4QXDA

Crystal structure of inositol polyphosphate 1-phosphatase from entamoeba histolytica
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
MQTSLFEFANVLITAVKEASYSISKFKEEVEIKYKSDGSEVTQVDTQSQQIIFSIIKNKYPTINIIGEEDVENGIPDNQLPTITQLSFGSLENKIININDIIIYVDPLDGTDCYTHKQYDSVCVLVGVTYKGKPMIGIVSKPFYNNEITFAIENYISSISLQPLNDKIIFVCSKKNDIQHLIKSFPDPYEVKYKGGSGAKMMAIIHQEADIYYHPLIQSCTWDTLAAQVILEAQGGIVCDIYGNPLCYPSSKKESMRHKKGVLCLSPRAKKYLPYMLSISKTILLLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based identification of inositol polyphosphate 1-phosphatase from Entamoeba histolytica
pubmed doi rcsb
source organism Entamoeba histolytica hm-1:imss
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase, putative
total genus 85
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.1.3.57: Inositol-1,4-bisphosphate 1-phosphatase.
pdb deposition date 2014-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4qxdA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4qxdA02
3IFAA 1QGXA 4I3YA 2P3NA 1SPIA 4H45A 1G0IA 1LEVA 3ROJA 1FJ6A 1NV4A 2OWZA 3RYDA 1FBPA 2F3DA 2PCRA 2CZKA 2WEFA 4HXVA 1Q9DA 1LBYA 4HE0A 1LBVA 5IZ3A 1CNQA 1FTAA 1LBZA 1FRPA 1NUXA 2DDKA 1NV2A 1FJ9A 3KC1A 1KA1A 1NUZA 3D1RA 1FPLA 4MJOA 1DCUA 3LV0A 1FPKA 1FSAA 2QFLA 2WBBA 4GBVA 1IMDA 1RDZA 5T3JA 1FBEA 2CZHA 1FBHA 1FPBA 4G61A 4GWUA 1IMCA 1G0HA 2JJKA 2GQ1A 2QVVA 2HHMA 2FBPA 1IMFA 5DW8A 5EQ9A 1LBWA 1FPGA 1IMBA 1NI9A 1NV7A 4AS4A 2CZIA 1FPDA 1FBCA 1IMEA 5EYHA 4I40A 1EYKA 4H46A 2Q8MA 2Y5LA 5EQAA 3LUZA 2Y5KA 4QXDA 4GWZA 5EYGA 5ET8A 5FBPA 5LDZA 1FPFA 4GX4A 4GWWA 1NV3A 4FBPA 4N81A 5F24A 2QVUA 1FPEA 5ET6A 2Q74A 1D9QA 1INPA 1NV6A 5ET5A 4GWSA 1DBZA 5ESYA 5IZ3B 5ET7A 1FBDA 2VT5A 4O7IA 2FIXA 5EQ7A 3A29A 1NV1A 4IR8A 3IFCA 1VDWA 2OX3A 4HE1A 2FIEA 2WBDA 1EYIA 1FPJA 2BJIA 3FBPA 1JP4A 1KA0A 1FBGA 1NUWA 2FHYA 1YYZA 3BIHA 3RPLB 1YXIA 5IZ1A 2F3BA 1NV5A 2QVRA 3BIGA 3KBZA 2FVZA 2P3VA 3QMFA 1RDXA 5I3SA 1KZ8A 1YZ0A 4GX3A 1XI6A 1K9YA 1FPIA 1LBXA 1NV0A 1EYJA 4GX6A 4I3EA 3B8BA 1IMAA 1NUYA 5J16A 4GWXA 3T0JA 3RPLA 2R8TA 4AS5A 1K9ZA 4PTKA 4GWYA 4GBWA 5A5LA 3KC0A 1BK4A 4KXPA 1DK4A 1FBFA 4HE2A 1AWBA 1RDYA 5EQ8A
chains in the Genus database with same CATH superfamily
1IXGA 1A54A 1B52A 2REGA 4OFLA 4QSCA 1NV4A 2V25A 5AA2B 1B7UA 4PAIA 2CZKA 1Z7NE 2VPNA 2DDKA 1KA1A 1NUZA 4MHFA 1DCUA 5IAIA 4PDHA 2XHDA 4AB5A 1NKXA 3JV9A 4M4GA 1P1OA 4OERA 4NWDA 3KJTA 4GWUA 1B3HA 1IMCA 4F39A 4NF5B 4AB6A 3CRBA 1IMFA 4GIZA 3VVFA 2DYXA 3BFUA 1KWHA 1NV7A 3O2AA 1H43A 2ONRA 1MQGA 3FVGA 1MY1A 3FV2A 3LUZA 4OESA 4H67A 4GX4A 2OJTA 4G68C 1NFTA 4E0XA 5I59B 5IZ3B 4PAKA 3IO6A 2AL5A 4DXUA 3IOWA 4HCYA 4N13A 4OETA 4P3LA 3GBAA 2CZLA 5CBRA 3S4UA 3KBZA 4GOTA 4QFPA 2WKYA 4IY5A 4OQOA 2GHBA 1B5HA 2A5TA 1LBXA 2XWOA 1R6ZA 3FUZA 3OXNA 3OO8A 3RPWA 3I6VA 4KQPA 4R72A 1K9ZA 4BDOA 3IL1B 3TUSA 2B4LA 4N15A 4MF3A 5A5LA 2ZZWA 4P0IA 4MBPA 3IOVA 1OLCA 3IFAA 4PF8A 3PTYA 2VD3A 3SERA 2OPDA 4K3FA 3FIRA 1S7YA 5H8QA 4N4UA 4C1TA 2ZYMA 1IXIA 4MMPA 1FSAA 3PUWE 2RCAA 1FBEA 4KFQA 5DT6A 4Q5TA 5DW8A 2OK2A 1UTBB 4RYAA 3SZPA 5TPAB 4G8NA 5DEXB 2L5VA 2CZIA 1M5FA 1QUIA 4JBZA 3I5OA 1N7WA 4LN5A 5ITOA 3R26A 3A09A 3FJ7A 2NVUB 4QXDA 4YB6A 4GWWA 3U72A 2E0SA 1O63A 1LCTA 3PUYE 1IITA 2DVCA 3TAJA 1VDWA 4DIGA 3E79A 4JWXA 5CMKA 1B6HA 1MG1A 1YXIA 1NV5A 5AA4A 1QJMA 5TP9B 1DOTA 1KZ8A 3G7WA 4KYEA 4X9TA 5EHSA 4BDNA 2ZYNA 1FTLA 2DWAA 4BDMA 1JVXA 3OO6A 3S9MC 4GWXA 2A5TB 3VDFA 2NOOA 1SVXB 1LAGE 2P0SA 2ZNTA 1WODA 5KZTA 1NH7A 3OMBA 3T1BA 4IGRA 3IORA 3RN8A 1Q9DA 1LBYA 4RJZA 4H65A 1P1WA 1NV2A 1FJ9A 5DVIA 4MJOA 3H4ZA 1IMDA 4OA4A 5JK4A 4NQ8A 3MVXA 2DP8A 5TPAA 3EQ1A 4NE4A 1I6AA 3CI8A 4EQBA 4UA8A 3KSJA 3MZ1A 3EF7A 2F34A 4PFUA 1LBWA 3MUQA 5AA3A 3HO7A 3ILTB 1JEUA 2E1SA 3MW0A 5EYGA 5ET8A 4F18A 4KI0E 5K2XA 3U8QA 5ISUA 1TWYA 2XX9A 1NV6A 4DI3D 3UA8A 1SI0A 1H45A 5AE4A 2RKMA 4H5GA 1FBDA 1AMFA 3TYHA 1B1HA 1PB7A 1OLAA 2V84A 1NNPA 2PT1A 4RNSA 2FIEA 1EZPA 1SI1A 3V89B 2ZZXA 1Q35A 3FGSA 2F78A 1MH4A 1YAEA 1TFAA 2QMWA 2HFBA 1XI6A 2D21A 4MLVA 2ZMBA 3VXCA 3RTWB 1IEJA 4N6DA 1MPCA 4HTGA 4G4PA 3H7MA 3OD7A 1RKMA 4XKNA 5DEXA 3KG2A 4XEQA 3PGFA 4OZ9A 4OEUA 5CRYA 3VLUA 4P8BA 2H9BA 4U22A 2DXYA 3TMGA 4IO4A 1SW4A 1AL3A 4P1LA 3UORA 2QMXA 3B6TA 1SW2A 5B70A 3KC1A 1NMUA 1MQDA 3U92A 2VHAA 4F19A 5T3JA 4F22A 2V3TA 3FXQA 3T9HB 2BJJX 3Q25A 4R74A 2JJKA 1RYOA 2V4CA 3C36A 3UN6A 2XXTA 1IUDA 2UVJA 2I48A 5I57B 2O84X 1EYKA 1FTMA 2HXRA 2KR0A 4OWDA 3MP1A 1BIYA 4GXSB 5LDZA 4GXAA 4DI4B 4KYDA 1MXVA 4P9KA 2I6EA 3SESA 5AA2A 2WYPA 3SEWA 4O7IA 4MCOA 4ZECA 3K01A 2XXYA 4MNCA 4OENA 4ZEDA 3RPLB 4OMBA 3KBRA 4U1ZA 3PMWA 3IOTA 5IZZA 2VD2A 1RDXA 5ICTA 4FORA 1IQ7A 1P99A 1R1NA 1CB6A 1NV0A 3EHSA 1WVJA 3SEXA 2DQVA 2FYIA 4PBQA 3RPLA 4I1DA 2UYEA 4MEVA 4ZEKA 5CI5A 4Z7EA 2V93A 1PB8A 4NAPA 3KOTA 3K0VA 5H8QB 1FBFA 1II5A 3IB2A 3DM0A 1B40A 2Z8FA 2I4BA 3HCQA 5H8FA 1B4ZA 3RYDA 3OENA 2YJPA 4EQ9A 2WEFA 1IXCA 4ELOA 1LBZA 5KDTA 3U93A 4F29A 5JEIA 3HPIA 2XXQA 1FPLA 3KN3A 2Q89A 3TTLA 4DZ1A 4IO2A 1WDNA 3P7IA 3O6IA 2H5YA 4LATA 4ECFA 2XXKA 4QSEA 1UIVA 5H8NA 2HZKA 2F7BA 1FBCA 1XC1A 5ITPA 3CFLA 1RYXA 4GLIA 3GBBA 3HHFA 4H0WA 5I58B 3UK4A 1US4A 1LBCA 1MH3A 3I3VA 4JB7A 3VV5A 2XXPA 3VE1B 5F7VA 2ONSA 4LA9A 3FZVA 1XOCA 2ZNUA 2OX3A 5I58A 4XXUA 1EYIA 1DPEA 1POTA 1Y1ZA 1BTJA 4PGPA 3TQLA 1YZ0A 3V83A 3KFMA 4H8JA 5DTBA 1K9YA 2V3UA 4NF8B 3SEVA 2IEEA 1IZ1A 5HPQA 5I56A 3MYUA 3FXBA 3VVEA 4I9DA 1H3DA 3IB0A 3B6QA 3K6VA 1M5DA 1UTHB 4PF6A 4JVCA 2WX9A 2GH9A 2GRVA 3OO7A 3QK6A 2B3FA 1MXZA 3IR1A 4PFWA 3AXFA 1B0LA 1UTBA 4F1VA 1F9BA 1B5JA 1DPPA 4LZ5A 3TEPA 4IO3A 1SQYA 4FE8A 1H76A 3MZ9A 1G0HA 4EXKA 3H06B 3EPEA 1VFEA 4PFIA 4XFEA 2VGQA 4AS4A 5DYHA 4PFTA 3RGYA 4H46A 3M8UA 4DE8A 4N6PA 2PFYA 1B9JA 5CC2A 1MPBA 4F31B 1FQFA 4BLAA 3K1MA 4ELQA 5I84A 5EHMA 3RY3A 4RK9A 3U1OA 4F2OA 3FVNA 1JW4A 5EQ7A 5CMMA 3QXMA 3A29A 1OVTA 3HN0A 3FBPA 4PDDA 4YMAA 3TZAA 3QMFA 3E78A 5I3SA 3DLNA 2THIA 3ZKKA 1MDP1 4QFKA 3M3KA 2Z8EA 4MFIA 4YICA 4AS5A 1B32A 4ZE9A 2YLNA 3DP4A 2RC8A 1L5TA 5AA2D 5LOMA 4G68B 4DDDA 2ESNA 2H4IA 5A5XB 1G0IA 4FATA 1OQHA 2F8DA 1R9QA 1H44A 2HZLA 3UIFA 3QYTA 1Y4CA 2QJEA 5ICQA 3G3GA 3Q29A 5ELVA 4R2BA 1B7HA 3FJMA 4RPOA 1EU8A 1NNFA 4DLDA 1JQFA 4C1UA 4JDFA 2F6GA 3TTMA 1QKBA 5I5PA 3G3FA 4PQJA 3QUFA 4IB2A 4OVTA 3EKIA 2Y7KA 3CIJA 4OANA 1IMBA 2CMOA 3O6GA 4O94A 4PAFA 4I40A 3O66A 2ZYKA 1LCFA 1VFDA 4MIJA 4KCCA 1SW1A 4NEDA 1HSLA 1FPEA 5ET6A 4FECA 1INPA 3THIA 1FQEA 2Y84A 3M3FA 3TDJA 1B3EA 2P1SA 3K4UA 3MSTA 4HE1A 2DWIA 1S50A 4JVIA 4ZEBA 4PE3A 1FPJA 5DVFA 1M5BA 1M5CA 2XD3A 4OFOA 2OPEA 3G3IA 5I56B 2ONKE 5JTYA 3FXUA 4KPTA 3B8BA 2ANJA 3T96B 1JVYA 4POXA 2QS3A 2CEXA 4N91A 1MQJA 5BWJA 4R6YA 1Y3PA 2Z8DA 1AH5A 1TFDA 3D4CA 1MY0A 4BDRA 2QPQA 3ZSFA 4O3AA 5J1DA 1O7TA 1FCKA 3JZJA 4I3YA 4IO7A 4Q30B 2QS1A 3PD9A 4ISUA 4MNIA 3VVDA 1USYE 1O64A 3OEKA 2PBWA 2O7IA 4OVRA 2H25A 3RUMA 4OTEA 4PCDA 3IX1A 4F3GA 1D9YA 4U4SA 1IXHA 3MVYA 4YKJA 4YB7A 3T22A 4RA1A 2FBPA 1DSNA 1EZOA 3F11A 3L6HA 3LBSA 1AIVA 2F6PA 4NF5A 1AOVA 4OHNA 3K1NA 1Y4TA 4IGTA 2PVUA 4U4XA 1OMPA 5CMCA 3K1PA 5I2NB 1MM6A 1DBZA 1DTGA 3DP8A 3SETA 3TCHA 2VP1A 5I7IA 4OYVA 3OEMA 3OSQA 4R6KA 5LTCA 2XXWA 4ZE8A 3WAEA 3CR9A 4H1XA 3KSXA 4MAGA 2P3VA 1S9TA 2O51A 2PFZA 1D3KA 2H99A 4WEDA 1US5A 2XXHA 1LBBA 2RCBA 2Z23A 1I6BA 4X1BA 4ELRA 3O97A 3K6WA 2ZZVA 3RQTA 1OQGA 3Q27A 5HM4B 4OVPA 4GWYA 1QUKA 3ONMA 2RINA 1BLFA 4DXCA 1D4NA 1M5EA 4LZ7A 3B50A 1I69A 1FBPA 2F35A 2GHAA 2F3DA 2PCRA 3GXAA 2UVHA 4HXVA 1MXYA 1LAHE 3QAXA 2XA5A 1ATGA 1B1XA 3TFLA 1URDA 4GBVA 3H3GA 1RDZA 4Q0CA 3CVGA 3LR1A 5H8HB 4KR5A 2Y7IA 4EUOA 1N04A 3PPRA 3RT6B 4N07A 3S2VA 4LQ2A 4WKMA 1VR5A 4XTCQ 3MVWA 3OSRA 5EYHA 4RXLA 3K00A 4GD5A 2Q9TA 4GWZA 4NN3A 2Y7RA 4XF5A 5F24A 2QVUA 3H6TA 2NXOA 4GWSA 2OCUA 4P11A 1SYHA 2ZYOA 1ZMGA 4GRKA 2DE2A 4ZDMA 5FTHA 4G68A 4YKKA 4ESWA 2FHYA 1YYZA 3TPAA 1SBPA 3LSXA 4IO5A 1UTHA 4FEBA 3R7XA 3C4MA 5I57A 2VPOA 5B7DA 4JSOA 1N76A 2I58A 2ABHA 1A40A 1QULA 3GZGA 2DVZA 2M8CA 2F36A 4JVDA 4KXPA 3MPLA 2OWTA 3HFUA 3EHTA 5EYFA 1SPIA 3ROJA 1B58A 3B7DA 4N8GA 1XT8A 2UVGA 4X1DA 1LBVA 3WAFA 4MX6A 5FHNA 1FRPA 1NUXA 4FAJA 2XXXA 1ZIUA 4PE5B 1DTZA 1XHYA 2WBBA 3JYRA 3LSLA 4G8MA 1N84A 1B0HA 3BBRA 2GFEA 1FPBA 4O3CA 3VFJA 1FPGA 1PC3A 1NI9A 4P0GA 1LGBC 3T66A 4Q8RA 2R9JA 1IMEA 1NNKA 3TODA 4NWCA 2Y5KA 3PPPA 2F5XA 3C33A 2R71A 1B3FA 1D9QA 2RC9A 4TLLB 4NGUA 5ET7A 3K2DA 5TP9A 2VT5A 2FIXA 3M3LA 3VXBA 1B3LA 1ZTYA 4ZEFA 4H5FA 2PT2A 1B3GA 1MY3A 2F97A 5KCJB 3BIHA 2DS9A 4LQ5A 4X48A 4R9GA 2YPNA 3LC8A 4G77A 3E13X 2O7UA 3SEUA 3N26A 2W7YA 3G3JA 2PYYA 1A55A 1QKAA 3RNNA 4IO6A 3OO9A 1SW5A 3IJOB 1DK4A 4TOZA 1FTOA 4F3BA 3R6UA 2X26A 3C9HA 2DSFA 3O29A 3DELB 1N0TA 2I3VA 2OWZA 1FTJA 2HPGA 1ANFA 3LSWA 3KOSA 4HCWA 2I0BA 4BDLA 2I0CA 1Y20A 3UP9A 1JETA 4OEVA 1MQIA 1YCJA 4NHBA 4WXJA 5K2YA 2XWVA 4DXBA 2QVVA 3MJNA 5M2VA 4NMYA 3W9WA 2OWSA 1YPNA 5I2KA 2Y5LA 1NL5A 2RC7A 2IA4A 3FXRA 5FBPA 4GL8A 4MH5A 1FPFA 4FBPA 4H8IA 4N81A 5ET5A 4QSDA 1OIBA 1Q1KA 1MXUA 3FD3A 2KQZA 1FQAA 3CHGA 4GVOA 4NF0A 4PETA 1URGA 3KN8A 1NV1A 5F1QA 3KN7A 5IKBA 5CMBA 2BJIA 3IAZA 1JP4A 1KA0A 1FBGA 1B7ZA 3C32A 5I2KB 1B5IA 3ILUB 4ND9A 1XVXA 1YTVA 3MP6A 5AA4B 1PDAA 3FASA 4GQOA 4RY1A 3T9VA 1EYJA 2XX7A 2WYKA 3PU5A 1IMAA 1NUYA 2PMSA 2UXAA 4JXIA 2D3IA 1Z7ME 2R8TA 1P1UA 2OZZA 4NG7A 1GV8A 2XWKA 2HCAA 2VOZA 3L6GA 4DCXA 4ZEIA 4HE2A 2XXRA 2GQ1A 1AWBA 4KHZE 1RDYA 4LVQA 3Q28A 1QGXA 3CSGA 2I3WA 1FW0A 3W9VA 1CE2A 1FJ6A 4FEDA 4YB5A 5DVJA 3E3KA 4HE0A 1TT1A 4U21A 4ZS9A 2F7CA 3LSFB 3V8XB 3ODBA 2G29A 4QBAA 1EZ9A 3K6UA 1NNTA 2DOJA 3MP8A 3MZBA 1LAFE 3PUZE 5EQ9A 3QIMA 4LUBA 1TXFA 2XXIA 4QHQA 3TTKA 2I49A 1MQHA 3FVOA 1UQWA 4KCDA 2OBGA 4I62A 1MRPA 4NTLA 2QS4A 3TQWA 1VE4A 1QUJA 5BUUA 1LB9A 3U94A 3CG3A 4F3SA 5L8DA 4POWA 1MPDA 2CEYA 3TELA 2X7PA 4F1YA 2V3QA 1PBQA 4HW8A 3SKPA 4EXLA 4KD5A 2G93A 2REJA 1D9VA 3N6TA 3DP6A 3IO4A 1ZU0A 2AL4A 3KZGA 3GLBA 3N5LA 3U65A 4GWOA 2AIXA 2MKZA 2PX1A 1FPIA 1FQCA 1ELJA 4E0WA 5H8NB 4YAHX 2QRYA 5H8SA 4ESXA 1LSTA 5I59A 4P1EA 3FJGA 3S9LC 3B6WA 4H6DA 1LEVA 3O9PA 2ZXTA 4G2ZA 1A99A 3UGWA 3IJXB 4EQ7A 3IOUA 4XIGQ 1A8EA 1QW0A 2ZNSA 3Q26A 4F2QA 1Y3QA 4NF6B 1B4HA 1GGGA 2CZHA 2XX8A 4LZ8A 4G61A 4XKQA 4YU0A 3TCFA 2ALUA 3PPOA 1SYIA 3MBPA 2AYSA 1Y1MA 1JNFA 4QFNA 1PB9A 3HHGA 4OVJA 1Y3NA 1BP5A 5H8FB 2D5WA 3HV1A 4IY6A 4TLMB 2DE3A 2Y7WA 2DE4A 1ZLQA 3T9XB 1B51A 2QL3A 1N3XA 4C0RA 1QVSA 4AQ4A 4F1UA 1VSOA 4NF6A 4ELPA 1P1NA 1LFHA 5HBCA 3A3UA 4XKPA 4RPNA 2QVRA 2FVZA 1FQDA 3BKIB 3PPQA 4GX6A 4GFRA 4OXVA 2XWIA 3FVKA 5L9SA 4FIMA 4GBWA 3O28A 3FATA 3RTFB 3MWBA 4P47A 4JWYA 4M1VA 3TKDA 3VLVA 2P3NA 3CFZA 4H45A 3EHUA 3H6VA 1PEBA 3PUXE 3IB1A 2O1MA 2Q2AA 2Z22A 2RF1A 4WEPA 3CFXA 3MPKA 3BFTA 1FPKA 2QFLA 1FQBA 3MC2A 3PMVA 4UACA 2HEUA 3PPNA 1A7LA 3FV1A 2HHMA 1POY1 1JW1A 1GTKA 4U23A 1FPDA 1T0KA 4ONYA 2Q8MA 4NF4A 1B05A 1MY2A 2XD2A 1LAXA 5TU0A 5FTIA 4U2RA 1R9LA 4F3PA 5CM6A 1NV3A 5FHMA 2Q74A 1URSA 3LUYA 3KJ7A 5A5XA 2OLBA 3ECRA 1XVYA 3GYYA 4X04A 3E4RA 4LP2B 3IFCA 4QRZA 5I2NA 4FJPA 3K6XA 1OVBA 1ZBMA 1NUWA 3O6HA 2HAVA 4RK2A 4Z0IA 3KGCA 5IGAA 2Q2CA 1N7XA 2B4MA 3USDA 1MXXA 4NF8A 2HQ0A 4R2FA 3T0JA 2LAOA 4KYSA 3MVZA 3KC0A 1BK4A 1FTKA 1N3WA 3PV0E 5EQ8A 4R73A 2UVIA 4YZZA 5CBSA 3CG1A 2HXWA 4OVQA 3OOAA 1LFGA 2O6AA 2DWHA 1LFIA 5IZ3A 1FTAA 1XS5A 1SD3A 4N17A 3TCGA 3PMXA 1JEVA 4G8HA 3N94A 4UABA 3G3KA 4GL0A 2A5SA 4I8CA 1LLSA 3S9EA 1HSJA 5EQAA 3G3HA 2XXUA 2O1LA 5H8HA 4EF2A 3C31A 3RLFE 4QFOA 2NUVA 1JW5A 3NOHA 1ZJLA 2HAUA 3TTNA 4NX1A 5ESYA 4HS7A 2NWJA 4R9FA 5FHOA 1MM7A 1GR2A 1MXWA 3OELA 3C34A 4L17A 2XXVA 2WBDA 3MQ9A 4PFRA 4GF8A 1SDXA 4YKIA 4JSDA 4THIA 5IZ1A 2F3BA 2B3BA 2Q88A 4O8MA 4N8YA 2DWJA 3N6UA 3PD8A 2Y7PA 4GX3A 3IK6B 5L9MA 1BKAA 2O69A 1MY4A 4PFBA 5AA1A 5J16A 2X7QA 2H98A 4LONB 4R6HA 4PTKA 2I4CA 1NH8A 4QFLA 4EDPA 2FNCA 3SDFA 4U1OA 4YMBA 4R75A 3HSTA 3S9NC 4PBHA 1LB8A 3CSBA 4NF4B 4MLQA 4ZZEA 1PBPA 4PGNA 1CNQA 1A8FA 2FA7A 3D4GA 5IM2A 5KCJA 4OVSA 3W15C 1MDQA 3D1RA 3LV0A 3KEIA 3QSLA 1DMBA 1UIUA 1HSEA 4O3BA 3QUJA 3T9UA 4EF1A 3ZKLA 1FBHA 3ISPA 2B65A 3SEYA 4PC9A 1USYH 1Y9UA 2DXRA 2KLFA 3H6UA 1I6QA 3MAMA 2QSXA 2P2AA 1B2HA 4JWOA 3E9XA 4TQUQ 4MNPA 4OFJA 5KDTB 4XKRA 5L9OA 1EH3A 1MS7A 2R6GE 4X8RA 4YKPA 1B46A 4QF9A 3VLWA 4PP0A 5JTYB 3ZS6A 4IR8A 1GVCA 3EN3A 3C35A 4P56A 3TTRA 4DCYA 1J1NA 3V5AA 2F7AA 1P1QA 3BIGA 4O7MA 2UYFA 2QS2A 4I3EA 3H03A 3H6WA 3RT8A 4BDQA 1ZKBA 1IIWA 2Q8JA 4PFYA 4ZZAA 3T93B 2O68A 3PUVE 3K02A 4N6KA 3A3CA
chains in the Genus database with same CATH topology
3HFUA 3IFAA 4PF8A 1QGXA 4I3YA 3PTYA 4YZZA 2P3NA 2WX9A 1SPIA 4P8BA 3W9VA 4H45A 1G0IA 1LEVA 3ROJA 4MNIA 3T1BA 1FJ6A 1NV4A 2HZLA 3B50A 2OWZA 4OVQA 3RYDA 4PBHA 4N8GA 1FBPA 4PAIA 2F3DA 2PCRA 2CZKA 2WEFA 4HXVA 1Q9DA 1LBYA 4HE0A 1LBVA 4P1LA 4PGNA 4MX6A 2VPNA 5IZ3A 1CNQA 1FTAA 4F1VA 1LBZA 5IM2A 2HPGA 4OVRA 1FRPA 1NUXA 5JK4A 2DDKA 1NV2A 1FJ9A 3KC1A 1KA1A 4N17A 4N4UA 1NUZA 4OVSA 3D1RA 1FPLA 4MJOA 2XA5A 4HCWA 4MMPA 4MHFA 1DCUA 3LV0A 1FPKA 1FSAA 2QFLA 2WBBA 4PDHA 4PCDA 4GBVA 4QBAA 1IMDA 1RDZA 4OA4A 4F19A 5T3JA 4NQ8A 1FBEA 5I5PA 2CZHA 1FBHA 4NHBA 1FPBA 3ISPA 4G61A 4GWUA 2XWVA 1IMCA 1G0HA 2JJKA 2GQ1A 4PC9A 2QVVA 2HHMA 3EKIA 4OVTA 2FBPA 1IMFA 5DW8A 5EQ9A 2XXKA 2V4CA 4OANA 4PFIA 1LBWA 3SZPA 1FPGA 4XFEA 1IMBA 1NI9A 1NV7A 4AS4A 2L5VA 2HZKA 2CZIA 4UABA 3W9WA 1FPDA 4O94A 1FBCA 1IMEA 5EYHA 4I40A 4MNPA 1EYKA 4LN5A 4H46A 2Q8MA 2Y5LA 4PAFA 5EQAA 2HXRA 2KR0A 3LUZA 2Y5KA 4QXDA 2Q9TA 4GWZA 5EYGA 2PFYA 4NN3A 4MIJA 5ET8A 5FBPA 4F18A 5LDZA 2F5XA 1FPFA 4GX4A 5CM6A 4XF5A 4GWWA 1NV3A 4FBPA 4N81A 4DI4B 3NOHA 5F24A 2QVUA 4P9KA 1FPEA 5ET6A 2Q74A 2DE3A 1D9QA 1INPA 1NV6A 5ET5A 4NX1A 4GWSA 1DBZA 4DI3D 2DE4A 5ESYA 4NGUA 5IZ3B 4X8RA 5ET7A 2WYPA 4PAKA 2CEYA 4PF6A 1FBDA 2VT5A 2KQZA 3CHGA 4NF0A 4O7IA 2DE2A 2FIXA 2V3QA 4PETA 3GYYA 5EQ7A 4HCYA 5I7IA 4MCOA 4X04A 3A29A 1NV1A 4IR8A 4F1UA 3MSTA 3IFCA 1VDWA 2OX3A 4HE1A 2FIEA 3E79A 4MNCA 4JVIA 4P3LA 4PE3A 2WBDA 5LTCA 1EYIA 1FPJA 2BJIA 3FBPA 4P56A 2ZZXA 1JP4A 1KA0A 1FBGA 1NUWA 4PDDA 4PFRA 2FHYA 1YYZA 3BIHA 3RPLB 1YXIA 5IZ1A 2F3BA 1NV5A 2QVRA 3BIGA 3KBZA 4MAGA 2FVZA 4O8MA 2P3VA 4N8YA 4PGPA 3U65A 5IZZA 4O7MA 3QMFA 1RDXA 3E78A 5I3SA 1KZ8A 2MKZA 2PFZA 1YZ0A 4GX3A 5IGAA 4X9TA 1XI6A 1K9YA 1FPIA 1LBXA 1NV0A 1EYJA 2VPOA 4GX6A 2B4MA 4I3EA 2WYKA 2XWOA 3B8BA 1IMAA 1NUYA 4PFBA 4N6DA 5J16A 4PBQA 4GWXA 3T0JA 2XWIA 2CEXA 2ZZVA 3RPLA 4M1VA 4N91A 4YICA 2R8TA 4AS5A 3MYUA 4MEVA 3FXBA 1K9ZA 4PTKA 4NG7A 4OVPA 4GWYA 4GBWA 2B4LA 2DVZA 2XWKA 4N15A 4NAPA 5A5LA 4XEQA 2QPQA 3KC0A 1BK4A 4KXPA 4JVDA 2ZZWA 1DK4A 4N6KA 1FBFA 4HE2A 4P1EA 1AWBA 5J1DA 4P47A 1RDYA 5EQ8A 4JVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFA A;  1QGX A;  4I3Y A;  2P3N A;  1SPI A;  4H45 A;  1G0I A;  1LEV A;  3ROJ A;  1FJ6 A;  1NV4 A;  2OWZ A;  3RYD A;  1FBP A;  2F3D A;  2PCR A;  2CZK A;  2WEF A;  4HXV A;  1Q9D A;  1LBY A;  4HE0 A;  1LBV A;  5IZ3 A;  1CNQ A;  1FTA A;  1LBZ A;  1FRP A;  1NUX A;  2DDK A;  1NV2 A;  1FJ9 A;  3KC1 A;  1KA1 A;  1NUZ A;  3D1R A;  1FPL A;  4MJO A;  1DCU A;  3LV0 A;  1FPK A;  1FSA A;  2QFL A;  2WBB A;  4GBV A;  1IMD A;  1RDZ A;  5T3J A;  1FBE A;  2CZH A;  1FBH A;  1FPB A;  4G61 A;  4GWU A;  1IMC A;  1G0H A;  2JJK A;  2GQ1 A;  2QVV A;  2HHM A;  2FBP A;  1IMF A;  5DW8 A;  5EQ9 A;  1LBW A;  1FPG A;  1IMB A;  1NI9 A;  1NV7 A;  4AS4 A;  2CZI A;  1FPD A;  1FBC A;  1IME A;  5EYH A;  4I40 A;  1EYK A;  4H46 A;  2Q8M A;  2Y5L A;  5EQA A;  3LUZ A;  2Y5K A;  4QXD A;  4GWZ A;  5EYG A;  5ET8 A;  5FBP A;  5LDZ A;  1FPF A;  4GX4 A;  4GWW A;  1NV3 A;  4FBP A;  4N81 A;  5F24 A;  2QVU A;  1FPE A;  5ET6 A;  2Q74 A;  1D9Q A;  1INP A;  1NV6 A;  5ET5 A;  4GWS A;  1DBZ A;  5ESY A;  5IZ3 B;  5ET7 A;  1FBD A;  2VT5 A;  4O7I A;  2FIX A;  5EQ7 A;  3A29 A;  1NV1 A;  4IR8 A;  3IFC A;  1VDW A;  2OX3 A;  4HE1 A;  2FIE A;  2WBD A;  1EYI A;  1FPJ A;  2BJI A;  3FBP A;  1JP4 A;  1KA0 A;  1FBG A;  1NUW A;  2FHY A;  1YYZ A;  3BIH A;  3RPL B;  1YXI A;  5IZ1 A;  2F3B A;  1NV5 A;  2QVR A;  3BIG A;  3KBZ A;  2FVZ A;  2P3V A;  3QMF A;  1RDX A;  5I3S A;  1KZ8 A;  1YZ0 A;  4GX3 A;  1XI6 A;  1K9Y A;  1FPI A;  1LBX A;  1NV0 A;  1EYJ A;  4GX6 A;  4I3E A;  3B8B A;  1IMA A;  1NUY A;  5J16 A;  4GWX A;  3T0J A;  3RPL A;  2R8T A;  4AS5 A;  1K9Z A;  4PTK A;  4GWY A;  4GBW A;  5A5L A;  3KC0 A;  1BK4 A;  4KXP A;  1DK4 A;  1FBF A;  4HE2 A;  1AWB A;  1RDY A;  5EQ8 A; 
#chains in the Genus database with same CATH topology
 1IXG A;  1A54 A;  1B52 A;  2REG A;  4OFL A;  4QSC A;  1NV4 A;  2V25 A;  5AA2 B;  1B7U A;  4PAI A;  2CZK A;  1Z7N E;  2VPN A;  2DDK A;  1KA1 A;  1NUZ A;  4MHF A;  1DCU A;  5IAI A;  4PDH A;  2XHD A;  4AB5 A;  1NKX A;  3JV9 A;  4M4G A;  1P1O A;  4OER A;  4NWD A;  3KJT A;  4GWU A;  1B3H A;  1IMC A;  4F39 A;  4NF5 B;  4AB6 A;  3CRB A;  1IMF A;  4GIZ A;  3VVF A;  2DYX A;  3BFU A;  1KWH A;  1NV7 A;  3O2A A;  1H43 A;  2ONR A;  1MQG A;  3FVG A;  1MY1 A;  3FV2 A;  3LUZ A;  4OES A;  4H67 A;  4GX4 A;  2OJT A;  4G68 C;  1NFT A;  4E0X A;  5I59 B;  5IZ3 B;  4PAK A;  3IO6 A;  2AL5 A;  4DXU A;  3IOW A;  4HCY A;  4N13 A;  4OET A;  4P3L A;  3GBA A;  2CZL A;  5CBR A;  3S4U A;  3KBZ A;  4GOT A;  4QFP A;  2WKY A;  4IY5 A;  4OQO A;  2GHB A;  1B5H A;  2A5T A;  1LBX A;  2XWO A;  1R6Z A;  3FUZ A;  3OXN A;  3OO8 A;  3RPW A;  3I6V A;  4KQP A;  4R72 A;  1K9Z A;  4BDO A;  3IL1 B;  3TUS A;  2B4L A;  4N15 A;  4MF3 A;  5A5L A;  2ZZW A;  4P0I A;  4MBP A;  3IOV A;  1OLC A;  3IFA A;  4PF8 A;  3PTY A;  2VD3 A;  3SER A;  2OPD A;  4K3F A;  3FIR A;  1S7Y A;  5H8Q A;  4N4U A;  4C1T A;  2ZYM A;  1IXI A;  4MMP A;  1FSA A;  3PUW E;  2RCA A;  1FBE A;  4KFQ A;  5DT6 A;  4Q5T A;  5DW8 A;  2OK2 A;  1UTB B;  4RYA A;  3SZP A;  5TPA B;  4G8N A;  5DEX B;  2L5V A;  2CZI A;  1M5F A;  1QUI A;  4JBZ A;  3I5O A;  1N7W A;  4LN5 A;  5ITO A;  3R26 A;  3A09 A;  3FJ7 A;  2NVU B;  4QXD A;  4YB6 A;  4GWW A;  3U72 A;  2E0S A;  1O63 A;  1LCT A;  3PUY E;  1IIT A;  2DVC A;  3TAJ A;  1VDW A;  4DIG A;  3E79 A;  4JWX A;  5CMK A;  1B6H A;  1MG1 A;  1YXI A;  1NV5 A;  5AA4 A;  1QJM A;  5TP9 B;  1DOT A;  1KZ8 A;  3G7W A;  4KYE A;  4X9T A;  5EHS A;  4BDN A;  2ZYN A;  1FTL A;  2DWA A;  4BDM A;  1JVX A;  3OO6 A;  3S9M C;  4GWX A;  2A5T B;  3VDF A;  2NOO A;  1SVX B;  1LAG E;  2P0S A;  2ZNT A;  1WOD A;  5KZT A;  1NH7 A;  3OMB A;  3T1B A;  4IGR A;  3IOR A;  3RN8 A;  1Q9D A;  1LBY A;  4RJZ A;  4H65 A;  1P1W A;  1NV2 A;  1FJ9 A;  5DVI A;  4MJO A;  3H4Z A;  1IMD A;  4OA4 A;  5JK4 A;  4NQ8 A;  3MVX A;  2DP8 A;  5TPA A;  3EQ1 A;  4NE4 A;  1I6A A;  3CI8 A;  4EQB A;  4UA8 A;  3KSJ A;  3MZ1 A;  3EF7 A;  2F34 A;  4PFU A;  1LBW A;  3MUQ A;  5AA3 A;  3HO7 A;  3ILT B;  1JEU A;  2E1S A;  3MW0 A;  5EYG A;  5ET8 A;  4F18 A;  4KI0 E;  5K2X A;  3U8Q A;  5ISU A;  1TWY A;  2XX9 A;  1NV6 A;  4DI3 D;  3UA8 A;  1SI0 A;  1H45 A;  5AE4 A;  2RKM A;  4H5G A;  1FBD A;  1AMF A;  3TYH A;  1B1H A;  1PB7 A;  1OLA A;  2V84 A;  1NNP A;  2PT1 A;  4RNS A;  2FIE A;  1EZP A;  1SI1 A;  3V89 B;  2ZZX A;  1Q35 A;  3FGS A;  2F78 A;  1MH4 A;  1YAE A;  1TFA A;  2QMW A;  2HFB A;  1XI6 A;  2D21 A;  4MLV A;  2ZMB A;  3VXC A;  3RTW B;  1IEJ A;  4N6D A;  1MPC A;  4HTG A;  4G4P A;  3H7M A;  3OD7 A;  1RKM A;  4XKN A;  5DEX A;  3KG2 A;  4XEQ A;  3PGF A;  4OZ9 A;  4OEU A;  5CRY A;  3VLU A;  4P8B A;  2H9B A;  4U22 A;  2DXY A;  3TMG A;  4IO4 A;  1SW4 A;  1AL3 A;  4P1L A;  3UOR A;  2QMX A;  3B6T A;  1SW2 A;  5B70 A;  3KC1 A;  1NMU A;  1MQD A;  3U92 A;  2VHA A;  4F19 A;  5T3J A;  4F22 A;  2V3T A;  3FXQ A;  3T9H B;  2BJJ X;  3Q25 A;  4R74 A;  2JJK A;  1RYO A;  2V4C A;  3C36 A;  3UN6 A;  2XXT A;  1IUD A;  2UVJ A;  2I48 A;  5I57 B;  2O84 X;  1EYK A;  1FTM A;  2HXR A;  2KR0 A;  4OWD A;  3MP1 A;  1BIY A;  4GXS B;  5LDZ A;  4GXA A;  4DI4 B;  4KYD A;  1MXV A;  4P9K A;  2I6E A;  3SES A;  5AA2 A;  2WYP A;  3SEW A;  4O7I A;  4MCO A;  4ZEC A;  3K01 A;  2XXY A;  4MNC A;  4OEN A;  4ZED A;  3RPL B;  4OMB A;  3KBR A;  4U1Z A;  3PMW A;  3IOT A;  5IZZ A;  2VD2 A;  1RDX A;  5ICT A;  4FOR A;  1IQ7 A;  1P99 A;  1R1N A;  1CB6 A;  1NV0 A;  3EHS A;  1WVJ A;  3SEX A;  2DQV A;  2FYI A;  4PBQ A;  3RPL A;  4I1D A;  2UYE A;  4MEV A;  4ZEK A;  5CI5 A;  4Z7E A;  2V93 A;  1PB8 A;  4NAP A;  3KOT A;  3K0V A;  5H8Q B;  1FBF A;  1II5 A;  3IB2 A;  3DM0 A;  1B40 A;  2Z8F A;  2I4B A;  3HCQ A;  5H8F A;  1B4Z A;  3RYD A;  3OEN A;  2YJP A;  4EQ9 A;  2WEF A;  1IXC A;  4ELO A;  1LBZ A;  5KDT A;  3U93 A;  4F29 A;  5JEI A;  3HPI A;  2XXQ A;  1FPL A;  3KN3 A;  2Q89 A;  3TTL A;  4DZ1 A;  4IO2 A;  1WDN A;  3P7I A;  3O6I A;  2H5Y A;  4LAT A;  4ECF A;  2XXK A;  4QSE A;  1UIV A;  5H8N A;  2HZK A;  2F7B A;  1FBC A;  1XC1 A;  5ITP A;  3CFL A;  1RYX A;  4GLI A;  3GBB A;  3HHF A;  4H0W A;  5I58 B;  3UK4 A;  1US4 A;  1LBC A;  1MH3 A;  3I3V A;  4JB7 A;  3VV5 A;  2XXP A;  3VE1 B;  5F7V A;  2ONS A;  4LA9 A;  3FZV A;  1XOC A;  2ZNU A;  2OX3 A;  5I58 A;  4XXU A;  1EYI A;  1DPE A;  1POT A;  1Y1Z A;  1BTJ A;  4PGP A;  3TQL A;  1YZ0 A;  3V83 A;  3KFM A;  4H8J A;  5DTB A;  1K9Y A;  2V3U A;  4NF8 B;  3SEV A;  2IEE A;  1IZ1 A;  5HPQ A;  5I56 A;  3MYU A;  3FXB A;  3VVE A;  4I9D A;  1H3D A;  3IB0 A;  3B6Q A;  3K6V A;  1M5D A;  1UTH B;  4PF6 A;  4JVC A;  2WX9 A;  2GH9 A;  2GRV A;  3OO7 A;  3QK6 A;  2B3F A;  1MXZ A;  3IR1 A;  4PFW A;  3AXF A;  1B0L A;  1UTB A;  4F1V A;  1F9B A;  1B5J A;  1DPP A;  4LZ5 A;  3TEP A;  4IO3 A;  1SQY A;  4FE8 A;  1H76 A;  3MZ9 A;  1G0H A;  4EXK A;  3H06 B;  3EPE A;  1VFE A;  4PFI A;  4XFE A;  2VGQ A;  4AS4 A;  5DYH A;  4PFT A;  3RGY A;  4H46 A;  3M8U A;  4DE8 A;  4N6P A;  2PFY A;  1B9J A;  5CC2 A;  1MPB A;  4F31 B;  1FQF A;  4BLA A;  3K1M A;  4ELQ A;  5I84 A;  5EHM A;  3RY3 A;  4RK9 A;  3U1O A;  4F2O A;  3FVN A;  1JW4 A;  5EQ7 A;  5CMM A;  3QXM A;  3A29 A;  1OVT A;  3HN0 A;  3FBP A;  4PDD A;  4YMA A;  3TZA A;  3QMF A;  3E78 A;  5I3S A;  3DLN A;  2THI A;  3ZKK A;  1MDP 1;  4QFK A;  3M3K A;  2Z8E A;  4MFI A;  4YIC A;  4AS5 A;  1B32 A;  4ZE9 A;  2YLN A;  3DP4 A;  2RC8 A;  1L5T A;  5AA2 D;  5LOM A;  4G68 B;  4DDD A;  2ESN A;  2H4I A;  5A5X B;  1G0I A;  4FAT A;  1OQH A;  2F8D A;  1R9Q A;  1H44 A;  2HZL A;  3UIF A;  3QYT A;  1Y4C A;  2QJE A;  5ICQ A;  3G3G A;  3Q29 A;  5ELV A;  4R2B A;  1B7H A;  3FJM A;  4RPO A;  1EU8 A;  1NNF A;  4DLD A;  1JQF A;  4C1U A;  4JDF A;  2F6G A;  3TTM A;  1QKB A;  5I5P A;  3G3F A;  4PQJ A;  3QUF A;  4IB2 A;  4OVT A;  3EKI A;  2Y7K A;  3CIJ A;  4OAN A;  1IMB A;  2CMO A;  3O6G A;  4O94 A;  4PAF A;  4I40 A;  3O66 A;  2ZYK A;  1LCF A;  1VFD A;  4MIJ A;  4KCC A;  1SW1 A;  4NED A;  1HSL A;  1FPE A;  5ET6 A;  4FEC A;  1INP A;  3THI A;  1FQE A;  2Y84 A;  3M3F A;  3TDJ A;  1B3E A;  2P1S A;  3K4U A;  3MST A;  4HE1 A;  2DWI A;  1S50 A;  4JVI A;  4ZEB A;  4PE3 A;  1FPJ A;  5DVF A;  1M5B A;  1M5C A;  2XD3 A;  4OFO A;  2OPE A;  3G3I A;  5I56 B;  2ONK E;  5JTY A;  3FXU A;  4KPT A;  3B8B A;  2ANJ A;  3T96 B;  1JVY A;  4POX A;  2QS3 A;  2CEX A;  4N91 A;  1MQJ A;  5BWJ A;  4R6Y A;  1Y3P A;  2Z8D A;  1AH5 A;  1TFD A;  3D4C A;  1MY0 A;  4BDR A;  2QPQ A;  3ZSF A;  4O3A A;  5J1D A;  1O7T A;  1FCK A;  3JZJ A;  4I3Y A;  4IO7 A;  4Q30 B;  2QS1 A;  3PD9 A;  4ISU A;  4MNI A;  3VVD A;  1USY E;  1O64 A;  3OEK A;  2PBW A;  2O7I A;  4OVR A;  2H25 A;  3RUM A;  4OTE A;  4PCD A;  3IX1 A;  4F3G A;  1D9Y A;  4U4S A;  1IXH A;  3MVY A;  4YKJ A;  4YB7 A;  3T22 A;  4RA1 A;  2FBP A;  1DSN A;  1EZO A;  3F11 A;  3L6H A;  3LBS A;  1AIV A;  2F6P A;  4NF5 A;  1AOV A;  4OHN A;  3K1N A;  1Y4T A;  4IGT A;  2PVU A;  4U4X A;  1OMP A;  5CMC A;  3K1P A;  5I2N B;  1MM6 A;  1DBZ A;  1DTG A;  3DP8 A;  3SET A;  3TCH A;  2VP1 A;  5I7I A;  4OYV A;  3OEM A;  3OSQ A;  4R6K A;  5LTC A;  2XXW A;  4ZE8 A;  3WAE A;  3CR9 A;  4H1X A;  3KSX A;  4MAG A;  2P3V A;  1S9T A;  2O51 A;  2PFZ A;  1D3K A;  2H99 A;  4WED A;  1US5 A;  2XXH A;  1LBB A;  2RCB A;  2Z23 A;  1I6B A;  4X1B A;  4ELR A;  3O97 A;  3K6W A;  2ZZV A;  3RQT A;  1OQG A;  3Q27 A;  5HM4 B;  4OVP A;  4GWY A;  1QUK A;  3ONM A;  2RIN A;  1BLF A;  4DXC A;  1D4N A;  1M5E A;  4LZ7 A;  3B50 A;  1I69 A;  1FBP A;  2F35 A;  2GHA A;  2F3D A;  2PCR A;  3GXA A;  2UVH A;  4HXV A;  1MXY A;  1LAH E;  3QAX A;  2XA5 A;  1ATG A;  1B1X A;  3TFL A;  1URD A;  4GBV A;  3H3G A;  1RDZ A;  4Q0C A;  3CVG A;  3LR1 A;  5H8H B;  4KR5 A;  2Y7I A;  4EUO A;  1N04 A;  3PPR A;  3RT6 B;  4N07 A;  3S2V A;  4LQ2 A;  4WKM A;  1VR5 A;  4XTC Q;  3MVW A;  3OSR A;  5EYH A;  4RXL A;  3K00 A;  4GD5 A;  2Q9T A;  4GWZ A;  4NN3 A;  2Y7R A;  4XF5 A;  5F24 A;  2QVU A;  3H6T A;  2NXO A;  4GWS A;  2OCU A;  4P11 A;  1SYH A;  2ZYO A;  1ZMG A;  4GRK A;  2DE2 A;  4ZDM A;  5FTH A;  4G68 A;  4YKK A;  4ESW A;  2FHY A;  1YYZ A;  3TPA A;  1SBP A;  3LSX A;  4IO5 A;  1UTH A;  4FEB A;  3R7X A;  3C4M A;  5I57 A;  2VPO A;  5B7D A;  4JSO A;  1N76 A;  2I58 A;  2ABH A;  1A40 A;  1QUL A;  3GZG A;  2DVZ A;  2M8C A;  2F36 A;  4JVD A;  4KXP A;  3MPL A;  2OWT A;  3HFU A;  3EHT A;  5EYF A;  1SPI A;  3ROJ A;  1B58 A;  3B7D A;  4N8G A;  1XT8 A;  2UVG A;  4X1D A;  1LBV A;  3WAF A;  4MX6 A;  5FHN A;  1FRP A;  1NUX A;  4FAJ A;  2XXX A;  1ZIU A;  4PE5 B;  1DTZ A;  1XHY A;  2WBB A;  3JYR A;  3LSL A;  4G8M A;  1N84 A;  1B0H A;  3BBR A;  2GFE A;  1FPB A;  4O3C A;  3VFJ A;  1FPG A;  1PC3 A;  1NI9 A;  4P0G A;  1LGB C;  3T66 A;  4Q8R A;  2R9J A;  1IME A;  1NNK A;  3TOD A;  4NWC A;  2Y5K A;  3PPP A;  2F5X A;  3C33 A;  2R71 A;  1B3F A;  1D9Q A;  2RC9 A;  4TLL B;  4NGU A;  5ET7 A;  3K2D A;  5TP9 A;  2VT5 A;  2FIX A;  3M3L A;  3VXB A;  1B3L A;  1ZTY A;  4ZEF A;  4H5F A;  2PT2 A;  1B3G A;  1MY3 A;  2F97 A;  5KCJ B;  3BIH A;  2DS9 A;  4LQ5 A;  4X48 A;  4R9G A;  2YPN A;  3LC8 A;  4G77 A;  3E13 X;  2O7U A;  3SEU A;  3N26 A;  2W7Y A;  3G3J A;  2PYY A;  1A55 A;  1QKA A;  3RNN A;  4IO6 A;  3OO9 A;  1SW5 A;  3IJO B;  1DK4 A;  4TOZ A;  1FTO A;  4F3B A;  3R6U A;  2X26 A;  3C9H A;  2DSF A;  3O29 A;  3DEL B;  1N0T A;  2I3V A;  2OWZ A;  1FTJ A;  2HPG A;  1ANF A;  3LSW A;  3KOS A;  4HCW A;  2I0B A;  4BDL A;  2I0C A;  1Y20 A;  3UP9 A;  1JET A;  4OEV A;  1MQI A;  1YCJ A;  4NHB A;  4WXJ A;  5K2Y A;  2XWV A;  4DXB A;  2QVV A;  3MJN A;  5M2V A;  4NMY A;  3W9W A;  2OWS A;  1YPN A;  5I2K A;  2Y5L A;  1NL5 A;  2RC7 A;  2IA4 A;  3FXR A;  5FBP A;  4GL8 A;  4MH5 A;  1FPF A;  4FBP A;  4H8I A;  4N81 A;  5ET5 A;  4QSD A;  1OIB A;  1Q1K A;  1MXU A;  3FD3 A;  2KQZ A;  1FQA A;  3CHG A;  4GVO A;  4NF0 A;  4PET A;  1URG A;  3KN8 A;  1NV1 A;  5F1Q A;  3KN7 A;  5IKB A;  5CMB A;  2BJI A;  3IAZ A;  1JP4 A;  1KA0 A;  1FBG A;  1B7Z A;  3C32 A;  5I2K B;  1B5I A;  3ILU B;  4ND9 A;  1XVX A;  1YTV A;  3MP6 A;  5AA4 B;  1PDA A;  3FAS A;  4GQO A;  4RY1 A;  3T9V A;  1EYJ A;  2XX7 A;  2WYK A;  3PU5 A;  1IMA A;  1NUY A;  2PMS A;  2UXA A;  4JXI A;  2D3I A;  1Z7M E;  2R8T A;  1P1U A;  2OZZ A;  4NG7 A;  1GV8 A;  2XWK A;  2HCA A;  2VOZ A;  3L6G A;  4DCX A;  4ZEI A;  4HE2 A;  2XXR A;  2GQ1 A;  1AWB A;  4KHZ E;  1RDY A;  4LVQ A;  3Q28 A;  1QGX A;  3CSG A;  2I3W A;  1FW0 A;  3W9V A;  1CE2 A;  1FJ6 A;  4FED A;  4YB5 A;  5DVJ A;  3E3K A;  4HE0 A;  1TT1 A;  4U21 A;  4ZS9 A;  2F7C A;  3LSF B;  3V8X B;  3ODB A;  2G29 A;  4QBA A;  1EZ9 A;  3K6U A;  1NNT A;  2DOJ A;  3MP8 A;  3MZB A;  1LAF E;  3PUZ E;  5EQ9 A;  3QIM A;  4LUB A;  1TXF A;  2XXI A;  4QHQ A;  3TTK A;  2I49 A;  1MQH A;  3FVO A;  1UQW A;  4KCD A;  2OBG A;  4I62 A;  1MRP A;  4NTL A;  2QS4 A;  3TQW A;  1VE4 A;  1QUJ A;  5BUU A;  1LB9 A;  3U94 A;  3CG3 A;  4F3S A;  5L8D A;  4POW A;  1MPD A;  2CEY A;  3TEL A;  2X7P A;  4F1Y A;  2V3Q A;  1PBQ A;  4HW8 A;  3SKP A;  4EXL A;  4KD5 A;  2G93 A;  2REJ A;  1D9V A;  3N6T A;  3DP6 A;  3IO4 A;  1ZU0 A;  2AL4 A;  3KZG A;  3GLB A;  3N5L A;  3U65 A;  4GWO A;  2AIX A;  2MKZ A;  2PX1 A;  1FPI A;  1FQC A;  1ELJ A;  4E0W A;  5H8N B;  4YAH X;  2QRY A;  5H8S A;  4ESX A;  1LST A;  5I59 A;  4P1E A;  3FJG A;  3S9L C;  3B6W A;  4H6D A;  1LEV A;  3O9P A;  2ZXT A;  4G2Z A;  1A99 A;  3UGW A;  3IJX B;  4EQ7 A;  3IOU A;  4XIG Q;  1A8E A;  1QW0 A;  2ZNS A;  3Q26 A;  4F2Q A;  1Y3Q A;  4NF6 B;  1B4H A;  1GGG A;  2CZH A;  2XX8 A;  4LZ8 A;  4G61 A;  4XKQ A;  4YU0 A;  3TCF A;  2ALU A;  3PPO A;  1SYI A;  3MBP A;  2AYS A;  1Y1M A;  1JNF A;  4QFN A;  1PB9 A;  3HHG A;  4OVJ A;  1Y3N A;  1BP5 A;  5H8F B;  2D5W A;  3HV1 A;  4IY6 A;  4TLM B;  2DE3 A;  2Y7W A;  2DE4 A;  1ZLQ A;  3T9X B;  1B51 A;  2QL3 A;  1N3X A;  4C0R A;  1QVS A;  4AQ4 A;  4F1U A;  1VSO A;  4NF6 A;  4ELP A;  1P1N A;  1LFH A;  5HBC A;  3A3U A;  4XKP A;  4RPN A;  2QVR A;  2FVZ A;  1FQD A;  3BKI B;  3PPQ A;  4GX6 A;  4GFR A;  4OXV A;  2XWI A;  3FVK A;  5L9S A;  4FIM A;  4GBW A;  3O28 A;  3FAT A;  3RTF B;  3MWB A;  4P47 A;  4JWY A;  4M1V A;  3TKD A;  3VLV A;  2P3N A;  3CFZ A;  4H45 A;  3EHU A;  3H6V A;  1PEB A;  3PUX E;  3IB1 A;  2O1M A;  2Q2A A;  2Z22 A;  2RF1 A;  4WEP A;  3CFX A;  3MPK A;  3BFT A;  1FPK A;  2QFL A;  1FQB A;  3MC2 A;  3PMV A;  4UAC A;  2HEU A;  3PPN A;  1A7L A;  3FV1 A;  2HHM A;  1POY 1;  1JW1 A;  1GTK A;  4U23 A;  1FPD A;  1T0K A;  4ONY A;  2Q8M A;  4NF4 A;  1B05 A;  1MY2 A;  2XD2 A;  1LAX A;  5TU0 A;  5FTI A;  4U2R A;  1R9L A;  4F3P A;  5CM6 A;  1NV3 A;  5FHM A;  2Q74 A;  1URS A;  3LUY A;  3KJ7 A;  5A5X A;  2OLB A;  3ECR A;  1XVY A;  3GYY A;  4X04 A;  3E4R A;  4LP2 B;  3IFC A;  4QRZ A;  5I2N A;  4FJP A;  3K6X A;  1OVB A;  1ZBM A;  1NUW A;  3O6H A;  2HAV A;  4RK2 A;  4Z0I A;  3KGC A;  5IGA A;  2Q2C A;  1N7X A;  2B4M A;  3USD A;  1MXX A;  4NF8 A;  2HQ0 A;  4R2F A;  3T0J A;  2LAO A;  4KYS A;  3MVZ A;  3KC0 A;  1BK4 A;  1FTK A;  1N3W A;  3PV0 E;  5EQ8 A;  4R73 A;  2UVI A;  4YZZ A;  5CBS A;  3CG1 A;  2HXW A;  4OVQ A;  3OOA A;  1LFG A;  2O6A A;  2DWH A;  1LFI A;  5IZ3 A;  1FTA A;  1XS5 A;  1SD3 A;  4N17 A;  3TCG A;  3PMX A;  1JEV A;  4G8H A;  3N94 A;  4UAB A;  3G3K A;  4GL0 A;  2A5S A;  4I8C A;  1LLS A;  3S9E A;  1HSJ A;  5EQA A;  3G3H A;  2XXU A;  2O1L A;  5H8H A;  4EF2 A;  3C31 A;  3RLF E;  4QFO A;  2NUV A;  1JW5 A;  3NOH A;  1ZJL A;  2HAU A;  3TTN A;  4NX1 A;  5ESY A;  4HS7 A;  2NWJ A;  4R9F A;  5FHO A;  1MM7 A;  1GR2 A;  1MXW A;  3OEL A;  3C34 A;  4L17 A;  2XXV A;  2WBD A;  3MQ9 A;  4PFR A;  4GF8 A;  1SDX A;  4YKI A;  4JSD A;  4THI A;  5IZ1 A;  2F3B A;  2B3B A;  2Q88 A;  4O8M A;  4N8Y A;  2DWJ A;  3N6U A;  3PD8 A;  2Y7P A;  4GX3 A;  3IK6 B;  5L9M A;  1BKA A;  2O69 A;  1MY4 A;  4PFB A;  5AA1 A;  5J16 A;  2X7Q A;  2H98 A;  4LON B;  4R6H A;  4PTK A;  2I4C A;  1NH8 A;  4QFL A;  4EDP A;  2FNC A;  3SDF A;  4U1O A;  4YMB A;  4R75 A;  3HST A;  3S9N C;  4PBH A;  1LB8 A;  3CSB A;  4NF4 B;  4MLQ A;  4ZZE A;  1PBP A;  4PGN A;  1CNQ A;  1A8F A;  2FA7 A;  3D4G A;  5IM2 A;  5KCJ A;  4OVS A;  3W15 C;  1MDQ A;  3D1R A;  3LV0 A;  3KEI A;  3QSL A;  1DMB A;  1UIU A;  1HSE A;  4O3B A;  3QUJ A;  3T9U A;  4EF1 A;  3ZKL A;  1FBH A;  3ISP A;  2B65 A;  3SEY A;  4PC9 A;  1USY H;  1Y9U A;  2DXR A;  2KLF A;  3H6U A;  1I6Q A;  3MAM A;  2QSX A;  2P2A A;  1B2H A;  4JWO A;  3E9X A;  4TQU Q;  4MNP A;  4OFJ A;  5KDT B;  4XKR A;  5L9O A;  1EH3 A;  1MS7 A;  2R6G E;  4X8R A;  4YKP A;  1B46 A;  4QF9 A;  3VLW A;  4PP0 A;  5JTY B;  3ZS6 A;  4IR8 A;  1GVC A;  3EN3 A;  3C35 A;  4P56 A;  3TTR A;  4DCY A;  1J1N A;  3V5A A;  2F7A A;  1P1Q A;  3BIG A;  4O7M A;  2UYF A;  2QS2 A;  4I3E A;  3H03 A;  3H6W A;  3RT8 A;  4BDQ A;  1ZKB A;  1IIW A;  2Q8J A;  4PFY A;  4ZZA A;  3T93 B;  2O68 A;  3PUV E;  3K02 A;  4N6K A;  3A3C A; 
#chains in the Genus database with same CATH homology
 3HFU A;  3IFA A;  4PF8 A;  1QGX A;  4I3Y A;  3PTY A;  4YZZ A;  2P3N A;  2WX9 A;  1SPI A;  4P8B A;  3W9V A;  4H45 A;  1G0I A;  1LEV A;  3ROJ A;  4MNI A;  3T1B A;  1FJ6 A;  1NV4 A;  2HZL A;  3B50 A;  2OWZ A;  4OVQ A;  3RYD A;  4PBH A;  4N8G A;  1FBP A;  4PAI A;  2F3D A;  2PCR A;  2CZK A;  2WEF A;  4HXV A;  1Q9D A;  1LBY A;  4HE0 A;  1LBV A;  4P1L A;  4PGN A;  4MX6 A;  2VPN A;  5IZ3 A;  1CNQ A;  1FTA A;  4F1V A;  1LBZ A;  5IM2 A;  2HPG A;  4OVR A;  1FRP A;  1NUX A;  5JK4 A;  2DDK A;  1NV2 A;  1FJ9 A;  3KC1 A;  1KA1 A;  4N17 A;  4N4U A;  1NUZ A;  4OVS A;  3D1R A;  1FPL A;  4MJO A;  2XA5 A;  4HCW A;  4MMP A;  4MHF A;  1DCU A;  3LV0 A;  1FPK A;  1FSA A;  2QFL A;  2WBB A;  4PDH A;  4PCD A;  4GBV A;  4QBA A;  1IMD A;  1RDZ A;  4OA4 A;  4F19 A;  5T3J A;  4NQ8 A;  1FBE A;  5I5P A;  2CZH A;  1FBH A;  4NHB A;  1FPB A;  3ISP A;  4G61 A;  4GWU A;  2XWV A;  1IMC A;  1G0H A;  2JJK A;  2GQ1 A;  4PC9 A;  2QVV A;  2HHM A;  3EKI A;  4OVT A;  2FBP A;  1IMF A;  5DW8 A;  5EQ9 A;  2XXK A;  2V4C A;  4OAN A;  4PFI A;  1LBW A;  3SZP A;  1FPG A;  4XFE A;  1IMB A;  1NI9 A;  1NV7 A;  4AS4 A;  2L5V A;  2HZK A;  2CZI A;  4UAB A;  3W9W A;  1FPD A;  4O94 A;  1FBC A;  1IME A;  5EYH A;  4I40 A;  4MNP A;  1EYK A;  4LN5 A;  4H46 A;  2Q8M A;  2Y5L A;  4PAF A;  5EQA A;  2HXR A;  2KR0 A;  3LUZ A;  2Y5K A;  4QXD A;  2Q9T A;  4GWZ A;  5EYG A;  2PFY A;  4NN3 A;  4MIJ A;  5ET8 A;  5FBP A;  4F18 A;  5LDZ A;  2F5X A;  1FPF A;  4GX4 A;  5CM6 A;  4XF5 A;  4GWW A;  1NV3 A;  4FBP A;  4N81 A;  4DI4 B;  3NOH A;  5F24 A;  2QVU A;  4P9K A;  1FPE A;  5ET6 A;  2Q74 A;  2DE3 A;  1D9Q A;  1INP A;  1NV6 A;  5ET5 A;  4NX1 A;  4GWS A;  1DBZ A;  4DI3 D;  2DE4 A;  5ESY A;  4NGU A;  5IZ3 B;  4X8R A;  5ET7 A;  2WYP A;  4PAK A;  2CEY A;  4PF6 A;  1FBD A;  2VT5 A;  2KQZ A;  3CHG A;  4NF0 A;  4O7I A;  2DE2 A;  2FIX A;  2V3Q A;  4PET A;  3GYY A;  5EQ7 A;  4HCY A;  5I7I A;  4MCO A;  4X04 A;  3A29 A;  1NV1 A;  4IR8 A;  4F1U A;  3MST A;  3IFC A;  1VDW A;  2OX3 A;  4HE1 A;  2FIE A;  3E79 A;  4MNC A;  4JVI A;  4P3L A;  4PE3 A;  2WBD A;  5LTC A;  1EYI A;  1FPJ A;  2BJI A;  3FBP A;  4P56 A;  2ZZX A;  1JP4 A;  1KA0 A;  1FBG A;  1NUW A;  4PDD A;  4PFR A;  2FHY A;  1YYZ A;  3BIH A;  3RPL B;  1YXI A;  5IZ1 A;  2F3B A;  1NV5 A;  2QVR A;  3BIG A;  3KBZ A;  4MAG A;  2FVZ A;  4O8M A;  2P3V A;  4N8Y A;  4PGP A;  3U65 A;  5IZZ A;  4O7M A;  3QMF A;  1RDX A;  3E78 A;  5I3S A;  1KZ8 A;  2MKZ A;  2PFZ A;  1YZ0 A;  4GX3 A;  5IGA A;  4X9T A;  1XI6 A;  1K9Y A;  1FPI A;  1LBX A;  1NV0 A;  1EYJ A;  2VPO A;  4GX6 A;  2B4M A;  4I3E A;  2WYK A;  2XWO A;  3B8B A;  1IMA A;  1NUY A;  4PFB A;  4N6D A;  5J16 A;  4PBQ A;  4GWX A;  3T0J A;  2XWI A;  2CEX A;  2ZZV A;  3RPL A;  4M1V A;  4N91 A;  4YIC A;  2R8T A;  4AS5 A;  3MYU A;  4MEV A;  3FXB A;  1K9Z A;  4PTK A;  4NG7 A;  4OVP A;  4GWY A;  4GBW A;  2B4L A;  2DVZ A;  2XWK A;  4N15 A;  4NAP A;  5A5L A;  4XEQ A;  2QPQ A;  3KC0 A;  1BK4 A;  4KXP A;  4JVD A;  2ZZW A;  1DK4 A;  4N6K A;  1FBF A;  4HE2 A;  4P1E A;  1AWB A;  5J1D A;  4P47 A;  1RDY A;  5EQ8 A;  4JVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...