3A29A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Synthesis, SAR, and X-ray structure of tricyclic compounds as potent FBPase inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3a29A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3a29A02
5IZ3A 2QFLA 2WBDA 2FIXA 3RPLB 3KBZA 5EQ9A 1FPIA 3RYDA 1FPFA 3FBPA 1INPA 2Y5KA 4GWYA 4GBVA 1FPGA 1RDXA 2VT5A 1KA1A 1DCUA 4GX3A 2P3VA 1FPBA 5LDZA 1K9YA 5ET5A 2F3DA 1SPIA 1NV2A 1FPEA 2P3NA 2QVRA 1FBDA 1IMDA 1EYIA 4I3EA 4I3YA 1NUWA 1FJ9A 4N81A 1FJ6A 1NUXA 1EYKA 1FBHA 1FPDA 1CNQA 1Q9DA 1VDWA 3KC1A 1DK4A 1BK4A 1G0IA 1YZ0A 5FBPA 5J16A 1FBFA 2GQ1A 1EYJA 4H46A 3RPLA 1DBZA 1IMEA 2CZKA 3IFCA 2DDKA 2Q8MA 5EQ8A 2CZHA 5DW8A 5IZ3B 1NV3A 4GWUA 4FBPA 1FRPA 2QVVA 4GWXA 3KC0A 4QXDA 4MJOA 1NV7A 4GX4A 1NV4A 3BIHA 4HE1A 2QVUA 4GWWA 4AS4A 1LBYA 1IMAA 1YYZA 5ET6A 1KA0A 4HE0A 1FBGA 1FPJA 2FHYA 2HHMA 4HXVA 5ET8A 1QGXA 4H45A 5I3SA 1NUYA 4AS5A 5ESYA 2BJIA 2FBPA 2Q74A 4GBWA 1NV0A 1IMCA 1LBZA 1FBPA 1LBWA 2JJKA 4GWSA 5EQ7A 5EQAA 2WEFA 1NUZA 5ET7A 4I40A 4PTKA 2FIEA 3ROJA 2CZIA 2F3BA 3T0JA 1FBEA 3D1RA 4IR8A 2FVZA 4GX6A 1YXIA 4HE2A 1IMFA 4KXPA 5EYGA 1NV6A 3BIGA 5IZ1A 5A5LA 1FSAA 4GWZA 3LV0A 2WBBA 2PCRA 2OWZA 1LBXA 2OX3A 1LBVA 1FPLA 1IMBA 2Y5LA 3B8BA 2R8TA 3A29A 1K9ZA 1NI9A 3LUZA 1FPKA 1XI6A 1FBCA 3QMFA 1G0HA 1FTAA 1D9QA 1KZ8A 1LEVA 3IFAA 4O7IA 1NV1A 1AWBA 5EYHA 5F24A 5T3JA 1RDZA 1NV5A 1JP4A 1RDYA 4G61A
chains in the Genus database with same CATH superfamily
5IZ3A 2ZYMA 4XTCQ 4JXIA 2F35A 1MXWA 3HFUA 4QRZA 3PD8A 1VSOA 1RDXA 2Z22A 2XXHA 3MP8A 4MFIA 4GX3A 5L9MA 3TTKA 4XEQA 3N26A 4DZ1A 5IKBA 5KZTA 5TP9A 2ONRA 2W7YA 3G3JA 1JVYA 2H5YA 5AA2A 5L8DA 3MZ9A 4NF5B 3RPLA 1RKMA 3BFUA 3GBBA 2P1SA 1A8EA 5AA2D 1FW0A 4ESWA 1NNKA 4I62A 4Z7EA 5KDTB 2BJJX 1M5DA 4HE0A 3RPWA 4F29A 4LATA 2DYXA 4MX6A 4PFRA 2YPNA 4MHFA 1LFGA 3T9HB 3ISPA 4TQUQ 4KYSA 1MY3A 3FIRA 4OMBA 2XXRA 4E0WA 3G3HA 5I56B 3D1RA 3O6HA 1US4A 3OO7A 3HHFA 4F22A 4NX1A 2B4MA 3IAZA 4R2BA 4F3GA 1Y9UA 2IEEA 3C4MA 3I3VA 2ZYKA 1Q35A 3MSTA 1J1NA 1LEVA 5IGAA 3T1BA 1B1XA 4EUOA 3TEPA 2XWOA 1AIVA 3K1NA 3BBRA 3OEKA 3TCHA 2WBDA 4GOTA 3ECRA 2E1SA 4PBQA 4OANA 4NEDA 1PDAA 1FQEA 2ZZVA 2DE4A 3PPPA 2PYYA 3TCGA 4ECFA 5ICTA 3D4CA 2HAUA 5A5XA 3JYRA 1LCFA 4U21A 3UORA 1SW4A 5LOMA 4KD5A 4JSOA 1Y4TA 2A5TB 4QFLA 1QKAA 2PMSA 4F31B 5IZZA 2VHAA 1PB7A 3EF7A 4TOZA 2PFZA 3FV2A 1PC3A 3MVXA 1LBYA 4PAIA 3RTFB 4E0XA 4IO3A 4ZZEA 1LB9A 3K6UA 4GIZA 3MUQA 1XVYA 1EH3A 3CSBA 1B7ZA 5I3SA 2ESNA 4PFWA 4PQJA 5I2NB 2PT2A 3CFZA 3WAFA 2Y7WA 4GBWA 4NF5A 2DP8A 3K02A 2WEFA 3MPLA 3FVGA 5EYGA 2V3QA 4G8HA 1IQ7A 2ONSA 3O9PA 3RLFE 3TTMA 2UVHA 5KDTA 5IAIA 1BTJA 4I8CA 1WDNA 3VDFA 4H65A 1SI0A 2B3BA 1NFTA 4JWOA 3THIA 3VXBA 4RJZA 2L5VA 2RINA 4YZZA 5I56A 2HXWA 4X04A 1B0LA 3OO8A 5EQ9A 4LQ5A 4FIMA 2Q8JA 1BIYA 1GGGA 2DXRA 1B46A 1S7YA 1YPNA 4O8MA 2HPGA 4MH5A 3KOSA 1LAHE 3MP1A 4MCOA 4WKMA 3TMGA 1IITA 4OVJA 3T22A 1FTMA 1BKAA 3MP6A 4KYEA 4PF8A 4Z0IA 2NOOA 3B50A 3QSLA 3M3LA 1GVCA 2ZNUA 2D3IA 2YJPA 1FBFA 3PUZE 4C1UA 2H98A 4F3SA 1IMEA 1US5A 3GLBA 2Q8MA 1H45A 5EQ8A 4AQ4A 4OXVA 4OZ9A 1NV3A 1MQGA 1MXZA 4ZE8A 4GWXA 2QVVA 2F6GA 4LZ7A 1Y1ZA 5L9OA 3M3FA 3EQ1A 2OLBA 5ET6A 3SZPA 3TDJA 4ZEFA 2DE3A 5K2XA 4U1OA 4GXSB 1BLFA 4ELRA 1NUZA 1QUKA 1AL3A 2G29A 3KSXA 4KXPA 2DQVA 3LV0A 2WBBA 3CVGA 4H8JA 1LBXA 3UIFA 5B7DA 4R6YA 1SDXA 3VVFA 5CMKA 4O3AA 4ONYA 1UTBB 2QS2A 1FTAA 2WYKA 2ANJA 2I6EA 3C34A 1JP4A 3U92A 4ZECA 4ELQA 2RCBA 1PEBA 4THIA 2QFLA 2O7IA 3E4RA 2V25A 2QL3A 5ITOA 3S4UA 4RPOA 3PPQA 1I69A 4WXJA 3OXNA 5DYHA 4MF3A 2XD3A 4QHQA 3B6TA 4DLDA 1XS5A 3KGCA 3T9VA 3IOUA 1LAGE 1FJ6A 1CNQA 3KC1A 2XXTA 2O1MA 4YMAA 1EYJA 4Q30B 4PAFA 1MQIA 2O68A 2DDKA 2O1LA 3IOTA 3O2AA 1N7XA 1LAFE 5DVIA 2F7BA 1LB8A 1II5A 1XC1A 4N8YA 1D9VA 3K01A 2X26A 3TQWA 4U4XA 1Z7NE 1KA0A 1SD3A 4DI4B 4P3LA 3PMWA 4R72A 3TZAA 5I59B 2OWSA 1B7UA 1NV0A 2QSXA 4FORA 3RN8A 1POTA 4PDDA 3Q28A 1FQCA 4R73A 2CZIA 3SEVA 2ONKE 4KCCA 5H8HA 5H8FB 3PV0E 2Q2AA 1NV6A 4PGPA 5I2KB 5H8NB 2QS4A 4PC9A 1FTJA 1YCJA 2I3VA 3RGYA 2RKMA 1Y3QA 3HHGA 2ZZWA 1NI9A 1N84A 3TKDA 3OO9A 3W9WA 5JK4A 1JEVA 3ZKKA 2F7AA 2GHAA 2WX9A 4QFKA 1IZ1A 1B2HA 3LC8A 3QAXA 4I1DA 3FVNA 3T9UA 2Z8EA 2HZKA 1FPFA 2AL4A 1P1QA 4XIGQ 4YICA 2OK2A 1UIVA 4POXA 4GWYA 3RUMA 1JQFA 3HO7A 3OSRA 3CG3A 1IIWA 3KBRA 2VPOA 5ET5A 4GVOA 1NV2A 2X7QA 5H8SA 5I58A 1IMDA 2DWHA 4DCXA 3FXRA 3KJTA 3N5LA 3PUXE 1MQJA 1Y4CA 2Y84A 1FBHA 4TLLB 5FBPA 2G93A 2GFEA 2GQ1A 1XVXA 3KN8A 3IFCA 1OVTA 1POY1 4X9TA 4H8IA 1B3HA 4FATA 1B9JA 1Y3NA 1QVSA 4PBHA 1ANFA 4U23A 1SW5A 4KHZE 1QGXA 2Z23A 2XXXA 1NNPA 4XKQA 1TXFA 1Y3PA 4NWDA 3ODBA 4GWSA 1JNFA 1ZU0A 2V84A 4I40A 4PTKA 3H6WA 1T0KA 3DP4A 1OVBA 3VV5A 4ZEDA 3TTRA 3MBPA 3CR9A 5IM2A 3OSQA 4PE3A 2O6AA 3VVEA 1USYH 1B05A 1IMBA 3S2VA 5I57A 3EKIA 1NKXA 3A3UA 4ZEIA 3EHTA 4LZ5A 2Y7KA 1NL5A 2I3WA 5I59A 1Y20A 1B4HA 4U22A 2HFBA 3TAJA 5F7VA 4C1TA 1CE2A 1NV5A 3DELB 4MIJA 1FQDA 1ELJA 2ABHA 4L17A 2Y7PA 5H8FA 1MXUA 2Y7IA 1SYHA 4NG7A 4DDDA 1B51A 5B70A 3W15C 4XKNA 2PFYA 1FPGA 1MY2A 3UA8A 2QMXA 1JW5A 3TQLA 2HAVA 5M2VA 2F8DA 2AL5A 4NF4B 4OYVA 1WODA 3LSXA 1EU8A 1M5EA 2I49A 3Q26A 1OMPA 1ZBMA 1FRPA 2F36A 4MNIA 1D9YA 1P1OA 2RCAA 3L6HA 2F97A 3V5AA 3K2DA 4AB5A 4P11A 4BDMA 1LCTA 4DXCA 2I0BA 3OO6A 3GXAA 3H6UA 4RK2A 1JEUA 3QIMA 3MQ9A 4MEVA 3U72A 1YXIA 4O3BA 3HCQA 1FTOA 2F5XA 5A5LA 3U8QA 4PAKA 3B7DA 2XD2A 2OX3A 3GZGA 4OFOA 4IGRA 4PCDA 4EDPA 3A29A 1LAXA 1B3LA 2FNCA 4ELOA 4JBZA 1KZ8A 3FZVA 4LA9A 4DXUA 4NN3A 4OA4A 3O28A 4G4PA 1RDZA 3C36A 3DM0A 4HW8A 2DWJA 1JW1A 1S50A 2FIXA 3S9EA 4IO5A 4YB6A 4H5GA 5JTYB 4IO6A 4QF9A 3ONMA 4LZ8A 1R9QA 1FPBA 3RNNA 4EF2A 2QRYA 2F78A 2QVRA 1PB8A 4UACA 1ZJLA 2NXOA 1QJMA 5J16A 2OCUA 1WVJA 1DSNA 1SW2A 4IB2A 5TU0A 4BDQA 4F2QA 4R6HA 3VLVA 1UQWA 4F1VA 5DW8A 1FCKA 1A8FA 3E9XA 3TCFA 1IMAA 4JVDA 2H9BA 2XXVA 2FHYA 4OVSA 4NF4A 4Q0CA 4KFQA 4QSCA 4MNCA 1LBWA 2NUVA 3KN7A 3IORA 2I58A 4I9DA 3MC2A 3UK4A 3MYUA 4P0IA 1I6BA 2MKZA 1GTKA 1N0TA 5AA4B 2A5SA 3IOVA 4G8NA 3B8BA 4OVRA 5I84A 1FQBA 3FV1A 2X7PA 1TWYA 4GXAA 3KZGA 4OVPA 4Q5TA 1RDYA 4NTLA 4DI3D 1QUJA 3ILUB 4FECA 1FPIA 2XWIA 4RXLA 5FTHA 3K00A 4P8BA 4R9FA 1OLCA 2THIA 1YAEA 4HCWA 1DTGA 1MPDA 4NHBA 1K9YA 1ZLQA 1SPIA 4RK9A 2P3NA 1F9BA 3UN6A 4PDHA 4N6DA 3M3KA 2XXKA 3I6VA 1FPDA 4JSDA 3FATA 1YTVA 1PBPA 3TYHA 5AE4A 3MJNA 2Z8DA 4FAJA 3U93A 2V93A 4NF8B 3KC0A 5JTYA 4QFPA 3T96B 3FVOA 4OFLA 4XKPA 3MZBA 3LBSA 2YLNA 1UIUA 4YB7A 3H6VA 4GRKA 4XF5A 4PFIA 1NH7A 3C32A 5AA1A 4R74A 2V4CA 3F11A 1O63A 1UTHB 3MAMA 4F3PA 1LBVA 3C31A 1DMBA 5I5PA 1MM6A 5DVFA 3CHGA 1FPKA 3RQTA 1LFIA 4WEPA 3B6WA 4O7IA 1P1WA 3KG2A 2A5TA 1S9TA 3CRBA 5CMBA 4R2FA 3T9XB 5ICQA 4M1VA 4EQ9A 1B3FA 1B5JA 2HZLA 3K6VA 3PPNA 1N3XA 2OZZA 4GL8A 3PUWE 4KCDA 2VT5A 2DWIA 3WAEA 5I2NA 4N15A 4ZZAA 1B40A 3K6XA 1MPCA 3MVYA 5EHSA 1NNTA 4DE8A 4PGNA 3O97A 4IY5A 2Y7RA 4PE5B 1TFAA 1JETA 4EXKA 3PMXA 4C0RA 4QXDA 4FE8A 4MJOA 4QSEA 4OEUA 4R9GA 3KEIA 1P1UA 1ZIUA 1MH3A 4X48A 5H8QB 4G8MA 4H45A 3ZKLA 4PETA 4MMPA 3IR1A 3LSLA 1ZKBA 5KCJB 2H25A 2VOZA 1VFDA 5F1QA 2XX8A 3NOHA 2F3BA 1FBEA 4F19A 4WEDA 4HE2A 4NF8A 4GQOA 2QJEA 1D3KA 4KQPA 2Y5LA 5K2YA 1KWHA 4LUBA 2R6GE 3HV1A 3SEWA 2ZXTA 3H06B 2Q88A 2UXAA 3CFLA 4BDOA 1IUDA 1XHYA 4N13A 3TTNA 1OQGA 4BDNA 4AB6A 1ZMGA 2V3TA 3KBZA 1B3EA 3FBPA 4GBVA 1UTHA 3U65A 1NNFA 1N3WA 1P1NA 1L5TA 3B6QA 1DCUA 1A55A 3IO6A 5CMCA 5CI5A 3C35A 3N94A 5FHOA 1FBDA 1EYIA 1IXHA 1OLAA 3TTLA 1EYKA 2GH9A 4KPTA 2AYSA 1H3DA 1N7WA 3H03A 2KLFA 3O29A 3EHSA 2QMWA 5IZ3B 2XWVA 1A54A 1UTBA 3Q25A 1TFDA 1IXCA 4ZDMA 3A09A 4AS4A 4PF6A 3IB2A 1FBGA 5DEXB 2I48A 2REJA 3TELA 4DCYA 5EQ7A 5TP9B 3OELA 5J1DA 3Q29A 2ALUA 3N6UA 2PVUA 2AIXA 3QUJA 4BDLA 4GWZA 3MW0A 2DXYA 4GD5A 1FPLA 1HSEA 4K3FA 4P56A 3FJ7A 1A7LA 2P0SA 5CM6A 2HQ0A 2KQZA 3CI8A 5CMMA 4KR5A 5BUUA 3QMFA 1N04A 4ESXA 3OOAA 3FXUA 3OENA 5EYHA 1B3GA 4N91A 4NMYA 5KCJA 3K1PA 4G61A 2UVJA 3P7IA 3DLNA 5HBCA 4U2RA 3LUYA 3QUFA 4G68C 1H44A 2FYIA 3RTWB 1HSJA 1KA1A 4OTEA 2F6PA 4XFEA 1LFHA 3IJOB 2XWKA 2OPEA 3SESA 4I3EA 4MLQA 4N6PA 3S9NC 1D4NA 4JWXA 2Z8FA 1NUXA 2E0SA 4GF8A 1G0IA 1BK4A 4P1LA 4NQ8A 3H6TA 1SVXB 3FASA 1FTLA 4EF1A 5I2KA 5H8NA 5CBSA 2XXUA 3C9HA 4FBPA 3R7XA 4HS7A 3ILTB 4MAGA 3RT6B 2ZYOA 5CC2A 3DP6A 3TODA 2XXPA 5EYFA 3K0VA 2HHMA 2F7CA 5ET8A 3PU5A 3EPEA 2VD2A 3G7WA 2BJIA 1IMCA 2B3FA 1XOCA 4NF0A 5JEIA 1ZTYA 1Q1KA 5A5XB 1BP5A 4P0GA 3T66A 3E13X 4F3BA 3E79A 2FVZA 3RY3A 3IOWA 5I7IA 3U94A 5IZ1A 4O7MA 1FSAA 2H4IA 4OHNA 2DE2A 2HXRA 3D4GA 1H76A 3UGWA 2RC7A 4U4SA 3TUSA 1MS7A 2QPQA 2I4BA 3LUZA 4ZE9A 5HPQA 2RF1A 3G3FA 4FJPA 2REGA 5DEXA 4OETA 4IGTA 4IO7A 4ZS9A 1O64A 1AWBA 4XKRA 2R9JA 3RYDA 2NVUB 4EQBA 4GFRA 2LAOA 4IO4A 3A3CA 3Q27A 4LN5A 2VD3A 1O7TA 2GRVA 4N81A 3G3IA 1VR5A 1VDWA 1R6ZA 3AXFA 4OEVA 1DOTA 3SEYA 2CZKA 1MY4A 1SI1A 4BLAA 2CZHA 3N6TA 1I6AA 4GWUA 3QXMA 4POWA 4JDFA 4LQ2A 1JVXA 3BIHA 4GWOA 2UYFA 4GWWA 4KI0E 1AOVA 1Z7ME 1PBQA 3O66A 4HXVA 2IA4A 5FHNA 2HEUA 1MRPA 1LBCA 2FBPA 1QW0A 3E78A 2DS9A 4RPNA 5ET7A 4F1UA 4RY1A 3QK6A 1MXYA 4NWCA 3FJMA 2PX1A 5ELVA 1MH4A 1FTKA 1A99A 2UYEA 1MM7A 4JVIA 2I0CA 2DVCA 1K9ZA 5DVJA 2GHBA 3PPOA 3H7MA 4EXLA 3R26A 4O3CA 2VP1A 3JZJA 2PT1A 4G68B 1TT1A 1MG1A 3PUVE 1LLSA 3OD7A 5AA3A 3KOTA 1EZPA 1B5IA 2WKYA 3E3KA 3O6GA 1Q9DA 3PD9A 2B65A 3H4ZA 5CBRA 3LSWA 3SEUA 3TPAA 2ZNTA 4X1BA 4GL0A 3PUYE 1NV7A 1NV4A 1B5HA 4DXBA 3IB1A 4PFBA 3S9LC 3R6UA 2KR0A 3KFMA 4ISUA 4RNSA 1MXVA 1SYIA 2CMOA 3V8XB 1MQHA 2ZNSA 1LBZA 4KYDA 3VLUA 2JJKA 5HM4B 2R71A 1B52A 3T0JA 1VE4A 1MPBA 1IMFA 3L6GA 4TLMB 4YMBA 1DPPA 3SERA 1B6HA 2OWZA 4OVTA 4MBPA 3SDFA 2XA5A 2O51A 2I4CA 4EQ7A 1SW1A 3IX1A 2O69A 4QFOA 1Y1MA 4OQOA 2VPNA 3T93B 1URDA 4YKJA 3H3GA 3G3KA 5F24A 1FQAA 3ZS6A 2FA7A 3ZSFA 4H6DA 2WYPA 3VVDA 4NGUA 4RA1A 1NH8A 4MNPA 4OWDA 1QUIA 2B4LA 3M8UA 1ATGA 1N76A 3OMBA 5H8HB 4FEBA 3UP9A 3SETA 3FGSA 5LDZA 2O7UA 5CRYA 3GYYA 3K6WA 1FPEA 1MY1A 1FJ9A 5FTIA 3BFTA 4PFTA 4N8GA 4MLVA 2RC8A 4OESA 4F39A 1DK4A 4G68A 1YZ0A 2OPDA 4ND9A 2ZZXA 3MVZA 3KSJA 3G3GA 4QBAA 1GV8A 3LSFB 3MWBA 1DBZA 5AA4A 3V89B 2DSFA 2VGQA 1URGA 2NWJA 4ELPA 5DT6A 1QULA 4DIGA 3IK6B 3FJGA 5ISUA 4G77A 4GX4A 2XXYA 4H1XA 3FXBA 4HCYA 4NAPA 2QVUA 2F34A 3IJXB 1FPJA 4F1YA 5ESYA 1SBPA 1IXGA 4YAHX 2Q74A 2Q9TA 5I58B 4H5FA 1IEJA 5EQAA 3K4UA 4OVQA 4H0WA 4GX6A 2ZMBA 4N07A 1QKBA 3VLWA 1H43A 4XXUA 2QS1A 4RYAA 4IY6A 3GBAA 1IXIA 3S9MC 2R8TA 1P99A 4N17A 3RT8A 2XXWA 2CEYA 4O94A 3C33A 3CIJA 2QS3A 3PTYA 1FBCA 2OWTA 1M5CA 4M4GA 1LGBC 5T3JA 1I6QA 1OIBA 1DTZA 5BWJA 2M8CA 4UABA 1B7HA 1B58A 4UA8A 1A40A 3HN0A 2V3UA 5ITPA 1RYOA 2Y5KA 2Q89A 3VXCA 3FVKA 2CZLA 2ZYNA 1MDQA 5I57B 3U1OA 4OENA 5EHMA 5FHMA 5TPAB 2OBGA 4G2ZA 1OQHA 2Q2CA 2XX7A 3LR1A 5L9SA 4PFUA 4U1ZA 3KJ7A 3SEXA 4H46A 3MVWA 4P9KA 2XHDA 4OERA 1R9LA 3VE1B 3QYTA 4YKPA 2XXQA 4X1DA 4HE1A 4FEDA 1YYZA 3CSGA 2DWAA 4R75A 4YB5A 2XXIA 3KN3A 3EHUA 1NUYA 4NF6B 4AS5A 2D21A 3USDA 4GLIA 2PBWA 1GR2A 3PMVA 1FBPA 3IO4A 1R1NA 3JV9A 3FXQA 3PGFA 4ZEKA 3OEMA 5DTBA 4OFJA 2XX9A 1B1HA 1M5BA 4IR8A 1VFEA 1DPEA 1MXXA 4F18A 4QFNA 4LONB 1LBBA 2RC9A 1SQYA 4YKIA 1AMFA 1D9QA 1JW4A 2HCAA 1B4ZA 4N4UA 4Q8RA 1NV1A 3SKPA 2DVZA 2O84X 4QSDA 5AA2B 1B32A 4YKKA 3TFLA 4LVQA 3DP8A 1AH5A 3RPLB 4PFYA 4F2OA 1RYXA 1INPA 3BKIB 5H8QA 2D5WA 2P3VA 4R6KA 2F3DA 3K1MA 4I3YA 1NUWA 1URSA 3PPRA 3FD3A 4PP0A 1EZ9A 1FQFA 1M5FA 1CB6A 5LTCA 3V83A 2OJTA 3IL1B 4JWYA 4ZEBA 1USYE 4HTGA 3FUZA 4YU0A 1EZOA 4IO2A 3HSTA 4X8RA 2P2AA 4N6KA 1HSLA 3CG1A 5TPAA 2H99A 4LP2B 2DOJA 3MZ1A 1PB9A 4NE4A 1NMUA 2FIEA 3ROJA 1LSTA 2UVIA 4BDRA 3BIGA 3MPKA 3O6IA 2PCRA 1MY0A 3HPIA 4P47A 2UVGA 2CEXA 3EN3A 1MQDA 3CFXA 1MDP1 3I5OA 4P1EA 4NF6A 1XI6A 1XT8A 3W9VA 1B0HA 1G0HA 3IFAA 3IB0A 3VFJA 4JB7A 4H67A 4JVCA
chains in the Genus database with same CATH topology
5IZ3A 2HZLA 2HZKA 1FPFA 4YICA 3HFUA 4GWYA 1RDXA 2VT5A 4GX3A 2VPOA 4N15A 4XEQA 5ET5A 1NV2A 1IMDA 4PGNA 1FBHA 1Q9DA 5FBPA 2GQ1A 3RPLA 3IFCA 4X9TA 4QXDA 4MJOA 1NV7A 4PBHA 1NV4A 4PFBA 2KR0A 4HE0A 1QGXA 4H45A 4MX6A 4PFRA 4PETA 4MMPA 4MHFA 1LBZA 3ISPA 2JJKA 4GWSA 4I40A 4PTKA 3NOHA 2F3BA 3T0JA 1FBEA 3D1RA 4F19A 4HE2A 1IMFA 5IM2A 4PE3A 4NX1A 2B4MA 2OWZA 4OVTA 1IMBA 2XA5A 2Y5LA 3EKIA 2VPNA 3MSTA 1LEVA 5IGAA 3T1BA 2XWOA 5F24A 1NV5A 4MIJA 2WBDA 2WYPA 3KBZA 3FBPA 4NG7A 4NGUA 4PBQA 4OANA 4MNPA 4GBVA 2B4LA 2ZZVA 2PFYA 1FPGA 3U65A 1DCUA 5LDZA 2DE4A 3GYYA 1FPEA 1FBDA 1EYIA 1FJ9A 4N8GA 1EYKA 1DK4A 1YZ0A 2ZZXA 4QBAA 1DBZA 5IZZA 5IZ3B 1FRPA 2PFZA 2XWVA 4MNIA 4GX4A 3FXBA 4HCYA 4NAPA 2QVUA 4AS4A 1LBYA 4PAIA 4PF6A 1FBGA 1FPJA 5I3SA 5ESYA 2Q74A 2Q9TA 4GBWA 5EQ7A 5EQAA 2WEFA 5J1DA 4OVQA 4MEVA 4GX6A 1YXIA 5EYGA 2F5XA 5A5LA 4GWZA 2V3QA 4PAKA 2OX3A 1FPLA 4P56A 5CM6A 2R8TA 4N17A 4PCDA 3A29A 2CEYA 2KQZA 4O94A 3PTYA 1FBCA 3QMFA 1KZ8A 4NN3A 5T3JA 5EYHA 4N91A 4OA4A 1RDZA 2L5VA 4G61A 4YZZA 4UABA 2FIXA 4X04A 5EQ9A 2Y5KA 1KA1A 4O8MA 2HPGA 4XFEA 1FPBA 4MCOA 2QVRA 4PF8A 2XWKA 4I3EA 1NUXA 5J16A 1G0IA 1BK4A 3B50A 4P1LA 4NQ8A 1FBFA 4H46A 1IMEA 2Q8MA 4P9KA 4F1VA 5EQ8A 5DW8A 1NV3A 4FBPA 4GWXA 2QVVA 4MAGA 4HE1A 1IMAA 1YYZA 4JVDA 5ET6A 3SZPA 2FHYA 2HHMA 4OVSA 5ET8A 1NUYA 4AS5A 2DE3A 2BJIA 1IMCA 4NF0A 4MNCA 1FBPA 1LBWA 1NUZA 3MYUA 4IR8A 3E79A 2FVZA 4KXPA 5I7IA 5IZ1A 2MKZA 1FSAA 4O7MA 3LV0A 2WBBA 2DE2A 2HXRA 1LBXA 4F18A 3B8BA 4OVRA 2QPQA 3LUZA 1FTAA 1D9QA 2WYKA 4N4UA 1NV1A 1AWBA 4OVPA 2DVZA 1JP4A 1RDYA 4DI3D 2QFLA 3RPLB 1FPIA 3RYDA 2XWIA 1INPA 4P8BA 4HCWA 2P3VA 4NHBA 1K9YA 2F3DA 1SPIA 4LN5A 2P3NA 4PDHA 4I3YA 1NUWA 4N6DA 4N81A 1FJ6A 2XXKA 1FPDA 1CNQA 1VDWA 3KC1A 1EYJA 4PAFA 5LTCA 2CZKA 2DDKA 2CZHA 4GWUA 3KC0A 4N8YA 3BIHA 4GWWA 4X8RA 4N6KA 1KA0A 4HXVA 4DI4B 4P3LA 2FBPA 1NV0A 3E78A 4XF5A 4PFIA 4PDDA 5ET7A 2FIEA 3ROJA 2CZIA 4F1UA 1NV6A 3BIGA 4PGPA 2PCRA 2V4CA 1LBVA 4PC9A 5I5PA 4P47A 4JVIA 3CHGA 1K9ZA 2CEXA 2ZZWA 1NI9A 4P1EA 1FPKA 1XI6A 3W9VA 1G0HA 3IFAA 4O7IA 3W9WA 5JK4A 2WX9A 4JVCA 4M1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IZ3 A;  2QFL A;  2WBD A;  2FIX A;  3RPL B;  3KBZ A;  5EQ9 A;  1FPI A;  3RYD A;  1FPF A;  3FBP A;  1INP A;  2Y5K A;  4GWY A;  4GBV A;  1FPG A;  1RDX A;  2VT5 A;  1KA1 A;  1DCU A;  4GX3 A;  2P3V A;  1FPB A;  5LDZ A;  1K9Y A;  5ET5 A;  2F3D A;  1SPI A;  1NV2 A;  1FPE A;  2P3N A;  2QVR A;  1FBD A;  1IMD A;  1EYI A;  4I3E A;  4I3Y A;  1NUW A;  1FJ9 A;  4N81 A;  1FJ6 A;  1NUX A;  1EYK A;  1FBH A;  1FPD A;  1CNQ A;  1Q9D A;  1VDW A;  3KC1 A;  1DK4 A;  1BK4 A;  1G0I A;  1YZ0 A;  5FBP A;  5J16 A;  1FBF A;  2GQ1 A;  1EYJ A;  4H46 A;  3RPL A;  1DBZ A;  1IME A;  2CZK A;  3IFC A;  2DDK A;  2Q8M A;  5EQ8 A;  2CZH A;  5DW8 A;  5IZ3 B;  1NV3 A;  4GWU A;  4FBP A;  1FRP A;  2QVV A;  4GWX A;  3KC0 A;  4QXD A;  4MJO A;  1NV7 A;  4GX4 A;  1NV4 A;  3BIH A;  4HE1 A;  2QVU A;  4GWW A;  4AS4 A;  1LBY A;  1IMA A;  1YYZ A;  5ET6 A;  1KA0 A;  4HE0 A;  1FBG A;  1FPJ A;  2FHY A;  2HHM A;  4HXV A;  5ET8 A;  1QGX A;  4H45 A;  5I3S A;  1NUY A;  4AS5 A;  5ESY A;  2BJI A;  2FBP A;  2Q74 A;  4GBW A;  1NV0 A;  1IMC A;  1LBZ A;  1FBP A;  1LBW A;  2JJK A;  4GWS A;  5EQ7 A;  5EQA A;  2WEF A;  1NUZ A;  5ET7 A;  4I40 A;  4PTK A;  2FIE A;  3ROJ A;  2CZI A;  2F3B A;  3T0J A;  1FBE A;  3D1R A;  4IR8 A;  2FVZ A;  4GX6 A;  1YXI A;  4HE2 A;  1IMF A;  4KXP A;  5EYG A;  1NV6 A;  3BIG A;  5IZ1 A;  5A5L A;  1FSA A;  4GWZ A;  3LV0 A;  2WBB A;  2PCR A;  2OWZ A;  1LBX A;  2OX3 A;  1LBV A;  1FPL A;  1IMB A;  2Y5L A;  3B8B A;  2R8T A;  3A29 A;  1K9Z A;  1NI9 A;  3LUZ A;  1FPK A;  1XI6 A;  1FBC A;  3QMF A;  1G0H A;  1FTA A;  1D9Q A;  1KZ8 A;  1LEV A;  3IFA A;  4O7I A;  1NV1 A;  1AWB A;  5EYH A;  5F24 A;  5T3J A;  1RDZ A;  1NV5 A;  1JP4 A;  1RDY A;  4G61 A; 
#chains in the Genus database with same CATH topology
 5IZ3 A;  2ZYM A;  4XTC Q;  4JXI A;  2F35 A;  1MXW A;  3HFU A;  4QRZ A;  3PD8 A;  1VSO A;  1RDX A;  2Z22 A;  2XXH A;  3MP8 A;  4MFI A;  4GX3 A;  5L9M A;  3TTK A;  4XEQ A;  3N26 A;  4DZ1 A;  5IKB A;  5KZT A;  5TP9 A;  2ONR A;  2W7Y A;  3G3J A;  1JVY A;  2H5Y A;  5AA2 A;  5L8D A;  3MZ9 A;  4NF5 B;  3RPL A;  1RKM A;  3BFU A;  3GBB A;  2P1S A;  1A8E A;  5AA2 D;  1FW0 A;  4ESW A;  1NNK A;  4I62 A;  4Z7E A;  5KDT B;  2BJJ X;  1M5D A;  4HE0 A;  3RPW A;  4F29 A;  4LAT A;  2DYX A;  4MX6 A;  4PFR A;  2YPN A;  4MHF A;  1LFG A;  3T9H B;  3ISP A;  4TQU Q;  4KYS A;  1MY3 A;  3FIR A;  4OMB A;  2XXR A;  4E0W A;  3G3H A;  5I56 B;  3D1R A;  3O6H A;  1US4 A;  3OO7 A;  3HHF A;  4F22 A;  4NX1 A;  2B4M A;  3IAZ A;  4R2B A;  4F3G A;  1Y9U A;  2IEE A;  3C4M A;  3I3V A;  2ZYK A;  1Q35 A;  3MST A;  1J1N A;  1LEV A;  5IGA A;  3T1B A;  1B1X A;  4EUO A;  3TEP A;  2XWO A;  1AIV A;  3K1N A;  3BBR A;  3OEK A;  3TCH A;  2WBD A;  4GOT A;  3ECR A;  2E1S A;  4PBQ A;  4OAN A;  4NED A;  1PDA A;  1FQE A;  2ZZV A;  2DE4 A;  3PPP A;  2PYY A;  3TCG A;  4ECF A;  5ICT A;  3D4C A;  2HAU A;  5A5X A;  3JYR A;  1LCF A;  4U21 A;  3UOR A;  1SW4 A;  5LOM A;  4KD5 A;  4JSO A;  1Y4T A;  2A5T B;  4QFL A;  1QKA A;  2PMS A;  4F31 B;  5IZZ A;  2VHA A;  1PB7 A;  3EF7 A;  4TOZ A;  2PFZ A;  3FV2 A;  1PC3 A;  3MVX A;  1LBY A;  4PAI A;  3RTF B;  4E0X A;  4IO3 A;  4ZZE A;  1LB9 A;  3K6U A;  4GIZ A;  3MUQ A;  1XVY A;  1EH3 A;  3CSB A;  1B7Z A;  5I3S A;  2ESN A;  4PFW A;  4PQJ A;  5I2N B;  2PT2 A;  3CFZ A;  3WAF A;  2Y7W A;  4GBW A;  4NF5 A;  2DP8 A;  3K02 A;  2WEF A;  3MPL A;  3FVG A;  5EYG A;  2V3Q A;  4G8H A;  1IQ7 A;  2ONS A;  3O9P A;  3RLF E;  3TTM A;  2UVH A;  5KDT A;  5IAI A;  1BTJ A;  4I8C A;  1WDN A;  3VDF A;  4H65 A;  1SI0 A;  2B3B A;  1NFT A;  4JWO A;  3THI A;  3VXB A;  4RJZ A;  2L5V A;  2RIN A;  4YZZ A;  5I56 A;  2HXW A;  4X04 A;  1B0L A;  3OO8 A;  5EQ9 A;  4LQ5 A;  4FIM A;  2Q8J A;  1BIY A;  1GGG A;  2DXR A;  1B46 A;  1S7Y A;  1YPN A;  4O8M A;  2HPG A;  4MH5 A;  3KOS A;  1LAH E;  3MP1 A;  4MCO A;  4WKM A;  3TMG A;  1IIT A;  4OVJ A;  3T22 A;  1FTM A;  1BKA A;  3MP6 A;  4KYE A;  4PF8 A;  4Z0I A;  2NOO A;  3B50 A;  3QSL A;  3M3L A;  1GVC A;  2ZNU A;  2D3I A;  2YJP A;  1FBF A;  3PUZ E;  4C1U A;  2H98 A;  4F3S A;  1IME A;  1US5 A;  3GLB A;  2Q8M A;  1H45 A;  5EQ8 A;  4AQ4 A;  4OXV A;  4OZ9 A;  1NV3 A;  1MQG A;  1MXZ A;  4ZE8 A;  4GWX A;  2QVV A;  2F6G A;  4LZ7 A;  1Y1Z A;  5L9O A;  3M3F A;  3EQ1 A;  2OLB A;  5ET6 A;  3SZP A;  3TDJ A;  4ZEF A;  2DE3 A;  5K2X A;  4U1O A;  4GXS B;  1BLF A;  4ELR A;  1NUZ A;  1QUK A;  1AL3 A;  2G29 A;  3KSX A;  4KXP A;  2DQV A;  3LV0 A;  2WBB A;  3CVG A;  4H8J A;  1LBX A;  3UIF A;  5B7D A;  4R6Y A;  1SDX A;  3VVF A;  5CMK A;  4O3A A;  4ONY A;  1UTB B;  2QS2 A;  1FTA A;  2WYK A;  2ANJ A;  2I6E A;  3C34 A;  1JP4 A;  3U92 A;  4ZEC A;  4ELQ A;  2RCB A;  1PEB A;  4THI A;  2QFL A;  2O7I A;  3E4R A;  2V25 A;  2QL3 A;  5ITO A;  3S4U A;  4RPO A;  3PPQ A;  1I69 A;  4WXJ A;  3OXN A;  5DYH A;  4MF3 A;  2XD3 A;  4QHQ A;  3B6T A;  4DLD A;  1XS5 A;  3KGC A;  3T9V A;  3IOU A;  1LAG E;  1FJ6 A;  1CNQ A;  3KC1 A;  2XXT A;  2O1M A;  4YMA A;  1EYJ A;  4Q30 B;  4PAF A;  1MQI A;  2O68 A;  2DDK A;  2O1L A;  3IOT A;  3O2A A;  1N7X A;  1LAF E;  5DVI A;  2F7B A;  1LB8 A;  1II5 A;  1XC1 A;  4N8Y A;  1D9V A;  3K01 A;  2X26 A;  3TQW A;  4U4X A;  1Z7N E;  1KA0 A;  1SD3 A;  4DI4 B;  4P3L A;  3PMW A;  4R72 A;  3TZA A;  5I59 B;  2OWS A;  1B7U A;  1NV0 A;  2QSX A;  4FOR A;  3RN8 A;  1POT A;  4PDD A;  3Q28 A;  1FQC A;  4R73 A;  2CZI A;  3SEV A;  2ONK E;  4KCC A;  5H8H A;  5H8F B;  3PV0 E;  2Q2A A;  1NV6 A;  4PGP A;  5I2K B;  5H8N B;  2QS4 A;  4PC9 A;  1FTJ A;  1YCJ A;  2I3V A;  3RGY A;  2RKM A;  1Y3Q A;  3HHG A;  2ZZW A;  1NI9 A;  1N84 A;  3TKD A;  3OO9 A;  3W9W A;  5JK4 A;  1JEV A;  3ZKK A;  2F7A A;  2GHA A;  2WX9 A;  4QFK A;  1IZ1 A;  1B2H A;  3LC8 A;  3QAX A;  4I1D A;  3FVN A;  3T9U A;  2Z8E A;  2HZK A;  1FPF A;  2AL4 A;  1P1Q A;  4XIG Q;  4YIC A;  2OK2 A;  1UIV A;  4POX A;  4GWY A;  3RUM A;  1JQF A;  3HO7 A;  3OSR A;  3CG3 A;  1IIW A;  3KBR A;  2VPO A;  5ET5 A;  4GVO A;  1NV2 A;  2X7Q A;  5H8S A;  5I58 A;  1IMD A;  2DWH A;  4DCX A;  3FXR A;  3KJT A;  3N5L A;  3PUX E;  1MQJ A;  1Y4C A;  2Y84 A;  1FBH A;  4TLL B;  5FBP A;  2G93 A;  2GFE A;  2GQ1 A;  1XVX A;  3KN8 A;  3IFC A;  1OVT A;  1POY 1;  4X9T A;  4H8I A;  1B3H A;  4FAT A;  1B9J A;  1Y3N A;  1QVS A;  4PBH A;  1ANF A;  4U23 A;  1SW5 A;  4KHZ E;  1QGX A;  2Z23 A;  2XXX A;  1NNP A;  4XKQ A;  1TXF A;  1Y3P A;  4NWD A;  3ODB A;  4GWS A;  1JNF A;  1ZU0 A;  2V84 A;  4I40 A;  4PTK A;  3H6W A;  1T0K A;  3DP4 A;  1OVB A;  3VV5 A;  4ZED A;  3TTR A;  3MBP A;  3CR9 A;  5IM2 A;  3OSQ A;  4PE3 A;  2O6A A;  3VVE A;  1USY H;  1B05 A;  1IMB A;  3S2V A;  5I57 A;  3EKI A;  1NKX A;  3A3U A;  4ZEI A;  3EHT A;  4LZ5 A;  2Y7K A;  1NL5 A;  2I3W A;  5I59 A;  1Y20 A;  1B4H A;  4U22 A;  2HFB A;  3TAJ A;  5F7V A;  4C1T A;  1CE2 A;  1NV5 A;  3DEL B;  4MIJ A;  1FQD A;  1ELJ A;  2ABH A;  4L17 A;  2Y7P A;  5H8F A;  1MXU A;  2Y7I A;  1SYH A;  4NG7 A;  4DDD A;  1B51 A;  5B70 A;  3W15 C;  4XKN A;  2PFY A;  1FPG A;  1MY2 A;  3UA8 A;  2QMX A;  1JW5 A;  3TQL A;  2HAV A;  5M2V A;  2F8D A;  2AL5 A;  4NF4 B;  4OYV A;  1WOD A;  3LSX A;  1EU8 A;  1M5E A;  2I49 A;  3Q26 A;  1OMP A;  1ZBM A;  1FRP A;  2F36 A;  4MNI A;  1D9Y A;  1P1O A;  2RCA A;  3L6H A;  2F97 A;  3V5A A;  3K2D A;  4AB5 A;  4P11 A;  4BDM A;  1LCT A;  4DXC A;  2I0B A;  3OO6 A;  3GXA A;  3H6U A;  4RK2 A;  1JEU A;  3QIM A;  3MQ9 A;  4MEV A;  3U72 A;  1YXI A;  4O3B A;  3HCQ A;  1FTO A;  2F5X A;  5A5L A;  3U8Q A;  4PAK A;  3B7D A;  2XD2 A;  2OX3 A;  3GZG A;  4OFO A;  4IGR A;  4PCD A;  4EDP A;  3A29 A;  1LAX A;  1B3L A;  2FNC A;  4ELO A;  4JBZ A;  1KZ8 A;  3FZV A;  4LA9 A;  4DXU A;  4NN3 A;  4OA4 A;  3O28 A;  4G4P A;  1RDZ A;  3C36 A;  3DM0 A;  4HW8 A;  2DWJ A;  1JW1 A;  1S50 A;  2FIX A;  3S9E A;  4IO5 A;  4YB6 A;  4H5G A;  5JTY B;  4IO6 A;  4QF9 A;  3ONM A;  4LZ8 A;  1R9Q A;  1FPB A;  3RNN A;  4EF2 A;  2QRY A;  2F78 A;  2QVR A;  1PB8 A;  4UAC A;  1ZJL A;  2NXO A;  1QJM A;  5J16 A;  2OCU A;  1WVJ A;  1DSN A;  1SW2 A;  4IB2 A;  5TU0 A;  4BDQ A;  4F2Q A;  4R6H A;  3VLV A;  1UQW A;  4F1V A;  5DW8 A;  1FCK A;  1A8F A;  3E9X A;  3TCF A;  1IMA A;  4JVD A;  2H9B A;  2XXV A;  2FHY A;  4OVS A;  4NF4 A;  4Q0C A;  4KFQ A;  4QSC A;  4MNC A;  1LBW A;  2NUV A;  3KN7 A;  3IOR A;  2I58 A;  4I9D A;  3MC2 A;  3UK4 A;  3MYU A;  4P0I A;  1I6B A;  2MKZ A;  1GTK A;  1N0T A;  5AA4 B;  2A5S A;  3IOV A;  4G8N A;  3B8B A;  4OVR A;  5I84 A;  1FQB A;  3FV1 A;  2X7P A;  1TWY A;  4GXA A;  3KZG A;  4OVP A;  4Q5T A;  1RDY A;  4NTL A;  4DI3 D;  1QUJ A;  3ILU B;  4FEC A;  1FPI A;  2XWI A;  4RXL A;  5FTH A;  3K00 A;  4P8B A;  4R9F A;  1OLC A;  2THI A;  1YAE A;  4HCW A;  1DTG A;  1MPD A;  4NHB A;  1K9Y A;  1ZLQ A;  1SPI A;  4RK9 A;  2P3N A;  1F9B A;  3UN6 A;  4PDH A;  4N6D A;  3M3K A;  2XXK A;  3I6V A;  1FPD A;  4JSD A;  3FAT A;  1YTV A;  1PBP A;  3TYH A;  5AE4 A;  3MJN A;  2Z8D A;  4FAJ A;  3U93 A;  2V93 A;  4NF8 B;  3KC0 A;  5JTY A;  4QFP A;  3T96 B;  3FVO A;  4OFL A;  4XKP A;  3MZB A;  3LBS A;  2YLN A;  1UIU A;  4YB7 A;  3H6V A;  4GRK A;  4XF5 A;  4PFI A;  1NH7 A;  3C32 A;  5AA1 A;  4R74 A;  2V4C A;  3F11 A;  1O63 A;  1UTH B;  3MAM A;  4F3P A;  1LBV A;  3C31 A;  1DMB A;  5I5P A;  1MM6 A;  5DVF A;  3CHG A;  1FPK A;  3RQT A;  1LFI A;  4WEP A;  3B6W A;  4O7I A;  1P1W A;  3KG2 A;  2A5T A;  1S9T A;  3CRB A;  5CMB A;  4R2F A;  3T9X B;  5ICQ A;  4M1V A;  4EQ9 A;  1B3F A;  1B5J A;  2HZL A;  3K6V A;  3PPN A;  1N3X A;  2OZZ A;  4GL8 A;  3PUW E;  4KCD A;  2VT5 A;  2DWI A;  3WAE A;  5I2N A;  4N15 A;  4ZZA A;  1B40 A;  3K6X A;  1MPC A;  3MVY A;  5EHS A;  1NNT A;  4DE8 A;  4PGN A;  3O97 A;  4IY5 A;  2Y7R A;  4PE5 B;  1TFA A;  1JET A;  4EXK A;  3PMX A;  4C0R A;  4QXD A;  4FE8 A;  4MJO A;  4QSE A;  4OEU A;  4R9G A;  3KEI A;  1P1U A;  1ZIU A;  1MH3 A;  4X48 A;  5H8Q B;  4G8M A;  4H45 A;  3ZKL A;  4PET A;  4MMP A;  3IR1 A;  3LSL A;  1ZKB A;  5KCJ B;  2H25 A;  2VOZ A;  1VFD A;  5F1Q A;  2XX8 A;  3NOH A;  2F3B A;  1FBE A;  4F19 A;  4WED A;  4HE2 A;  4NF8 A;  4GQO A;  2QJE A;  1D3K A;  4KQP A;  2Y5L A;  5K2Y A;  1KWH A;  4LUB A;  2R6G E;  3HV1 A;  3SEW A;  2ZXT A;  3H06 B;  2Q88 A;  2UXA A;  3CFL A;  4BDO A;  1IUD A;  1XHY A;  4N13 A;  3TTN A;  1OQG A;  4BDN A;  4AB6 A;  1ZMG A;  2V3T A;  3KBZ A;  1B3E A;  3FBP A;  4GBV A;  1UTH A;  3U65 A;  1NNF A;  1N3W A;  1P1N A;  1L5T A;  3B6Q A;  1DCU A;  1A55 A;  3IO6 A;  5CMC A;  5CI5 A;  3C35 A;  3N94 A;  5FHO A;  1FBD A;  1EYI A;  1IXH A;  1OLA A;  3TTL A;  1EYK A;  2GH9 A;  4KPT A;  2AYS A;  1H3D A;  1N7W A;  3H03 A;  2KLF A;  3O29 A;  3EHS A;  2QMW A;  5IZ3 B;  2XWV A;  1A54 A;  1UTB A;  3Q25 A;  1TFD A;  1IXC A;  4ZDM A;  3A09 A;  4AS4 A;  4PF6 A;  3IB2 A;  1FBG A;  5DEX B;  2I48 A;  2REJ A;  3TEL A;  4DCY A;  5EQ7 A;  5TP9 B;  3OEL A;  5J1D A;  3Q29 A;  2ALU A;  3N6U A;  2PVU A;  2AIX A;  3QUJ A;  4BDL A;  4GWZ A;  3MW0 A;  2DXY A;  4GD5 A;  1FPL A;  1HSE A;  4K3F A;  4P56 A;  3FJ7 A;  1A7L A;  2P0S A;  5CM6 A;  2HQ0 A;  2KQZ A;  3CI8 A;  5CMM A;  4KR5 A;  5BUU A;  3QMF A;  1N04 A;  4ESX A;  3OOA A;  3FXU A;  3OEN A;  5EYH A;  1B3G A;  4N91 A;  4NMY A;  5KCJ A;  3K1P A;  4G61 A;  2UVJ A;  3P7I A;  3DLN A;  5HBC A;  4U2R A;  3LUY A;  3QUF A;  4G68 C;  1H44 A;  2FYI A;  3RTW B;  1HSJ A;  1KA1 A;  4OTE A;  2F6P A;  4XFE A;  1LFH A;  3IJO B;  2XWK A;  2OPE A;  3SES A;  4I3E A;  4MLQ A;  4N6P A;  3S9N C;  1D4N A;  4JWX A;  2Z8F A;  1NUX A;  2E0S A;  4GF8 A;  1G0I A;  1BK4 A;  4P1L A;  4NQ8 A;  3H6T A;  1SVX B;  3FAS A;  1FTL A;  4EF1 A;  5I2K A;  5H8N A;  5CBS A;  2XXU A;  3C9H A;  4FBP A;  3R7X A;  4HS7 A;  3ILT B;  4MAG A;  3RT6 B;  2ZYO A;  5CC2 A;  3DP6 A;  3TOD A;  2XXP A;  5EYF A;  3K0V A;  2HHM A;  2F7C A;  5ET8 A;  3PU5 A;  3EPE A;  2VD2 A;  3G7W A;  2BJI A;  1IMC A;  2B3F A;  1XOC A;  4NF0 A;  5JEI A;  1ZTY A;  1Q1K A;  5A5X B;  1BP5 A;  4P0G A;  3T66 A;  3E13 X;  4F3B A;  3E79 A;  2FVZ A;  3RY3 A;  3IOW A;  5I7I A;  3U94 A;  5IZ1 A;  4O7M A;  1FSA A;  2H4I A;  4OHN A;  2DE2 A;  2HXR A;  3D4G A;  1H76 A;  3UGW A;  2RC7 A;  4U4S A;  3TUS A;  1MS7 A;  2QPQ A;  2I4B A;  3LUZ A;  4ZE9 A;  5HPQ A;  2RF1 A;  3G3F A;  4FJP A;  2REG A;  5DEX A;  4OET A;  4IGT A;  4IO7 A;  4ZS9 A;  1O64 A;  1AWB A;  4XKR A;  2R9J A;  3RYD A;  2NVU B;  4EQB A;  4GFR A;  2LAO A;  4IO4 A;  3A3C A;  3Q27 A;  4LN5 A;  2VD3 A;  1O7T A;  2GRV A;  4N81 A;  3G3I A;  1VR5 A;  1VDW A;  1R6Z A;  3AXF A;  4OEV A;  1DOT A;  3SEY A;  2CZK A;  1MY4 A;  1SI1 A;  4BLA A;  2CZH A;  3N6T A;  1I6A A;  4GWU A;  3QXM A;  4POW A;  4JDF A;  4LQ2 A;  1JVX A;  3BIH A;  4GWO A;  2UYF A;  4GWW A;  4KI0 E;  1AOV A;  1Z7M E;  1PBQ A;  3O66 A;  4HXV A;  2IA4 A;  5FHN A;  2HEU A;  1MRP A;  1LBC A;  2FBP A;  1QW0 A;  3E78 A;  2DS9 A;  4RPN A;  5ET7 A;  4F1U A;  4RY1 A;  3QK6 A;  1MXY A;  4NWC A;  3FJM A;  2PX1 A;  5ELV A;  1MH4 A;  1FTK A;  1A99 A;  2UYE A;  1MM7 A;  4JVI A;  2I0C A;  2DVC A;  1K9Z A;  5DVJ A;  2GHB A;  3PPO A;  3H7M A;  4EXL A;  3R26 A;  4O3C A;  2VP1 A;  3JZJ A;  2PT1 A;  4G68 B;  1TT1 A;  1MG1 A;  3PUV E;  1LLS A;  3OD7 A;  5AA3 A;  3KOT A;  1EZP A;  1B5I A;  2WKY A;  3E3K A;  3O6G A;  1Q9D A;  3PD9 A;  2B65 A;  3H4Z A;  5CBR A;  3LSW A;  3SEU A;  3TPA A;  2ZNT A;  4X1B A;  4GL0 A;  3PUY E;  1NV7 A;  1NV4 A;  1B5H A;  4DXB A;  3IB1 A;  4PFB A;  3S9L C;  3R6U A;  2KR0 A;  3KFM A;  4ISU A;  4RNS A;  1MXV A;  1SYI A;  2CMO A;  3V8X B;  1MQH A;  2ZNS A;  1LBZ A;  4KYD A;  3VLU A;  2JJK A;  5HM4 B;  2R71 A;  1B52 A;  3T0J A;  1VE4 A;  1MPB A;  1IMF A;  3L6G A;  4TLM B;  4YMB A;  1DPP A;  3SER A;  1B6H A;  2OWZ A;  4OVT A;  4MBP A;  3SDF A;  2XA5 A;  2O51 A;  2I4C A;  4EQ7 A;  1SW1 A;  3IX1 A;  2O69 A;  4QFO A;  1Y1M A;  4OQO A;  2VPN A;  3T93 B;  1URD A;  4YKJ A;  3H3G A;  3G3K A;  5F24 A;  1FQA A;  3ZS6 A;  2FA7 A;  3ZSF A;  4H6D A;  2WYP A;  3VVD A;  4NGU A;  4RA1 A;  1NH8 A;  4MNP A;  4OWD A;  1QUI A;  2B4L A;  3M8U A;  1ATG A;  1N76 A;  3OMB A;  5H8H B;  4FEB A;  3UP9 A;  3SET A;  3FGS A;  5LDZ A;  2O7U A;  5CRY A;  3GYY A;  3K6W A;  1FPE A;  1MY1 A;  1FJ9 A;  5FTI A;  3BFT A;  4PFT A;  4N8G A;  4MLV A;  2RC8 A;  4OES A;  4F39 A;  1DK4 A;  4G68 A;  1YZ0 A;  2OPD A;  4ND9 A;  2ZZX A;  3MVZ A;  3KSJ A;  3G3G A;  4QBA A;  1GV8 A;  3LSF B;  3MWB A;  1DBZ A;  5AA4 A;  3V89 B;  2DSF A;  2VGQ A;  1URG A;  2NWJ A;  4ELP A;  5DT6 A;  1QUL A;  4DIG A;  3IK6 B;  3FJG A;  5ISU A;  4G77 A;  4GX4 A;  2XXY A;  4H1X A;  3FXB A;  4HCY A;  4NAP A;  2QVU A;  2F34 A;  3IJX B;  1FPJ A;  4F1Y A;  5ESY A;  1SBP A;  1IXG A;  4YAH X;  2Q74 A;  2Q9T A;  5I58 B;  4H5F A;  1IEJ A;  5EQA A;  3K4U A;  4OVQ A;  4H0W A;  4GX6 A;  2ZMB A;  4N07 A;  1QKB A;  3VLW A;  1H43 A;  4XXU A;  2QS1 A;  4RYA A;  4IY6 A;  3GBA A;  1IXI A;  3S9M C;  2R8T A;  1P99 A;  4N17 A;  3RT8 A;  2XXW A;  2CEY A;  4O94 A;  3C33 A;  3CIJ A;  2QS3 A;  3PTY A;  1FBC A;  2OWT A;  1M5C A;  4M4G A;  1LGB C;  5T3J A;  1I6Q A;  1OIB A;  1DTZ A;  5BWJ A;  2M8C A;  4UAB A;  1B7H A;  1B58 A;  4UA8 A;  1A40 A;  3HN0 A;  2V3U A;  5ITP A;  1RYO A;  2Y5K A;  2Q89 A;  3VXC A;  3FVK A;  2CZL A;  2ZYN A;  1MDQ A;  5I57 B;  3U1O A;  4OEN A;  5EHM A;  5FHM A;  5TPA B;  2OBG A;  4G2Z A;  1OQH A;  2Q2C A;  2XX7 A;  3LR1 A;  5L9S A;  4PFU A;  4U1Z A;  3KJ7 A;  3SEX A;  4H46 A;  3MVW A;  4P9K A;  2XHD A;  4OER A;  1R9L A;  3VE1 B;  3QYT A;  4YKP A;  2XXQ A;  4X1D A;  4HE1 A;  4FED A;  1YYZ A;  3CSG A;  2DWA A;  4R75 A;  4YB5 A;  2XXI A;  3KN3 A;  3EHU A;  1NUY A;  4NF6 B;  4AS5 A;  2D21 A;  3USD A;  4GLI A;  2PBW A;  1GR2 A;  3PMV A;  1FBP A;  3IO4 A;  1R1N A;  3JV9 A;  3FXQ A;  3PGF A;  4ZEK A;  3OEM A;  5DTB A;  4OFJ A;  2XX9 A;  1B1H A;  1M5B A;  4IR8 A;  1VFE A;  1DPE A;  1MXX A;  4F18 A;  4QFN A;  4LON B;  1LBB A;  2RC9 A;  1SQY A;  4YKI A;  1AMF A;  1D9Q A;  1JW4 A;  2HCA A;  1B4Z A;  4N4U A;  4Q8R A;  1NV1 A;  3SKP A;  2DVZ A;  2O84 X;  4QSD A;  5AA2 B;  1B32 A;  4YKK A;  3TFL A;  4LVQ A;  3DP8 A;  1AH5 A;  3RPL B;  4PFY A;  4F2O A;  1RYX A;  1INP A;  3BKI B;  5H8Q A;  2D5W A;  2P3V A;  4R6K A;  2F3D A;  3K1M A;  4I3Y A;  1NUW A;  1URS A;  3PPR A;  3FD3 A;  4PP0 A;  1EZ9 A;  1FQF A;  1M5F A;  1CB6 A;  5LTC A;  3V83 A;  2OJT A;  3IL1 B;  4JWY A;  4ZEB A;  1USY E;  4HTG A;  3FUZ A;  4YU0 A;  1EZO A;  4IO2 A;  3HST A;  4X8R A;  2P2A A;  4N6K A;  1HSL A;  3CG1 A;  5TPA A;  2H99 A;  4LP2 B;  2DOJ A;  3MZ1 A;  1PB9 A;  4NE4 A;  1NMU A;  2FIE A;  3ROJ A;  1LST A;  2UVI A;  4BDR A;  3BIG A;  3MPK A;  3O6I A;  2PCR A;  1MY0 A;  3HPI A;  4P47 A;  2UVG A;  2CEX A;  3EN3 A;  1MQD A;  3CFX A;  1MDP 1;  3I5O A;  4P1E A;  4NF6 A;  1XI6 A;  1XT8 A;  3W9V A;  1B0H A;  1G0H A;  3IFA A;  3IB0 A;  3VFJ A;  4JB7 A;  4H67 A;  4JVC A; 
#chains in the Genus database with same CATH homology
 5IZ3 A;  2HZL A;  2HZK A;  1FPF A;  4YIC A;  3HFU A;  4GWY A;  1RDX A;  2VT5 A;  4GX3 A;  2VPO A;  4N15 A;  4XEQ A;  5ET5 A;  1NV2 A;  1IMD A;  4PGN A;  1FBH A;  1Q9D A;  5FBP A;  2GQ1 A;  3RPL A;  3IFC A;  4X9T A;  4QXD A;  4MJO A;  1NV7 A;  4PBH A;  1NV4 A;  4PFB A;  2KR0 A;  4HE0 A;  1QGX A;  4H45 A;  4MX6 A;  4PFR A;  4PET A;  4MMP A;  4MHF A;  1LBZ A;  3ISP A;  2JJK A;  4GWS A;  4I40 A;  4PTK A;  3NOH A;  2F3B A;  3T0J A;  1FBE A;  3D1R A;  4F19 A;  4HE2 A;  1IMF A;  5IM2 A;  4PE3 A;  4NX1 A;  2B4M A;  2OWZ A;  4OVT A;  1IMB A;  2XA5 A;  2Y5L A;  3EKI A;  2VPN A;  3MST A;  1LEV A;  5IGA A;  3T1B A;  2XWO A;  5F24 A;  1NV5 A;  4MIJ A;  2WBD A;  2WYP A;  3KBZ A;  3FBP A;  4NG7 A;  4NGU A;  4PBQ A;  4OAN A;  4MNP A;  4GBV A;  2B4L A;  2ZZV A;  2PFY A;  1FPG A;  3U65 A;  1DCU A;  5LDZ A;  2DE4 A;  3GYY A;  1FPE A;  1FBD A;  1EYI A;  1FJ9 A;  4N8G A;  1EYK A;  1DK4 A;  1YZ0 A;  2ZZX A;  4QBA A;  1DBZ A;  5IZZ A;  5IZ3 B;  1FRP A;  2PFZ A;  2XWV A;  4MNI A;  4GX4 A;  3FXB A;  4HCY A;  4NAP A;  2QVU A;  4AS4 A;  1LBY A;  4PAI A;  4PF6 A;  1FBG A;  1FPJ A;  5I3S A;  5ESY A;  2Q74 A;  2Q9T A;  4GBW A;  5EQ7 A;  5EQA A;  2WEF A;  5J1D A;  4OVQ A;  4MEV A;  4GX6 A;  1YXI A;  5EYG A;  2F5X A;  5A5L A;  4GWZ A;  2V3Q A;  4PAK A;  2OX3 A;  1FPL A;  4P56 A;  5CM6 A;  2R8T A;  4N17 A;  4PCD A;  3A29 A;  2CEY A;  2KQZ A;  4O94 A;  3PTY A;  1FBC A;  3QMF A;  1KZ8 A;  4NN3 A;  5T3J A;  5EYH A;  4N91 A;  4OA4 A;  1RDZ A;  2L5V A;  4G61 A;  4YZZ A;  4UAB A;  2FIX A;  4X04 A;  5EQ9 A;  2Y5K A;  1KA1 A;  4O8M A;  2HPG A;  4XFE A;  1FPB A;  4MCO A;  2QVR A;  4PF8 A;  2XWK A;  4I3E A;  1NUX A;  5J16 A;  1G0I A;  1BK4 A;  3B50 A;  4P1L A;  4NQ8 A;  1FBF A;  4H46 A;  1IME A;  2Q8M A;  4P9K A;  4F1V A;  5EQ8 A;  5DW8 A;  1NV3 A;  4FBP A;  4GWX A;  2QVV A;  4MAG A;  4HE1 A;  1IMA A;  1YYZ A;  4JVD A;  5ET6 A;  3SZP A;  2FHY A;  2HHM A;  4OVS A;  5ET8 A;  1NUY A;  4AS5 A;  2DE3 A;  2BJI A;  1IMC A;  4NF0 A;  4MNC A;  1FBP A;  1LBW A;  1NUZ A;  3MYU A;  4IR8 A;  3E79 A;  2FVZ A;  4KXP A;  5I7I A;  5IZ1 A;  2MKZ A;  1FSA A;  4O7M A;  3LV0 A;  2WBB A;  2DE2 A;  2HXR A;  1LBX A;  4F18 A;  3B8B A;  4OVR A;  2QPQ A;  3LUZ A;  1FTA A;  1D9Q A;  2WYK A;  4N4U A;  1NV1 A;  1AWB A;  4OVP A;  2DVZ A;  1JP4 A;  1RDY A;  4DI3 D;  2QFL A;  3RPL B;  1FPI A;  3RYD A;  2XWI A;  1INP A;  4P8B A;  4HCW A;  2P3V A;  4NHB A;  1K9Y A;  2F3D A;  1SPI A;  4LN5 A;  2P3N A;  4PDH A;  4I3Y A;  1NUW A;  4N6D A;  4N81 A;  1FJ6 A;  2XXK A;  1FPD A;  1CNQ A;  1VDW A;  3KC1 A;  1EYJ A;  4PAF A;  5LTC A;  2CZK A;  2DDK A;  2CZH A;  4GWU A;  3KC0 A;  4N8Y A;  3BIH A;  4GWW A;  4X8R A;  4N6K A;  1KA0 A;  4HXV A;  4DI4 B;  4P3L A;  2FBP A;  1NV0 A;  3E78 A;  4XF5 A;  4PFI A;  4PDD A;  5ET7 A;  2FIE A;  3ROJ A;  2CZI A;  4F1U A;  1NV6 A;  3BIG A;  4PGP A;  2PCR A;  2V4C A;  1LBV A;  4PC9 A;  5I5P A;  4P47 A;  4JVI A;  3CHG A;  1K9Z A;  2CEX A;  2ZZW A;  1NI9 A;  4P1E A;  1FPK A;  1XI6 A;  3W9V A;  1G0H A;  3IFA A;  4O7I A;  3W9W A;  5JK4 A;  2WX9 A;  4JVC A;  4M1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...