;  1YYZ A;  3RPL A;  1DK4 A;  4P8B A;  1NUY A;  3RYD A;  1NUX A;  4PCD A;  2DDK A;  4UAB A;  1BK4 A;  4N8G A;  4N6D A;  4MMP A;  2QVV A;  3T1B A;  2F3B A;  4NX1 A;  2ZZX A;  4MCO A;  2XXK A;  4DI3 D;  1EYK A;  3PTY A;  3LUZ A;  4OVR A;  1NV1 A;  4O94 A;  3A29 A;  5FBP A;  2HHM A;  1YZ0 A;  3QMF A;  2ZZW A;  5IZ3 B;  4OA4 A;  2VPN A;  1INP A;  2R8T A;  2GQ1 A;  1NV5 A;  4X8R A;  2JJK A;  4MHF A;  4OVT A;  4MEV A;  5DW8 A;  4OAN A;  2V4C A;  4N15 A;  5IM2 A;  3HFU A;  2OWZ A;  2DE4 A;  3GYY A;  2B4L A;  1NV0 A;  2QVU A;  4N91 A;  4AS4 A;  4H45 A;  2P3N A;  1FPE A;  4PE3 A;  2KQZ A;  4GX3 A;  3W9W A;  1KA1 A;  1XI6 A;  4DI4 B;  3FBP A;  2VT5 A;  1RDZ A;  5EQ9 A;  4P47 A;  4GWS A;  3E79 A;  4NG7 A;  4N81 A;  1FPF A;  1D9Q A;  2WBD A;  4HCY A;  3B50 A;  4OVS A;  4GWW A;  1YXI A;  1LBV A;  3ISP A;  2V3Q A;  3KC0 A;  3NOH A;  1JP4 A;  2B4M A;  2BJI A;  5I3S A;  4F1U A;  1FPK A;  1FRP A;  5IGA A;  1NV7 A;  4NQ8 A;  4NHB A;  4PTK A;  3EKI A;  1FSA A;  1CNQ A;  5CM6 A;  1NV3 A;  4H46 A;  4I3E A;  2QVR A;  1IMA A;  2FIE A;  1NV4 A;  4GBW A;  2XWV A;  2OX3 A;  2Q8M A;  2CEX A;  1EYJ A;  2QFL A;  5T3J A;  3IFA A;  5EQA A;  2MKZ A;  1RDY A;  4GX6 A;  4YZZ A;  2WYK A;  1FBP A;  5J1D A;  5ET5 A;  4X04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...