4GWUA

Crystal structure of fru 2,6-bisphosphate complexes of porcine liver fructose-1,6-bisphosphatase with filled central cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
307
Chain Sequence
IVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAIHRAVRKAKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMVNGVNCFMYDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSPEDVTELLEIYQKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Hydrophobic Central Cavity in Fructose-1,6-bisphosphatase is Essential for the Synergism in AMP/Fru 2,6-bisphosphate Inhibition
rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 95
structure length 307
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4gwuA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4gwuA02
5FBPA 2QFLA 1NUWA 2CZKA 1DK4A 1NV6A 1FBCA 2HHMA 2P3VA 3FBPA 1FPGA 1IMAA 1KA1A 1NUXA 2VT5A 4GWYA 4HE0A 3A29A 3BIGA 1NV7A 2Q74A 2Y5KA 1XI6A 1FPIA 2BJIA 3RPLB 4GBWA 2WBBA 5DW8A 3QMFA 3D1RA 1FBPA 2JJKA 1NV4A 1YXIA 1FBGA 4H46A 1DCUA 4AS5A 1QGXA 2QVVA 1FBDA 2GQ1A 1FJ6A 1NUZA 1BK4A 1K9YA 1FRPA 3B8BA 1LBZA 5ET6A 1LBVA 2P3NA 1VDWA 4GWWA 2OX3A 3ROJA 2F3DA 1G0IA 1K9ZA 5J16A 5LDZA 3IFAA 4GX4A 5ET5A 3RYDA 2R8TA 2FHYA 5IZ1A 5EYHA 1CNQA 1G0HA 1IMDA 1NI9A 4KXPA 5F24A 1KZ8A 1FTAA 3LUZA 5EQAA 1FPDA 2FVZA 4HE1A 5ET7A 2Q8MA 1RDZA 4O7IA 1IMEA 1DBZA 5EYGA 5IZ3A 2QVUA 1AWBA 4FBPA 1NV5A 2DDKA 2OWZA 1NUYA 4G61A 5ET8A 5I3SA 1INPA 1FPKA 4HXVA 3IFCA 2QVRA 1LBXA 4GWZA 4N81A 1IMFA 5EQ7A 1FPLA 4GBVA 1FPEA 2Y5LA 1FJ9A 1JP4A 4GX3A 4I3YA 2CZHA 2PCRA 1LBWA 5EQ9A 1FSAA 3KBZA 4GWSA 3RPLA 4PTKA 2FIXA 5T3JA 4I40A 4QXDA 4I3EA 4MJOA 5A5LA 1NV0A 3LV0A 1IMBA 1FBHA 3KC1A 1SPIA 1Q9DA 2CZIA 4GX6A 4H45A 1IMCA 1D9QA 2FBPA 2F3BA 1FBFA 1RDXA 1YZ0A 2WBDA 1RDYA 5EQ8A 5ESYA 1EYIA 1LEVA 1EYJA 1FBEA 1NV1A 3T0JA 1FPBA 1YYZA 5IZ3B 1KA0A 4IR8A 1LBYA 1FPFA 1NV2A 4AS4A 4GWUA 1NV3A 3BIHA 1FPJA 2FIEA 4HE2A 1EYKA 2WEFA 3KC0A 4GWXA
chains in the Genus database with same CATH superfamily
1KA1A 3I3VA 4XKQA 3U94A 4M1VA 5ELVA 3U92A 1MY3A 3T93B 2WKYA 3MUQA 3KZGA 1FBDA 4GL8A 3L6HA 1B40A 2P2AA 1IQ7A 3VFJA 3UK4A 4C1TA 4NF4B 3TMGA 1LBVA 4OZ9A 3OXNA 4BDQA 1ELJA 4EQBA 5IGAA 3MPLA 5FTIA 5EYHA 5BUUA 3FGSA 2Q8MA 2O1LA 3USDA 4X8RA 5IZ3A 4U21A 5KZTA 1NKXA 4JVCA 2H9BA 1WODA 3PD9A 1NL5A 1DPPA 4N81A 2CZLA 5I59B 2PT2A 4NGUA 1UTBB 2A5TB 3IJXB 4LZ7A 3TTMA 4EF2A 3QUFA 3B7DA 2F7AA 2WYPA 4I40A 4MH5A 3C35A 3IO6A 4YICA 2FYIA 1A8FA 4O8MA 5H8FB 2V3TA 3RTFB 4NQ8A 1Y9UA 2YJPA 3PUYE 2Z8FA 3QXMA 1OQGA 1D9VA 4JWXA 4NF4A 4G68B 1LAHE 1NNTA 2ZYNA 3G3HA 4PE3A 4GIZA 4Z0IA 4Z7EA 5KDTB 2OCUA 3LSFB 1VFEA 1A55A 1II5A 1NV6A 3GBAA 3SEYA 1IXCA 1O63A 1OQHA 2HCAA 2QPQA 3A29A 2DQVA 3SERA 2O7IA 1YXIA 3R7XA 4E0XA 5I59A 5H8NB 1B3EA 1QGXA 1UTBA 4NF0A 3SEUA 2A5TA 2DVZA 3PPPA 1B1HA 2Q88A 1EH3A 2QJEA 1IUDA 3T9HB 5ET6A 2Q89A 4R6KA 4ZEBA 2R9JA 2XXIA 3HCQA 3RTWB 5H8FA 1IZ1A 1OLAA 4H8JA 1P1WA 1MXVA 3TTRA 4H5GA 1XS5A 4U4XA 2KQZA 2DDKA 5KDTA 3FXBA 1B3LA 4ZZAA 4OETA 3TZAA 3FVNA 2CZHA 3WAFA 2FIXA 3R26A 1LFGA 4MJOA 4AB5A 4OQOA 4KCCA 5H8NA 3BFTA 3HHFA 1Q9DA 5L9SA 3TTLA 3K6VA 3LR1A 3IK6B 4JXIA 3U8QA 3OEMA 4DI3D 2QSXA 3T9UA 2W7YA 4OVRA 3CFXA 1GR2A 4GWUA 1NV3A 3RLFE 1HSJA 2I0CA 2O69A 3KSXA 2X7PA 5FBPA 4FECA 3PUVE 4R73A 1Q35A 1FQEA 2H5YA 4H1XA 3HO7A 2Y5KA 3SESA 4N17A 4GBWA 2B4MA 2E0SA 2UVJA 2OBGA 3CG3A 4LA9A 1N04A 1USYH 2Q2CA 1ZLQA 3OO9A 5TP9B 5AA4B 1T0KA 1FRPA 4F29A 2HQ0A 3ROJA 2NWJA 4KI0E 3I5OA 3TTKA 1OMPA 3HN0A 1PB9A 2FHYA 3VVDA 1CB6A 2XXXA 3RGYA 3BKIB 1JVXA 1MQHA 2RC7A 4P8BA 1UTHB 2O7UA 2PMSA 4G8MA 2XXWA 2HZLA 2BJJX 5I3SA 3R6UA 2QL3A 3GYYA 3C9HA 2VD2A 1LB8A 4R75A 5AA3A 3OO8A 2I49A 2H4IA 5CI5A 5EQ9A 2Y7PA 4P11A 1NH8A 4I3EA 1I69A 5FHOA 4RPOA 2F35A 4G77A 2ZMBA 4H5FA 1SI0A 3DP6A 1NNKA 3KG2A 5TP9A 4H0WA 3CIJA 5AA4A 4QRZA 1FBFA 1RDYA 3W15C 4ESXA 1AL3A 1NV1A 4FIMA 5IKBA 3K1MA 1SW1A 4MLVA 3E13X 4RYAA 1QJMA 1NUWA 1Y20A 1FTJA 3FXUA 1R1NA 1H44A 1FPGA 1Y3QA 4PDHA 1MXYA 1UTHA 1OVTA 1GVCA 2XWKA 4EXLA 1SVXB 2V84A 5H8HA 1FBGA 1QW0A 3IR1A 2XXVA 2QVVA 2VHAA 2CEXA 3UA8A 4E0WA 4ISUA 4OESA 3IOTA 4OVPA 1JETA 2OZZA 2QMWA 2XXUA 1K9ZA 5J16A 1Z7ME 5CBRA 4OVSA 1BIYA 3TCFA 4X1BA 1YCJA 2QS1A 5F24A 3M3FA 1B0LA 1RDZA 2DVCA 2H99A 2V3QA 2CEYA 1SI1A 1ZTYA 4MHFA 4HXVA 4OANA 4U4SA 2I4BA 4PC9A 2QS3A 3N6UA 1LBWA 5L8DA 4TLMB 4MLQA 3EKIA 3QIMA 4QXDA 4DI4B 2I3VA 4XTCQ 3TQWA 2GHBA 4WXJA 2QMXA 5I2NB 3IX1A 5EQ8A 5CRYA 3BFUA 3O6IA 1JEVA 4I1DA 2OPDA 2IEEA 2NUVA 3MZ9A 5EHMA 3IB0A 2PT1A 4R74A 4NX1A 2HFBA 2DE2A 4HE0A 2XXPA 1AIVA 1NMUA 3IL1B 2XWVA 4IO6A 4HTGA 4YAHX 3UP9A 2F36A 3H7MA 3KGCA 3E79A 4NF8B 3V83A 2MKZA 4F2QA 4RK9A 1FTMA 4QSEA 4N8GA 1LBZA 3JV9A 3GXAA 2DWJA 1MQGA 3K02A 1LBCA 1N3WA 4OVJA 5IZ1A 4LONB 5I2NA 4PFBA 4GRKA 4GL0A 2NXOA 5H8QB 2VD3A 1YAEA 1A8EA 3C34A 1NH7A 3FJMA 3ZKKA 1R9QA 4G61A 5AA2B 3Q26A 1XVXA 2I3WA 4KR5A 3VLWA 5IAIA 2F34A 2XA5A 4NWDA 1JP4A 4P56A 4PAFA 2PFYA 1AMFA 5CMMA 1FSAA 3PPOA 5A5XB 3MBPA 4NF8A 4FATA 1P1UA 4H45A 2D5WA 1B3FA 1B5JA 2Y7IA 3MVZA 3CSBA 4IGRA 2ANJA 4QFKA 4HCYA 3C33A 4FE8A 3T96B 5AE4A 2O1MA 3DLNA 1LLSA 2AL4A 3C36A 3QSLA 4OENA 1SW2A 4RY1A 1D9YA 3FVKA 2WEFA 4EUOA 4N8YA 3RN8A 2HHMA 3KJ7A 3VXBA 1IMAA 2HAUA 1MPDA 4MBPA 2RKMA 3OO7A 1LB9A 2DYXA 5FHNA 1MXZA 1LBBA 4TOZA 2KLFA 4KCDA 4ZEIA 2GQ1A 3ZKLA 2QRYA 3FD3A 3KSJA 5A5XA 3LSWA 4H67A 1B7HA 2XWIA 2UYFA 3CR9A 3IFAA 3TAJA 2VPOA 4JSDA 4YB7A 4JWOA 5IZZA 2ZYOA 4PCDA 4HE1A 4PGPA 4R2BA 5EYGA 2LAOA 2DXYA 2F5XA 3OSQA 3TFLA 4MIJA 1IXGA 4TQUQ 1FPKA 3MJNA 4H8IA 1B51A 4WKMA 1MY2A 4GX3A 4XXUA 5FTHA 3G3KA 3MP1A 1MQIA 4KYEA 4ZEKA 1UIVA 2RC9A 3ODBA 1XOCA 3A3CA 5HM4B 1LSTA 4GX6A 1S7YA 3THIA 2V93A 2R6GE 2HPGA 3ZSFA 4P0IA 1FBEA 4OFLA 2VPNA 4F31B 4O3BA 4OVQA 3SEWA 3N94A 1USYE 4MX6A 3KC0A 4GWXA 1OIBA 1FBCA 4UABA 1PBPA 1Y3NA 4YKPA 1LFIA 2ZYKA 2BJIA 3IOUA 5DT6A 3PGFA 4F18A 2UYEA 3FZVA 4AB6A 1B7ZA 1SYIA 1M5EA 4KYDA 1BK4A 3E78A 1QULA 2DE3A 2ALUA 4YB5A 3IOWA 1VFDA 1B52A 3O9PA 3MAMA 1NNPA 4LP2B 2ESNA 3HV1A 2P0SA 5DEXB 3QAXA 2F6PA 2IA4A 1MXWA 4QSCA 1M5DA 3TKDA 4GVOA 4O7IA 3EHTA 1S9TA 4OFOA 2QVUA 1NV5A 1LGBC 2YLNA 3IFCA 1I6BA 2AYSA 1UQWA 4N91A 4R6YA 3RUMA 3PTYA 5T3JA 2R71A 4YKJA 1M5BA 4LVQA 2ZYMA 1XHYA 3K00A 1Y1ZA 4F19A 3VLVA 1D3KA 4FEBA 4EDPA 5L9MA 3V5AA 4PE5B 1M5CA 3W9WA 1MM6A 3EHUA 3ILTB 2VP1A 4LUBA 1NV2A 3OENA 1B4HA 5DEXA 2REGA 1Q1KA 1US5A 1IITA 1URDA 2F78A 5B70A 5CMCA 2I6EA 5J1DA 1BKAA 2Y7KA 3E4RA 3FBPA 4N07A 3OOAA 1JW1A 4Q0CA 3D4CA 5DW8A 1BLFA 1EU8A 1SYHA 2JJKA 1ZJLA 4P3LA 2GH9A 5JTYB 3MW0A 3S2VA 2XD3A 1FQCA 1B46A 4PF8A 4ELQA 1FJ6A 3DP8A 1DTZA 2P1SA 4ELPA 4PFYA 3TQLA 4OEUA 3CSGA 4NWCA 1B58A 5I57B 3VDFA 2ONKE 1H76A 4Q30B 2HXWA 1XVYA 1G0IA 3RY3A 5F7VA 4DDDA 1A99A 1MY0A 3KEIA 4JVDA 4XKPA 4BLAA 3CFZA 5DVFA 2B3BA 1CNQA 3UN6A 3C32A 1MH3A 2PVUA 4ZEFA 2FA7A 4FBPA 3CI8A 1NUYA 1ANFA 2XXYA 2Y7WA 3H6VA 4U2RA 1BTJA 1EZ9A 4YU0A 4RJZA 1H45A 4MCOA 5EQ7A 4GBVA 2Y5LA 4N15A 4MMPA 3E9XA 3EQ1A 3PMXA 1N7XA 3VLUA 2XXKA 4PFIA 3K6WA 3BBRA 4FORA 5A5LA 4YZZA 4R9GA 3OELA 2HXRA 4BDNA 4KPTA 2F7BA 5JTYA 1D9QA 3IB2A 5H8HB 4RK2A 5ESYA 5I57A 2M8CA 4IO5A 3T0JA 4M4GA 2RF1A 1J1NA 4O3CA 1O7TA 2DWHA 1FPJA 3H06B 4G4PA 4QF9A 3MZBA 3PMVA 3K6UA 1NUXA 4MEVA 2XX8A 4NG7A 3V89B 4JB7A 4KHZE 3QMFA 5AA1A 3TCHA 2DSFA 4I62A 4GXSB 1ZU0A 4H46A 4RNSA 3GBBA 4C1UA 4F1YA 3IJOB 3S9LC 4PFWA 2FNCA 1K9YA 5ICTA 5CM6A 4K3FA 1B3HA 2ZNUA 3EHSA 4U1OA 1A40A 4IO3A 4JDFA 5CBSA 3PU5A 3A09A 2DS9A 1B32A 3I6VA 4G8HA 5TPAB 3FATA 1KZ8A 1FPDA 4ZS9A 3RT8A 3M8UA 3HSTA 3PPQA 3G3IA 3PPNA 4EXKA 1AWBA 4PAIA 3VXCA 1INPA 4H6DA 2O51A 2XX7A 1FPLA 3FVGA 4QFOA 3S4UA 4IO2A 1KWHA 5K2XA 3L6GA 3OD7A 3KBZA 4YKIA 4ECFA 2ZZXA 1SPIA 5DVJA 4Q5TA 3G3FA 1FW0A 3EPEA 1B1XA 4PBQA 4QBAA 5K2YA 4F1UA 1URGA 4XKRA 1JW5A 1PC3A 1POTA 4XFEA 3O6HA 3TELA 1B7UA 2WYKA 1MQJA 3QUJA 3T22A 2F6GA 2QS4A 3LSXA 3S9EA 1MXXA 1ATGA 3PD8A 1P1QA 1Y1MA 5TPAA 4JVIA 4ELRA 4O94A 4ZEDA 3OEKA 1PDAA 3FV2A 4RPNA 3MYUA 4GLIA 1FPIA 1FBPA 1NV4A 1L5TA 2Q9TA 4ND9A 5L9OA 1Y3PA 3EN3A 1H3DA 3K2DA 3PV0E 4ZECA 3MVYA 3ZS6A 4YMBA 2NOOA 3KOTA 4UA8A 3B8BA 1R9LA 4OYVA 1FQAA 1WVJA 2P3NA 1RYOA 2F3DA 3VV5A 4RXLA 1MPCA 1LCFA 1Z7NE 2QS2A 3AXFA 1FTLA 3N6TA 4DXBA 4P9KA 3K4UA 3OO6A 4P0GA 4YB6A 1VR5A 4WEPA 4DXCA 2ZZWA 4LN5A 1QKAA 3ILUB 4EQ9A 2PFZA 1M5FA 1B5IA 4NF6B 1IMFA 1SBPA 3VVFA 4MFIA 4DXUA 4HW8A 1MXUA 2XXTA 4NTLA 3O28A 4KD5A 1EZPA 4HCWA 1ZMGA 3LV0A 2X26A 3CHGA 4OERA 1DSNA 3O2AA 5I58B 1R6ZA 3PUXE 2F3BA 1YZ0A 3V8XB 4YMAA 4UACA 4ZDMA 5H8SA 1XC1A 1A54A 3H4ZA 1PB7A 3IORA 2XXRA 1GGGA 2Z23A 3H6TA 4N13A 4FJPA 4DLDA 3BIGA 4F39A 2V4CA 2OLBA 2CMOA 3D1RA 4TLLB 4NF6A 2F97A 1IIWA 3MPKA 3VVEA 4POXA 1QUIA 5M2VA 1JQFA 2GRVA 1N7WA 2THIA 4P1EA 1FTOA 4PDDA 2F7CA 4GWWA 1VDWA 1LAGE 3LSLA 4JSOA 3KN7A 5I58A 1PBQA 4F3BA 3FIRA 1MY4A 3JYRA 4IB2A 4XF5A 2DXRA 2OPEA 3G7WA 3MSTA 3EF7A 3MQ9A 3PMWA 2OWZA 1RYXA 2NVUB 1TWYA 4OXVA 2XXQA 3QYTA 1FPEA 1FJ9A 3FUZA 4KYSA 3K6XA 4NEDA 4PFRA 1OVBA 3MVWA 1IXIA 1ZBMA 3B50A 3IAZA 4NN3A 2REJA 2UVGA 3TTNA 5ICQA 3KOSA 2WBDA 1EYJA 4I8CA 4DCXA 1HSEA 4THIA 1LBYA 2I48A 2UVIA 2FIEA 4HE2A 1FQFA 1SD3A 3JZJA 1DK4A 3KBRA 4PETA 4X48A 2X7QA 3MWBA 4MF3A 4N4UA 4QSDA 1XI6A 2V25A 2WBBA 1TT1A 3FJGA 3MZ1A 4NE4A 4PAKA 3TPAA 1URSA 4X04A 4ZZEA 1POY1 2DWAA 4ZE8A 3M3KA 1GTKA 2V3UA 4LZ5A 2HZKA 3HFUA 3SDFA 3MP6A 4GQOA 4H65A 3G3GA 4F3PA 4GX4A 3CVGA 4HS7A 1DPEA 1Y4CA 4IO4A 1MDQA 5AA2D 4DCYA 1JVYA 4BDRA 3ECRA 1WDNA 5ITPA 3O29A 4OHNA 4GWZA 2XWOA 3D4GA 2Z8DA 2G29A 5DVIA 3W9VA 1LAFE 3TEPA 4ONYA 1I6QA 1NV0A 3KC1A 2ZZVA 2I58A 1TXFA 4WEDA 5I5PA 2VGQA 4IY5A 3OSRA 4ESWA 3Q25A 4JWYA 1YYZA 3SEXA 4YKKA 1AOVA 3MP8A 1MDP1 4U1ZA 5IM2A 1EYKA 2CZKA 1MM7A 1OLCA 4LQ2A 3T9VA 2P3VA 3LBSA 2Q8JA 1S50A 4F3SA 3U72A 1B3GA 1NV7A 3RPLB 5I7IA 3B6WA 4GFRA 1FQDA 3DM0A 4G68A 2GHAA 2PBWA 3N5LA 2I0BA 3H3GA 5EYFA 3UORA 4G8NA 3IO4A 4LQ5A 3NOHA 4R9FA 4NAPA 5ET5A 3QK6A 3TDJA 2Z22A 1HSLA 3LUZA 5EQAA 4R6HA 5ET7A 3H6UA 3O6GA 4FEDA 4ELOA 5I84A 2OWTA 3Q28A 1DBZA 4DE8A 3RQTA 1QVSA 2O68A 4F1VA 3SETA 3RT6B 5ET8A 3M3LA 3KN8A 3TYHA 1B05A 2I4CA 1IEJA 3LC8A 1QUJA 2PCRA 1XT8A 3RPLA 3WAEA 4PTKA 4Q8RA 4P1LA 1Y4TA 2UVHA 4X9TA 4GXAA 4LATA 3HPIA 4L17A 2PYYA 2H25A 3S9MC 3FVOA 2OJTA 2PX1A 3MC2A 3K01A 2HEUA 3RNNA 4G2ZA 1FPFA 1MRPA 4R72A 3BIHA 4FAJA 2XHDA 3UGWA 2A5SA 4XKNA 2QFLA 5I2KB 4ZE9A 4BDOA 3VE1B 2Q2AA 4NF5B 3OMBA 2VT5A 4GWYA 1B4ZA 3SKPA 4KFQA 2Q74A 4QFNA 4OFJA 4MAGA 4OWDA 1P99A 5LOMA 3U1OA 3DP4A 3N26A 4N6PA 4KQPA 4OMBA 3K1PA 5JEIA 3P7IA 5CC2A 3K1NA 2VOZA 1CE2A 3KJTA 1JNFA 4P47A 4OTEA 1SDXA 2D21A 3CRBA 2AIXA 2Y84A 2OWSA 1B2HA 2RCAA 2HAVA 5CMKA 2AL5A 4O3AA 1I6AA 1G0HA 1VSOA 4MNPA 4KXPA 4JBZA 3Q29A 1MS7A 3SEVA 2B4LA 1US4A 3H03A 3GZGA 4QFLA 3F11A 4I9DA 3IOVA 1N76A 2UXAA 5I2KA 3B6TA 4N6KA 4NF5A 4I3YA 1NNFA 1MH4A 1MG1A 1N3XA 1NFTA 1N84A 4PGNA 3G3JA 3LUYA 1DTGA 4GWSA 2DWIA 1D4NA 4MNIA 5B7DA 4F22A 2XD2A 3GLBA 2CZIA 1SW4A 4NHBA 1IMCA 3PPRA 4OVTA 4PP0A 2D3IA 2B65A 4GOTA 5DYHA 4PF6A 1A7LA 5CMBA 1P1OA 1LCTA 2F8DA 2ZNSA 3MVXA 2RC8A 1QUKA 3SZPA 2ZXTA 1ZKBA 5DTBA 3FV1A 2RINA 2ONRA 3FXRA 3CFLA 2XX9A 5I56B 3Q27A 3RPWA 4G68C 1SQYA 2ZNTA 2OK2A 3PUZE 1B6HA 1DCUA 1EZOA 4X1DA 4PBHA 4O7MA 4DZ1A 4EF1A 1BP5A 4N6DA 5ITOA 1B0HA 1H43A 5ISUA 4XIGQ 3RYDA 4GWOA 2ABHA 4U22A 1FTAA 2FVZA 5BWJA 1MPBA 3TCGA 1FTKA 3A3UA 4BDLA 4EQ7A 3O66A 5TU0A 3DELB 4PFTA 2Z8EA 4GF8A 1LBXA 1TFAA 5I56A 1MY1A 4NMYA 1LFHA 5FHMA 3H6WA 3U65A 2L5VA 4U23A 1IXHA 4POWA 3FJ7A 2DOJA 1YPNA 1IMBA 1FBHA 2WX9A 1LAXA 1N0TA 1RKMA 1JEUA 4QFPA 2FBPA 1GV8A 3KFMA 2G93A 5HPQA 2E1SA 4AQ4A 1FPBA 3C31A 3CG1A 3U93A 4IR8A 1JW4A 3FXQA 4RA1A 1PB8A 1DOTA 4LZ8A 5JK4A 4QHQA 3E3KA 2DP8A 3UIFA 2GFEA 4MNCA 1FQBA 3T66A 3T1BA 3TODA 1QKBA 3KN3A 2O84X 4AS5A 1FCKA 4DIGA 1MQDA 5KCJB 2RCBA 1NUZA 3FASA 1F9BA 4F3GA 4C0RA 5F1QA 1B5HA 5EHSA 3C4MA 2OX3A 1AH5A 5LDZA 2ONSA 4XEQA 2R8TA 3ONMA 5HBCA 1IMDA 1NI9A 1PEBA 1IMEA 1P1NA 2B3FA 3PUWE 4OEVA 5LTCA 4OA4A 2QVRA 2H98A 1SW5A 1DMBA 3IB1A 2O6AA 1B9JA 3O97A 2YPNA 3K0VA 3B6QA 3S9NC 1TFDA 4PQJA 4F2OA 5H8QA 4PFUA 5KCJA 2XXHA 3T9XB 2DE4A 4R2FA 1YTVA 1UIUA 1VE4A 1RDXA 3TUSA 5AA2A 1EYIA 1LEVA 4GD5A 2KR0A 5IZ3B 2Y7RA 1KA0A 3HHGA 4IGTA 4IY6A 1ZIUA 4AS4A 1O64A 3ISPA 4BDMA 4IO7A
chains in the Genus database with same CATH topology
2CZKA 2P3VA 4NX1A 2DE2A 1KA1A 1NUXA 4HE0A 4MEVA 4NG7A 1NV7A 3RPLB 2XWVA 4M1VA 3QMFA 5I7IA 4H46A 3E79A 2MKZA 1FBDA 1K9YA 5CM6A 4N8GA 1LBZA 1LBVA 3NOHA 4NAPA 5IGAA 5ET5A 5IZ1A 5EYHA 4PFBA 1KZ8A 3LUZA 5EQAA 1FPDA 2Q8MA 5ET7A 4X8RA 5IZ3A 1DBZA 4F1VA 1AWBA 4PAIA 4G61A 5ET8A 1INPA 4JVCA 4N81A 2XA5A 4NGUA 1FPLA 1JP4A 4P56A 4PAFA 2PFYA 2PCRA 1FSAA 3KBZA 3RPLA 4PTKA 2WYPA 4P1LA 4I40A 4X9TA 2ZZXA 1SPIA 4H45A 4YICA 4O8MA 4NQ8A 4PBQA 4QBAA 4F1UA 4HCYA 4XFEA 4PE3A 1FPFA 2WYKA 3BIHA 2WEFA 4JVIA 4N8YA 2QFLA 4O94A 1NV6A 2HHMA 1IMAA 2VT5A 4GWYA 2QPQA 3MYUA 3A29A 2Q74A 1FPIA 4MAGA 1FBPA 1NV4A 1YXIA 2Q9TA 1QGXA 4NF0A 2GQ1A 4P47A 2DVZA 3B8BA 5ET6A 2P3NA 2F3DA 2XWIA 3IFAA 2VPOA 1G0HA 5IZZA 4MNPA 4KXPA 4P9KA 4PCDA 4HE1A 2B4LA 4PGPA 5EYGA 2F5XA 2KQZA 2ZZWA 4LN5A 2DDKA 4MIJA 3FXBA 2PFZA 1FPKA 1IMFA 4N6KA 4GX3A 4I3YA 2CZHA 4PGNA 4GWSA 2FIXA 4MNIA 4HCWA 4MJOA 3LV0A 3CHGA 1Q9DA 2CZIA 4GX6A 4NHBA 1IMCA 4OVTA 2HPGA 2F3BA 1YZ0A 4PF6A 1FBEA 2VPNA 4DI3D 3SZPA 4OVRA 4OVQA 4GWUA 1NV3A 4MX6A 3KC0A 4GWXA 5FBPA 1FBCA 4UABA 3BIGA 2Y5KA 4N17A 2BJIA 2V4CA 4GBWA 2B4MA 3D1RA 4F18A 1DCUA 4PBHA 4P1EA 1BK4A 4O7MA 3E78A 2DE3A 4PDDA 1FRPA 4N6DA 4GWWA 1VDWA 3ROJA 3RYDA 2FHYA 1FTAA 2FVZA 4O7IA 4XF5A 4P8BA 3MSTA 2QVUA 1NV5A 2OWZA 2HZLA 5I3SA 3IFCA 3GYYA 1LBXA 1FPEA 1FJ9A 4N91A 5EQ9A 3PTYA 3U65A 4PFRA 5T3JA 2L5VA 4I3EA 3B50A 1IMBA 1FBHA 2WX9A 4NN3A 4F19A 2FBPA 1FBFA 2WBDA 1RDYA 1EYJA 3W9WA 1NV1A 1FPBA 4IR8A 1LBYA 1NV2A 2FIEA 4HE2A 5J1DA 1NUWA 5JK4A 1DK4A 3FBPA 1FPGA 4PETA 4PDHA 4N4UA 1XI6A 4MNCA 2XWKA 2WBBA 5DW8A 3T1BA 2JJKA 1FBGA 4PAKA 4P3LA 4AS5A 2QVVA 2CEXA 4X04A 4PF8A 1FJ6A 1NUZA 4OVPA 2OX3A 2HZKA 3HFUA 1G0IA 1K9ZA 5J16A 5LDZA 4OVSA 4GX4A 4JVDA 4XEQA 2R8TA 1CNQA 1IMDA 1NI9A 5F24A 1RDZA 2V3QA 2CEYA 1IMEA 4MHFA 4FBPA 1NUYA 5LTCA 4HXVA 4OA4A 4OANA 2QVRA 4GWZA 2XWOA 4PC9A 4MCOA 5EQ7A 4GBVA 2Y5LA 4N15A 1LBWA 4MMPA 2XXKA 4PFIA 3W9VA 3EKIA 4QXDA 4DI4B 5A5LA 4YZZA 1NV0A 2HXRA 3KC1A 2ZZVA 2DE4A 5I5PA 1D9QA 1RDXA 5ESYA 5EQ8A 1EYIA 1LEVA 3T0JA 2KR0A 1YYZA 5IZ3B 1KA0A 4AS4A 3ISPA 1FPJA 5IM2A 1EYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FBP A;  2QFL A;  1NUW A;  2CZK A;  1DK4 A;  1NV6 A;  1FBC A;  2HHM A;  2P3V A;  3FBP A;  1FPG A;  1IMA A;  1KA1 A;  1NUX A;  2VT5 A;  4GWY A;  4HE0 A;  3A29 A;  3BIG A;  1NV7 A;  2Q74 A;  2Y5K A;  1XI6 A;  1FPI A;  2BJI A;  3RPL B;  4GBW A;  2WBB A;  5DW8 A;  3QMF A;  3D1R A;  1FBP A;  2JJK A;  1NV4 A;  1YXI A;  1FBG A;  4H46 A;  1DCU A;  4AS5 A;  1QGX A;  2QVV A;  1FBD A;  2GQ1 A;  1FJ6 A;  1NUZ A;  1BK4 A;  1K9Y A;  1FRP A;  3B8B A;  1LBZ A;  5ET6 A;  1LBV A;  2P3N A;  1VDW A;  4GWW A;  2OX3 A;  3ROJ A;  2F3D A;  1G0I A;  1K9Z A;  5J16 A;  5LDZ A;  3IFA A;  4GX4 A;  5ET5 A;  3RYD A;  2R8T A;  2FHY A;  5IZ1 A;  5EYH A;  1CNQ A;  1G0H A;  1IMD A;  1NI9 A;  4KXP A;  5F24 A;  1KZ8 A;  1FTA A;  3LUZ A;  5EQA A;  1FPD A;  2FVZ A;  4HE1 A;  5ET7 A;  2Q8M A;  1RDZ A;  4O7I A;  1IME A;  1DBZ A;  5EYG A;  5IZ3 A;  2QVU A;  1AWB A;  4FBP A;  1NV5 A;  2DDK A;  2OWZ A;  1NUY A;  4G61 A;  5ET8 A;  5I3S A;  1INP A;  1FPK A;  4HXV A;  3IFC A;  2QVR A;  1LBX A;  4GWZ A;  4N81 A;  1IMF A;  5EQ7 A;  1FPL A;  4GBV A;  1FPE A;  2Y5L A;  1FJ9 A;  1JP4 A;  4GX3 A;  4I3Y A;  2CZH A;  2PCR A;  1LBW A;  5EQ9 A;  1FSA A;  3KBZ A;  4GWS A;  3RPL A;  4PTK A;  2FIX A;  5T3J A;  4I40 A;  4QXD A;  4I3E A;  4MJO A;  5A5L A;  1NV0 A;  3LV0 A;  1IMB A;  1FBH A;  3KC1 A;  1SPI A;  1Q9D A;  2CZI A;  4GX6 A;  4H45 A;  1IMC A;  1D9Q A;  2FBP A;  2F3B A;  1FBF A;  1RDX A;  1YZ0 A;  2WBD A;  1RDY A;  5EQ8 A;  5ESY A;  1EYI A;  1LEV A;  1EYJ A;  1FBE A;  1NV1 A;  3T0J A;  1FPB A;  1YYZ A;  5IZ3 B;  1KA0 A;  4IR8 A;  1LBY A;  1FPF A;  1NV2 A;  4AS4 A;  4GWU A;  1NV3 A;  3BIH A;  1FPJ A;  2FIE A;  4HE2 A;  1EYK A;  2WEF A;  3KC0 A;  4GWX A; 
#chains in the Genus database with same CATH topology
 1KA1 A;  3I3V A;  4XKQ A;  3U94 A;  4M1V A;  5ELV A;  3U92 A;  1MY3 A;  3T93 B;  2WKY A;  3MUQ A;  3KZG A;  1FBD A;  4GL8 A;  3L6H A;  1B40 A;  2P2A A;  1IQ7 A;  3VFJ A;  3UK4 A;  4C1T A;  4NF4 B;  3TMG A;  1LBV A;  4OZ9 A;  3OXN A;  4BDQ A;  1ELJ A;  4EQB A;  5IGA A;  3MPL A;  5FTI A;  5EYH A;  5BUU A;  3FGS A;  2Q8M A;  2O1L A;  3USD A;  4X8R A;  5IZ3 A;  4U21 A;  5KZT A;  1NKX A;  4JVC A;  2H9B A;  1WOD A;  3PD9 A;  1NL5 A;  1DPP A;  4N81 A;  2CZL A;  5I59 B;  2PT2 A;  4NGU A;  1UTB B;  2A5T B;  3IJX B;  4LZ7 A;  3TTM A;  4EF2 A;  3QUF A;  3B7D A;  2F7A A;  2WYP A;  4I40 A;  4MH5 A;  3C35 A;  3IO6 A;  4YIC A;  2FYI A;  1A8F A;  4O8M A;  5H8F B;  2V3T A;  3RTF B;  4NQ8 A;  1Y9U A;  2YJP A;  3PUY E;  2Z8F A;  3QXM A;  1OQG A;  1D9V A;  4JWX A;  4NF4 A;  4G68 B;  1LAH E;  1NNT A;  2ZYN A;  3G3H A;  4PE3 A;  4GIZ A;  4Z0I A;  4Z7E A;  5KDT B;  2OCU A;  3LSF B;  1VFE A;  1A55 A;  1II5 A;  1NV6 A;  3GBA A;  3SEY A;  1IXC A;  1O63 A;  1OQH A;  2HCA A;  2QPQ A;  3A29 A;  2DQV A;  3SER A;  2O7I A;  1YXI A;  3R7X A;  4E0X A;  5I59 A;  5H8N B;  1B3E A;  1QGX A;  1UTB A;  4NF0 A;  3SEU A;  2A5T A;  2DVZ A;  3PPP A;  1B1H A;  2Q88 A;  1EH3 A;  2QJE A;  1IUD A;  3T9H B;  5ET6 A;  2Q89 A;  4R6K A;  4ZEB A;  2R9J A;  2XXI A;  3HCQ A;  3RTW B;  5H8F A;  1IZ1 A;  1OLA A;  4H8J A;  1P1W A;  1MXV A;  3TTR A;  4H5G A;  1XS5 A;  4U4X A;  2KQZ A;  2DDK A;  5KDT A;  3FXB A;  1B3L A;  4ZZA A;  4OET A;  3TZA A;  3FVN A;  2CZH A;  3WAF A;  2FIX A;  3R26 A;  1LFG A;  4MJO A;  4AB5 A;  4OQO A;  4KCC A;  5H8N A;  3BFT A;  3HHF A;  1Q9D A;  5L9S A;  3TTL A;  3K6V A;  3LR1 A;  3IK6 B;  4JXI A;  3U8Q A;  3OEM A;  4DI3 D;  2QSX A;  3T9U A;  2W7Y A;  4OVR A;  3CFX A;  1GR2 A;  4GWU A;  1NV3 A;  3RLF E;  1HSJ A;  2I0C A;  2O69 A;  3KSX A;  2X7P A;  5FBP A;  4FEC A;  3PUV E;  4R73 A;  1Q35 A;  1FQE A;  2H5Y A;  4H1X A;  3HO7 A;  2Y5K A;  3SES A;  4N17 A;  4GBW A;  2B4M A;  2E0S A;  2UVJ A;  2OBG A;  3CG3 A;  4LA9 A;  1N04 A;  1USY H;  2Q2C A;  1ZLQ A;  3OO9 A;  5TP9 B;  5AA4 B;  1T0K A;  1FRP A;  4F29 A;  2HQ0 A;  3ROJ A;  2NWJ A;  4KI0 E;  3I5O A;  3TTK A;  1OMP A;  3HN0 A;  1PB9 A;  2FHY A;  3VVD A;  1CB6 A;  2XXX A;  3RGY A;  3BKI B;  1JVX A;  1MQH A;  2RC7 A;  4P8B A;  1UTH B;  2O7U A;  2PMS A;  4G8M A;  2XXW A;  2HZL A;  2BJJ X;  5I3S A;  3R6U A;  2QL3 A;  3GYY A;  3C9H A;  2VD2 A;  1LB8 A;  4R75 A;  5AA3 A;  3OO8 A;  2I49 A;  2H4I A;  5CI5 A;  5EQ9 A;  2Y7P A;  4P11 A;  1NH8 A;  4I3E A;  1I69 A;  5FHO A;  4RPO A;  2F35 A;  4G77 A;  2ZMB A;  4H5F A;  1SI0 A;  3DP6 A;  1NNK A;  3KG2 A;  5TP9 A;  4H0W A;  3CIJ A;  5AA4 A;  4QRZ A;  1FBF A;  1RDY A;  3W15 C;  4ESX A;  1AL3 A;  1NV1 A;  4FIM A;  5IKB A;  3K1M A;  1SW1 A;  4MLV A;  3E13 X;  4RYA A;  1QJM A;  1NUW A;  1Y20 A;  1FTJ A;  3FXU A;  1R1N A;  1H44 A;  1FPG A;  1Y3Q A;  4PDH A;  1MXY A;  1UTH A;  1OVT A;  1GVC A;  2XWK A;  4EXL A;  1SVX B;  2V84 A;  5H8H A;  1FBG A;  1QW0 A;  3IR1 A;  2XXV A;  2QVV A;  2VHA A;  2CEX A;  3UA8 A;  4E0W A;  4ISU A;  4OES A;  3IOT A;  4OVP A;  1JET A;  2OZZ A;  2QMW A;  2XXU A;  1K9Z A;  5J16 A;  1Z7M E;  5CBR A;  4OVS A;  1BIY A;  3TCF A;  4X1B A;  1YCJ A;  2QS1 A;  5F24 A;  3M3F A;  1B0L A;  1RDZ A;  2DVC A;  2H99 A;  2V3Q A;  2CEY A;  1SI1 A;  1ZTY A;  4MHF A;  4HXV A;  4OAN A;  4U4S A;  2I4B A;  4PC9 A;  2QS3 A;  3N6U A;  1LBW A;  5L8D A;  4TLM B;  4MLQ A;  3EKI A;  3QIM A;  4QXD A;  4DI4 B;  2I3V A;  4XTC Q;  3TQW A;  2GHB A;  4WXJ A;  2QMX A;  5I2N B;  3IX1 A;  5EQ8 A;  5CRY A;  3BFU A;  3O6I A;  1JEV A;  4I1D A;  2OPD A;  2IEE A;  2NUV A;  3MZ9 A;  5EHM A;  3IB0 A;  2PT1 A;  4R74 A;  4NX1 A;  2HFB A;  2DE2 A;  4HE0 A;  2XXP A;  1AIV A;  1NMU A;  3IL1 B;  2XWV A;  4IO6 A;  4HTG A;  4YAH X;  3UP9 A;  2F36 A;  3H7M A;  3KGC A;  3E79 A;  4NF8 B;  3V83 A;  2MKZ A;  4F2Q A;  4RK9 A;  1FTM A;  4QSE A;  4N8G A;  1LBZ A;  3JV9 A;  3GXA A;  2DWJ A;  1MQG A;  3K02 A;  1LBC A;  1N3W A;  4OVJ A;  5IZ1 A;  4LON B;  5I2N A;  4PFB A;  4GRK A;  4GL0 A;  2NXO A;  5H8Q B;  2VD3 A;  1YAE A;  1A8E A;  3C34 A;  1NH7 A;  3FJM A;  3ZKK A;  1R9Q A;  4G61 A;  5AA2 B;  3Q26 A;  1XVX A;  2I3W A;  4KR5 A;  3VLW A;  5IAI A;  2F34 A;  2XA5 A;  4NWD A;  1JP4 A;  4P56 A;  4PAF A;  2PFY A;  1AMF A;  5CMM A;  1FSA A;  3PPO A;  5A5X B;  3MBP A;  4NF8 A;  4FAT A;  1P1U A;  4H45 A;  2D5W A;  1B3F A;  1B5J A;  2Y7I A;  3MVZ A;  3CSB A;  4IGR A;  2ANJ A;  4QFK A;  4HCY A;  3C33 A;  4FE8 A;  3T96 B;  5AE4 A;  2O1M A;  3DLN A;  1LLS A;  2AL4 A;  3C36 A;  3QSL A;  4OEN A;  1SW2 A;  4RY1 A;  1D9Y A;  3FVK A;  2WEF A;  4EUO A;  4N8Y A;  3RN8 A;  2HHM A;  3KJ7 A;  3VXB A;  1IMA A;  2HAU A;  1MPD A;  4MBP A;  2RKM A;  3OO7 A;  1LB9 A;  2DYX A;  5FHN A;  1MXZ A;  1LBB A;  4TOZ A;  2KLF A;  4KCD A;  4ZEI A;  2GQ1 A;  3ZKL A;  2QRY A;  3FD3 A;  3KSJ A;  5A5X A;  3LSW A;  4H67 A;  1B7H A;  2XWI A;  2UYF A;  3CR9 A;  3IFA A;  3TAJ A;  2VPO A;  4JSD A;  4YB7 A;  4JWO A;  5IZZ A;  2ZYO A;  4PCD A;  4HE1 A;  4PGP A;  4R2B A;  5EYG A;  2LAO A;  2DXY A;  2F5X A;  3OSQ A;  3TFL A;  4MIJ A;  1IXG A;  4TQU Q;  1FPK A;  3MJN A;  4H8I A;  1B51 A;  4WKM A;  1MY2 A;  4GX3 A;  4XXU A;  5FTH A;  3G3K A;  3MP1 A;  1MQI A;  4KYE A;  4ZEK A;  1UIV A;  2RC9 A;  3ODB A;  1XOC A;  3A3C A;  5HM4 B;  1LST A;  4GX6 A;  1S7Y A;  3THI A;  2V93 A;  2R6G E;  2HPG A;  3ZSF A;  4P0I A;  1FBE A;  4OFL A;  2VPN A;  4F31 B;  4O3B A;  4OVQ A;  3SEW A;  3N94 A;  1USY E;  4MX6 A;  3KC0 A;  4GWX A;  1OIB A;  1FBC A;  4UAB A;  1PBP A;  1Y3N A;  4YKP A;  1LFI A;  2ZYK A;  2BJI A;  3IOU A;  5DT6 A;  3PGF A;  4F18 A;  2UYE A;  3FZV A;  4AB6 A;  1B7Z A;  1SYI A;  1M5E A;  4KYD A;  1BK4 A;  3E78 A;  1QUL A;  2DE3 A;  2ALU A;  4YB5 A;  3IOW A;  1VFD A;  1B52 A;  3O9P A;  3MAM A;  1NNP A;  4LP2 B;  2ESN A;  3HV1 A;  2P0S A;  5DEX B;  3QAX A;  2F6P A;  2IA4 A;  1MXW A;  4QSC A;  1M5D A;  3TKD A;  4GVO A;  4O7I A;  3EHT A;  1S9T A;  4OFO A;  2QVU A;  1NV5 A;  1LGB C;  2YLN A;  3IFC A;  1I6B A;  2AYS A;  1UQW A;  4N91 A;  4R6Y A;  3RUM A;  3PTY A;  5T3J A;  2R71 A;  4YKJ A;  1M5B A;  4LVQ A;  2ZYM A;  1XHY A;  3K00 A;  1Y1Z A;  4F19 A;  3VLV A;  1D3K A;  4FEB A;  4EDP A;  5L9M A;  3V5A A;  4PE5 B;  1M5C A;  3W9W A;  1MM6 A;  3EHU A;  3ILT B;  2VP1 A;  4LUB A;  1NV2 A;  3OEN A;  1B4H A;  5DEX A;  2REG A;  1Q1K A;  1US5 A;  1IIT A;  1URD A;  2F78 A;  5B70 A;  5CMC A;  2I6E A;  5J1D A;  1BKA A;  2Y7K A;  3E4R A;  3FBP A;  4N07 A;  3OOA A;  1JW1 A;  4Q0C A;  3D4C A;  5DW8 A;  1BLF A;  1EU8 A;  1SYH A;  2JJK A;  1ZJL A;  4P3L A;  2GH9 A;  5JTY B;  3MW0 A;  3S2V A;  2XD3 A;  1FQC A;  1B46 A;  4PF8 A;  4ELQ A;  1FJ6 A;  3DP8 A;  1DTZ A;  2P1S A;  4ELP A;  4PFY A;  3TQL A;  4OEU A;  3CSG A;  4NWC A;  1B58 A;  5I57 B;  3VDF A;  2ONK E;  1H76 A;  4Q30 B;  2HXW A;  1XVY A;  1G0I A;  3RY3 A;  5F7V A;  4DDD A;  1A99 A;  1MY0 A;  3KEI A;  4JVD A;  4XKP A;  4BLA A;  3CFZ A;  5DVF A;  2B3B A;  1CNQ A;  3UN6 A;  3C32 A;  1MH3 A;  2PVU A;  4ZEF A;  2FA7 A;  4FBP A;  3CI8 A;  1NUY A;  1ANF A;  2XXY A;  2Y7W A;  3H6V A;  4U2R A;  1BTJ A;  1EZ9 A;  4YU0 A;  4RJZ A;  1H45 A;  4MCO A;  5EQ7 A;  4GBV A;  2Y5L A;  4N15 A;  4MMP A;  3E9X A;  3EQ1 A;  3PMX A;  1N7X A;  3VLU A;  2XXK A;  4PFI A;  3K6W A;  3BBR A;  4FOR A;  5A5L A;  4YZZ A;  4R9G A;  3OEL A;  2HXR A;  4BDN A;  4KPT A;  2F7B A;  5JTY A;  1D9Q A;  3IB2 A;  5H8H B;  4RK2 A;  5ESY A;  5I57 A;  2M8C A;  4IO5 A;  3T0J A;  4M4G A;  2RF1 A;  1J1N A;  4O3C A;  1O7T A;  2DWH A;  1FPJ A;  3H06 B;  4G4P A;  4QF9 A;  3MZB A;  3PMV A;  3K6U A;  1NUX A;  4MEV A;  2XX8 A;  4NG7 A;  3V89 B;  4JB7 A;  4KHZ E;  3QMF A;  5AA1 A;  3TCH A;  2DSF A;  4I62 A;  4GXS B;  1ZU0 A;  4H46 A;  4RNS A;  3GBB A;  4C1U A;  4F1Y A;  3IJO B;  3S9L C;  4PFW A;  2FNC A;  1K9Y A;  5ICT A;  5CM6 A;  4K3F A;  1B3H A;  2ZNU A;  3EHS A;  4U1O A;  1A40 A;  4IO3 A;  4JDF A;  5CBS A;  3PU5 A;  3A09 A;  2DS9 A;  1B32 A;  3I6V A;  4G8H A;  5TPA B;  3FAT A;  1KZ8 A;  1FPD A;  4ZS9 A;  3RT8 A;  3M8U A;  3HST A;  3PPQ A;  3G3I A;  3PPN A;  4EXK A;  1AWB A;  4PAI A;  3VXC A;  1INP A;  4H6D A;  2O51 A;  2XX7 A;  1FPL A;  3FVG A;  4QFO A;  3S4U A;  4IO2 A;  1KWH A;  5K2X A;  3L6G A;  3OD7 A;  3KBZ A;  4YKI A;  4ECF A;  2ZZX A;  1SPI A;  5DVJ A;  4Q5T A;  3G3F A;  1FW0 A;  3EPE A;  1B1X A;  4PBQ A;  4QBA A;  5K2Y A;  4F1U A;  1URG A;  4XKR A;  1JW5 A;  1PC3 A;  1POT A;  4XFE A;  3O6H A;  3TEL A;  1B7U A;  2WYK A;  1MQJ A;  3QUJ A;  3T22 A;  2F6G A;  2QS4 A;  3LSX A;  3S9E A;  1MXX A;  1ATG A;  3PD8 A;  1P1Q A;  1Y1M A;  5TPA A;  4JVI A;  4ELR A;  4O94 A;  4ZED A;  3OEK A;  1PDA A;  3FV2 A;  4RPN A;  3MYU A;  4GLI A;  1FPI A;  1FBP A;  1NV4 A;  1L5T A;  2Q9T A;  4ND9 A;  5L9O A;  1Y3P A;  3EN3 A;  1H3D A;  3K2D A;  3PV0 E;  4ZEC A;  3MVY A;  3ZS6 A;  4YMB A;  2NOO A;  3KOT A;  4UA8 A;  3B8B A;  1R9L A;  4OYV A;  1FQA A;  1WVJ A;  2P3N A;  1RYO A;  2F3D A;  3VV5 A;  4RXL A;  1MPC A;  1LCF A;  1Z7N E;  2QS2 A;  3AXF A;  1FTL A;  3N6T A;  4DXB A;  4P9K A;  3K4U A;  3OO6 A;  4P0G A;  4YB6 A;  1VR5 A;  4WEP A;  4DXC A;  2ZZW A;  4LN5 A;  1QKA A;  3ILU B;  4EQ9 A;  2PFZ A;  1M5F A;  1B5I A;  4NF6 B;  1IMF A;  1SBP A;  3VVF A;  4MFI A;  4DXU A;  4HW8 A;  1MXU A;  2XXT A;  4NTL A;  3O28 A;  4KD5 A;  1EZP A;  4HCW A;  1ZMG A;  3LV0 A;  2X26 A;  3CHG A;  4OER A;  1DSN A;  3O2A A;  5I58 B;  1R6Z A;  3PUX E;  2F3B A;  1YZ0 A;  3V8X B;  4YMA A;  4UAC A;  4ZDM A;  5H8S A;  1XC1 A;  1A54 A;  3H4Z A;  1PB7 A;  3IOR A;  2XXR A;  1GGG A;  2Z23 A;  3H6T A;  4N13 A;  4FJP A;  4DLD A;  3BIG A;  4F39 A;  2V4C A;  2OLB A;  2CMO A;  3D1R A;  4TLL B;  4NF6 A;  2F97 A;  1IIW A;  3MPK A;  3VVE A;  4POX A;  1QUI A;  5M2V A;  1JQF A;  2GRV A;  1N7W A;  2THI A;  4P1E A;  1FTO A;  4PDD A;  2F7C A;  4GWW A;  1VDW A;  1LAG E;  3LSL A;  4JSO A;  3KN7 A;  5I58 A;  1PBQ A;  4F3B A;  3FIR A;  1MY4 A;  3JYR A;  4IB2 A;  4XF5 A;  2DXR A;  2OPE A;  3G7W A;  3MST A;  3EF7 A;  3MQ9 A;  3PMW A;  2OWZ A;  1RYX A;  2NVU B;  1TWY A;  4OXV A;  2XXQ A;  3QYT A;  1FPE A;  1FJ9 A;  3FUZ A;  4KYS A;  3K6X A;  4NED A;  4PFR A;  1OVB A;  3MVW A;  1IXI A;  1ZBM A;  3B50 A;  3IAZ A;  4NN3 A;  2REJ A;  2UVG A;  3TTN A;  5ICQ A;  3KOS A;  2WBD A;  1EYJ A;  4I8C A;  4DCX A;  1HSE A;  4THI A;  1LBY A;  2I48 A;  2UVI A;  2FIE A;  4HE2 A;  1FQF A;  1SD3 A;  3JZJ A;  1DK4 A;  3KBR A;  4PET A;  4X48 A;  2X7Q A;  3MWB A;  4MF3 A;  4N4U A;  4QSD A;  1XI6 A;  2V25 A;  2WBB A;  1TT1 A;  3FJG A;  3MZ1 A;  4NE4 A;  4PAK A;  3TPA A;  1URS A;  4X04 A;  4ZZE A;  1POY 1;  2DWA A;  4ZE8 A;  3M3K A;  1GTK A;  2V3U A;  4LZ5 A;  2HZK A;  3HFU A;  3SDF A;  3MP6 A;  4GQO A;  4H65 A;  3G3G A;  4F3P A;  4GX4 A;  3CVG A;  4HS7 A;  1DPE A;  1Y4C A;  4IO4 A;  1MDQ A;  5AA2 D;  4DCY A;  1JVY A;  4BDR A;  3ECR A;  1WDN A;  5ITP A;  3O29 A;  4OHN A;  4GWZ A;  2XWO A;  3D4G A;  2Z8D A;  2G29 A;  5DVI A;  3W9V A;  1LAF E;  3TEP A;  4ONY A;  1I6Q A;  1NV0 A;  3KC1 A;  2ZZV A;  2I58 A;  1TXF A;  4WED A;  5I5P A;  2VGQ A;  4IY5 A;  3OSR A;  4ESW A;  3Q25 A;  4JWY A;  1YYZ A;  3SEX A;  4YKK A;  1AOV A;  3MP8 A;  1MDP 1;  4U1Z A;  5IM2 A;  1EYK A;  2CZK A;  1MM7 A;  1OLC A;  4LQ2 A;  3T9V A;  2P3V A;  3LBS A;  2Q8J A;  1S50 A;  4F3S A;  3U72 A;  1B3G A;  1NV7 A;  3RPL B;  5I7I A;  3B6W A;  4GFR A;  1FQD A;  3DM0 A;  4G68 A;  2GHA A;  2PBW A;  3N5L A;  2I0B A;  3H3G A;  5EYF A;  3UOR A;  4G8N A;  3IO4 A;  4LQ5 A;  3NOH A;  4R9F A;  4NAP A;  5ET5 A;  3QK6 A;  3TDJ A;  2Z22 A;  1HSL A;  3LUZ A;  5EQA A;  4R6H A;  5ET7 A;  3H6U A;  3O6G A;  4FED A;  4ELO A;  5I84 A;  2OWT A;  3Q28 A;  1DBZ A;  4DE8 A;  3RQT A;  1QVS A;  2O68 A;  4F1V A;  3SET A;  3RT6 B;  5ET8 A;  3M3L A;  3KN8 A;  3TYH A;  1B05 A;  2I4C A;  1IEJ A;  3LC8 A;  1QUJ A;  2PCR A;  1XT8 A;  3RPL A;  3WAE A;  4PTK A;  4Q8R A;  4P1L A;  1Y4T A;  2UVH A;  4X9T A;  4GXA A;  4LAT A;  3HPI A;  4L17 A;  2PYY A;  2H25 A;  3S9M C;  3FVO A;  2OJT A;  2PX1 A;  3MC2 A;  3K01 A;  2HEU A;  3RNN A;  4G2Z A;  1FPF A;  1MRP A;  4R72 A;  3BIH A;  4FAJ A;  2XHD A;  3UGW A;  2A5S A;  4XKN A;  2QFL A;  5I2K B;  4ZE9 A;  4BDO A;  3VE1 B;  2Q2A A;  4NF5 B;  3OMB A;  2VT5 A;  4GWY A;  1B4Z A;  3SKP A;  4KFQ A;  2Q74 A;  4QFN A;  4OFJ A;  4MAG A;  4OWD A;  1P99 A;  5LOM A;  3U1O A;  3DP4 A;  3N26 A;  4N6P A;  4KQP A;  4OMB A;  3K1P A;  5JEI A;  3P7I A;  5CC2 A;  3K1N A;  2VOZ A;  1CE2 A;  3KJT A;  1JNF A;  4P47 A;  4OTE A;  1SDX A;  2D21 A;  3CRB A;  2AIX A;  2Y84 A;  2OWS A;  1B2H A;  2RCA A;  2HAV A;  5CMK A;  2AL5 A;  4O3A A;  1I6A A;  1G0H A;  1VSO A;  4MNP A;  4KXP A;  4JBZ A;  3Q29 A;  1MS7 A;  3SEV A;  2B4L A;  1US4 A;  3H03 A;  3GZG A;  4QFL A;  3F11 A;  4I9D A;  3IOV A;  1N76 A;  2UXA A;  5I2K A;  3B6T A;  4N6K A;  4NF5 A;  4I3Y A;  1NNF A;  1MH4 A;  1MG1 A;  1N3X A;  1NFT A;  1N84 A;  4PGN A;  3G3J A;  3LUY A;  1DTG A;  4GWS A;  2DWI A;  1D4N A;  4MNI A;  5B7D A;  4F22 A;  2XD2 A;  3GLB A;  2CZI A;  1SW4 A;  4NHB A;  1IMC A;  3PPR A;  4OVT A;  4PP0 A;  2D3I A;  2B65 A;  4GOT A;  5DYH A;  4PF6 A;  1A7L A;  5CMB A;  1P1O A;  1LCT A;  2F8D A;  2ZNS A;  3MVX A;  2RC8 A;  1QUK A;  3SZP A;  2ZXT A;  1ZKB A;  5DTB A;  3FV1 A;  2RIN A;  2ONR A;  3FXR A;  3CFL A;  2XX9 A;  5I56 B;  3Q27 A;  3RPW A;  4G68 C;  1SQY A;  2ZNT A;  2OK2 A;  3PUZ E;  1B6H A;  1DCU A;  1EZO A;  4X1D A;  4PBH A;  4O7M A;  4DZ1 A;  4EF1 A;  1BP5 A;  4N6D A;  5ITO A;  1B0H A;  1H43 A;  5ISU A;  4XIG Q;  3RYD A;  4GWO A;  2ABH A;  4U22 A;  1FTA A;  2FVZ A;  5BWJ A;  1MPB A;  3TCG A;  1FTK A;  3A3U A;  4BDL A;  4EQ7 A;  3O66 A;  5TU0 A;  3DEL B;  4PFT A;  2Z8E A;  4GF8 A;  1LBX A;  1TFA A;  5I56 A;  1MY1 A;  4NMY A;  1LFH A;  5FHM A;  3H6W A;  3U65 A;  2L5V A;  4U23 A;  1IXH A;  4POW A;  3FJ7 A;  2DOJ A;  1YPN A;  1IMB A;  1FBH A;  2WX9 A;  1LAX A;  1N0T A;  1RKM A;  1JEU A;  4QFP A;  2FBP A;  1GV8 A;  3KFM A;  2G93 A;  5HPQ A;  2E1S A;  4AQ4 A;  1FPB A;  3C31 A;  3CG1 A;  3U93 A;  4IR8 A;  1JW4 A;  3FXQ A;  4RA1 A;  1PB8 A;  1DOT A;  4LZ8 A;  5JK4 A;  4QHQ A;  3E3K A;  2DP8 A;  3UIF A;  2GFE A;  4MNC A;  1FQB A;  3T66 A;  3T1B A;  3TOD A;  1QKB A;  3KN3 A;  2O84 X;  4AS5 A;  1FCK A;  4DIG A;  1MQD A;  5KCJ B;  2RCB A;  1NUZ A;  3FAS A;  1F9B A;  4F3G A;  4C0R A;  5F1Q A;  1B5H A;  5EHS A;  3C4M A;  2OX3 A;  1AH5 A;  5LDZ A;  2ONS A;  4XEQ A;  2R8T A;  3ONM A;  5HBC A;  1IMD A;  1NI9 A;  1PEB A;  1IME A;  1P1N A;  2B3F A;  3PUW E;  4OEV A;  5LTC A;  4OA4 A;  2QVR A;  2H98 A;  1SW5 A;  1DMB A;  3IB1 A;  2O6A A;  1B9J A;  3O97 A;  2YPN A;  3K0V A;  3B6Q A;  3S9N C;  1TFD A;  4PQJ A;  4F2O A;  5H8Q A;  4PFU A;  5KCJ A;  2XXH A;  3T9X B;  2DE4 A;  4R2F A;  1YTV A;  1UIU A;  1VE4 A;  1RDX A;  3TUS A;  5AA2 A;  1EYI A;  1LEV A;  4GD5 A;  2KR0 A;  5IZ3 B;  2Y7R A;  1KA0 A;  3HHG A;  4IGT A;  4IY6 A;  1ZIU A;  4AS4 A;  1O64 A;  3ISP A;  4BDM A;  4IO7 A; 
#chains in the Genus database with same CATH homology
 2CZK A;  2P3V A;  4NX1 A;  2DE2 A;  1KA1 A;  1NUX A;  4HE0 A;  4MEV A;  4NG7 A;  1NV7 A;  3RPL B;  2XWV A;  4M1V A;  3QMF A;  5I7I A;  4H46 A;  3E79 A;  2MKZ A;  1FBD A;  1K9Y A;  5CM6 A;  4N8G A;  1LBZ A;  1LBV A;  3NOH A;  4NAP A;  5IGA A;  5ET5 A;  5IZ1 A;  5EYH A;  4PFB A;  1KZ8 A;  3LUZ A;  5EQA A;  1FPD A;  2Q8M A;  5ET7 A;  4X8R A;  5IZ3 A;  1DBZ A;  4F1V A;  1AWB A;  4PAI A;  4G61 A;  5ET8 A;  1INP A;  4JVC A;  4N81 A;  2XA5 A;  4NGU A;  1FPL A;  1JP4 A;  4P56 A;  4PAF A;  2PFY A;  2PCR A;  1FSA A;  3KBZ A;  3RPL A;  4PTK A;  2WYP A;  4P1L A;  4I40 A;  4X9T A;  2ZZX A;  1SPI A;  4H45 A;  4YIC A;  4O8M A;  4NQ8 A;  4PBQ A;  4QBA A;  4F1U A;  4HCY A;  4XFE A;  4PE3 A;  1FPF A;  2WYK A;  3BIH A;  2WEF A;  4JVI A;  4N8Y A;  2QFL A;  4O94 A;  1NV6 A;  2HHM A;  1IMA A;  2VT5 A;  4GWY A;  2QPQ A;  3MYU A;  3A29 A;  2Q74 A;  1FPI A;  4MAG A;  1FBP A;  1NV4 A;  1YXI A;  2Q9T A;  1QGX A;  4NF0 A;  2GQ1 A;  4P47 A;  2DVZ A;  3B8B A;  5ET6 A;  2P3N A;  2F3D A;  2XWI A;  3IFA A;  2VPO A;  1G0H A;  5IZZ A;  4MNP A;  4KXP A;  4P9K A;  4PCD A;  4HE1 A;  2B4L A;  4PGP A;  5EYG A;  2F5X A;  2KQZ A;  2ZZW A;  4LN5 A;  2DDK A;  4MIJ A;  3FXB A;  2PFZ A;  1FPK A;  1IMF A;  4N6K A;  4GX3 A;  4I3Y A;  2CZH A;  4PGN A;  4GWS A;  2FIX A;  4MNI A;  4HCW A;  4MJO A;  3LV0 A;  3CHG A;  1Q9D A;  2CZI A;  4GX6 A;  4NHB A;  1IMC A;  4OVT A;  2HPG A;  2F3B A;  1YZ0 A;  4PF6 A;  1FBE A;  2VPN A;  4DI3 D;  3SZP A;  4OVR A;  4OVQ A;  4GWU A;  1NV3 A;  4MX6 A;  3KC0 A;  4GWX A;  5FBP A;  1FBC A;  4UAB A;  3BIG A;  2Y5K A;  4N17 A;  2BJI A;  2V4C A;  4GBW A;  2B4M A;  3D1R A;  4F18 A;  1DCU A;  4PBH A;  4P1E A;  1BK4 A;  4O7M A;  3E78 A;  2DE3 A;  4PDD A;  1FRP A;  4N6D A;  4GWW A;  1VDW A;  3ROJ A;  3RYD A;  2FHY A;  1FTA A;  2FVZ A;  4O7I A;  4XF5 A;  4P8B A;  3MST A;  2QVU A;  1NV5 A;  2OWZ A;  2HZL A;  5I3S A;  3IFC A;  3GYY A;  1LBX A;  1FPE A;  1FJ9 A;  4N91 A;  5EQ9 A;  3PTY A;  3U65 A;  4PFR A;  5T3J A;  2L5V A;  4I3E A;  3B50 A;  1IMB A;  1FBH A;  2WX9 A;  4NN3 A;  4F19 A;  2FBP A;  1FBF A;  2WBD A;  1RDY A;  1EYJ A;  3W9W A;  1NV1 A;  1FPB A;  4IR8 A;  1LBY A;  1NV2 A;  2FIE A;  4HE2 A;  5J1D A;  1NUW A;  5JK4 A;  1DK4 A;  3FBP A;  1FPG A;  4PET A;  4PDH A;  4N4U A;  1XI6 A;  4MNC A;  2XWK A;  2WBB A;  5DW8 A;  3T1B A;  2JJK A;  1FBG A;  4PAK A;  4P3L A;  4AS5 A;  2QVV A;  2CEX A;  4X04 A;  4PF8 A;  1FJ6 A;  1NUZ A;  4OVP A;  2OX3 A;  2HZK A;  3HFU A;  1G0I A;  1K9Z A;  5J16 A;  5LDZ A;  4OVS A;  4GX4 A;  4JVD A;  4XEQ A;  2R8T A;  1CNQ A;  1IMD A;  1NI9 A;  5F24 A;  1RDZ A;  2V3Q A;  2CEY A;  1IME A;  4MHF A;  4FBP A;  1NUY A;  5LTC A;  4HXV A;  4OA4 A;  4OAN A;  2QVR A;  4GWZ A;  2XWO A;  4PC9 A;  4MCO A;  5EQ7 A;  4GBV A;  2Y5L A;  4N15 A;  1LBW A;  4MMP A;  2XXK A;  4PFI A;  3W9V A;  3EKI A;  4QXD A;  4DI4 B;  5A5L A;  4YZZ A;  1NV0 A;  2HXR A;  3KC1 A;  2ZZV A;  2DE4 A;  5I5P A;  1D9Q A;  1RDX A;  5ESY A;  5EQ8 A;  1EYI A;  1LEV A;  3T0J A;  2KR0 A;  1YYZ A;  5IZ3 B;  1KA0 A;  4AS4 A;  3ISP A;  1FPJ A;  5IM2 A;  1EYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...