4GWUA

Crystal structure of fru 2,6-bisphosphate complexes of porcine liver fructose-1,6-bisphosphatase with filled central cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
307
Chain Sequence
IVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAIHRAVRKAKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMVNGVNCFMYDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSPEDVTELLEIYQKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic Central Cavity in Fructose-1,6-bisphosphatase is Essential for the Synergism in AMP/Fru 2,6-bisphosphate Inhibition
rcsb
source organism Sus scrofa
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 95
structure length 307
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4gwuA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4gwuA02
5ESYA 2WBBA 5EQ9A 1INPA 1JP4A 3D1RA 1NI9A 2VT5A 1FSAA 1NUZA 4I3YA 1LEVA 1YYZA 1FPGA 2Q74A 4GWUA 4I3EA 1DK4A 4GX4A 2QFLA 3A29A 4GWWA 1NV4A 4GBWA 3RPLB 1YXIA 1LBVA 1EYJA 3KC1A 1RDYA 5I3SA 1NUWA 5ET6A 5F24A 4MJOA 5EYGA 1NV2A 4HXVA 5ET7A 2P3NA 1LBWA 2FBPA 4G61A 1CNQA 1SPIA 1IMBA 4GX3A 4FBPA 5ET8A 1IMEA 1IMFA 1QGXA 5EQ7A 4H45A 1FBPA 3RYDA 1FBFA 5IZ3A 4AS4A 2Q8MA 4GWSA 1RDXA 1FBHA 1FBGA 1NV3A 5IZ3B 1IMDA 2Y5LA 3BIHA 5LDZA 1LBZA 2P3VA 2OWZA 1KA1A 1FBCA 2F3BA 3LUZA 1FPKA 5J16A 2BJIA 5FBPA 4GWXA 4IR8A 5EYHA 2R8TA 1DBZA 2FIXA 1KA0A 1XI6A 1NV0A 4HE2A 1NUYA 3T0JA 1FBEA 1FPJA 1FPBA 3RPLA 2QVVA 1NV5A 2HHMA 2CZHA 1IMAA 2QVRA 3KC0A 4HE0A 5EQ8A 1FJ6A 2CZKA 4PTKA 1RDZA 3BIGA 4AS5A 4KXPA 2WEFA 4GBVA 2Y5KA 1K9ZA 2F3DA 1D9QA 1FPIA 1LBYA 4I40A 1FBDA 1EYKA 1DCUA 2OX3A 3IFAA 3IFCA 5EQAA 5ET5A 1BK4A 4GWYA 2PCRA 1Q9DA 1AWBA 1YZ0A 3LV0A 4HE1A 1G0IA 4GWZA 1FRPA 1FTAA 5A5LA 2DDKA 2FHYA 4GX6A 2WBDA 1LBXA 1FPEA 2FIEA 4H46A 2FVZA 2GQ1A 1NV6A 1EYIA 2QVUA 1K9YA 1VDWA 1IMCA 1NV1A 1FPFA 5T3JA 1FJ9A 3FBPA 1KZ8A 4QXDA 1FPDA 1FPLA 4O7IA 3B8BA 5IZ1A 1G0HA 3ROJA 5DW8A 1NUXA 3QMFA 4N81A 2CZIA 3KBZA 2JJKA 1NV7A
chains in the Genus database with same CATH superfamily
4RNSA 3RN8A 2UVIA 2XWOA 3CG3A 4UACA 2GRVA 3CR9A 4PFYA 4GVOA 4F2QA 3U65A 4OTEA 1N84A 3IB2A 3IOWA 1SW5A 4N07A 2QMWA 4AQ4A 4FEBA 1B5HA 5ET7A 2FBPA 3F11A 3KN3A 1BKAA 1FBPA 1B6HA 4X1BA 4AS4A 4NF6B 4GWSA 4WEDA 2E1SA 3BIHA 3SETA 1LBZA 2X26A 4G68B 1B40A 5H8NB 1KA1A 4ELPA 1FBCA 2BJIA 3IOVA 2Z22A 1QUJA 1DBZA 4UA8A 1A99A 3VLUA 4KR5A 1IIWA 2QVVA 1UTHA 2DE2A 2H98A 2Y7RA 1IUDA 1WODA 4IGTA 5H8QA 4DDDA 3GYYA 3TCGA 4MEVA 3PTYA 1B1XA 3EQ1A 3BFUA 3KBRA 4HW8A 3IFAA 1S7YA 3B6WA 3T9VA 5A5LA 2P1SA 1QKAA 4GRKA 1MH4A 3MQ9A 3PUWE 4P0IA 2F8DA 5T3JA 3H7MA 3W9VA 2XXHA 4M1VA 1G0HA 1B51A 2IEEA 3H6WA 2UVGA 4I9DA 5A5XB 4IY5A 4ZEDA 2Y7KA 3CIJA 1FPGA 3LSFB 1XOCA 3A29A 1NV4A 4OHNA 2OJTA 5L9SA 1MXUA 4GQOA 5B70A 2AL4A 4QHQA 4R2BA 5H8HB 4Q8RA 4JXIA 1S50A 2RKMA 4U2RA 4N6DA 4MNPA 4MX6A 3UP9A 4IGRA 1LAHE 4HCYA 2REGA 2B65A 4ECFA 2UYFA 1I69A 3KOTA 2PYYA 3HPIA 4RY1A 4KCCA 1BTJA 3MW0A 5H8HA 2XXRA 3K01A 4PAFA 1FBEA 1XVYA 2A5SA 3SKPA 2CZHA 4E0WA 1IXHA 5I59B 1DMBA 3OD7A 1Y3QA 3U92A 4FORA 4PAIA 3I6VA 4GBVA 3FZVA 3FJ7A 3EHSA 1A54A 3R6UA 1MQHA 3VXCA 5ITPA 3O9PA 2ZZXA 1R6ZA 2Q8JA 4N91A 4G77A 4GF8A 4YU0A 3MJNA 1EYIA 4EXLA 5AA2A 4WXJA 4OFJA 3GBBA 1AIVA 3KJ7A 2ZYOA 1Q35A 5F7VA 5TP9B 4NMYA 5ITOA 5ICQA 2DVZA 4XKRA 5K2XA 3PUVE 4YKPA 3ONMA 3O6HA 1B52A 5H8SA 1JQFA 1MXZA 3IO6A 1QUKA 2ALUA 5IAIA 1DOTA 2O51A 4H1XA 4OVSA 5CMKA 1A55A 3PGFA 4P9KA 3R26A 4QSCA 3HV1A 3E9XA 4PBQA 4BDNA 4HE2A 1FQEA 3DP4A 1BLFA 2F7AA 1NFTA 2Z8EA 2D5WA 2BJJX 3CRBA 3T66A 1FTLA 4BDMA 4RPOA 3ILTB 1B3FA 2F3DA 4JWOA 4YB5A 1NL5A 2B3BA 2ZNTA 1D9VA 2VP1A 1RKMA 3TQWA 2DVCA 3FVKA 3HHFA 1YTVA 4GOTA 2DSFA 3G7WA 3TTNA 3SEUA 2FHYA 4IO2A 4OVTA 3RUMA 1LBXA 3KSJA 3S4UA 2XXYA 3S2VA 5AA2D 1PB7A 1MG1A 4EQ9A 2OZZA 2CMOA 3KG2A 3E78A 3B6QA 5I5PA 2I4BA 3FD3A 2HFBA 4N81A 2CZIA 3EN3A 1DPEA 4R9GA 2WBBA 3C35A 4F22A 1B5JA 4MNCA 3RGYA 4IO7A 1ANFA 1I6AA 4F3PA 3I3VA 5A5XA 4GBWA 3Q29A 2QS4A 4O7MA 3DM0A 3FV2A 2XXTA 1N76A 1JVYA 4G61A 1IMBA 4FE8A 3TTRA 3TPAA 4H65A 5AA4B 3RYDA 1MH3A 3HCQA 3A3UA 1HSEA 2I4CA 3JZJA 1FBGA 4NX1A 1IMDA 3RLFE 5IZZA 1POY1 1LAXA 1FTOA 3T9HB 1USYH 5FBPA 4LZ5A 5EYHA 2I3VA 4ZE9A 2UVJA 4M4GA 2P2AA 3JV9A 5CI5A 4XXUA 2QVRA 3T1BA 3LUYA 1BP5A 4HE0A 2DQVA 5CBRA 1TFAA 5I58B 2QS2A 5L9OA 2R71A 4F2OA 1K9ZA 3PD8A 4OENA 1FBDA 1QULA 4NF5B 3EF7A 3TEPA 4DCXA 4HTGA 2OWTA 2Y7IA 1IITA 5EQAA 1LB9A 4LZ7A 2VGQA 2PCRA 2XHDA 1YZ0A 1TWYA 2F5XA 1LB8A 4OYVA 1FTAA 4G8MA 4GX6A 2FIEA 2R9JA 4FIMA 1P1WA 4WKMA 4X8RA 3L6HA 1M5EA 2ZYKA 4MNIA 4OWDA 1FPLA 2QS3A 4O7IA 3RPWA 2DP8A 3B7DA 4F1UA 4DI4B 1SDXA 2Q2AA 1GR2A 2GHBA 1NMUA 1MY0A 3SZPA 4LQ5A 4BDLA 2I58A 1Z7ME 3PPNA 4QFNA 2I0BA 4F1YA 4FJPA 3SESA 4BLAA 4BDOA 4IO4A 3RQTA 3FATA 2VPNA 3OENA 1RYXA 3Q27A 2D21A 2PT2A 1AMFA 3IL1B 2F3BA 1YAEA 1FPKA 1N7WA 5TPAB 5KZTA 3USDA 2VD3A 4PP0A 3N6TA 4JDFA 1XI6A 3T0JA 1NH8A 4QFOA 1FPBA 5HPQA 3U8QA 1SW2A 1NV5A 1B3EA 2HHMA 2F36A 3K6XA 3TCFA 3KC0A 5EQ8A 4N13A 4AS5A 3BIGA 1FTJA 3O66A 1D3KA 2X7PA 2Y5KA 3K02A 4U1ZA 1P1OA 3VFJA 5B7DA 1OQGA 1NKXA 4LA9A 3E4RA 4P1LA 2CZLA 1MY3A 3MPLA 4YMAA 4PF8A 4ZEKA 3DELB 1FPDA 2Z8FA 2XWVA 4NF0A 2OWSA 1B7HA 3KFMA 1EZOA 1XHYA 3K1NA 3W9WA 2JJKA 1LBVA 1B3HA 1M5DA 1INPA 1FQCA 5I2KA 4QF9A 2V93A 5CMMA 4DXCA 5DT6A 1F9BA 2RC9A 1LCFA 1CE2A 1EYJA 5K2YA 1MY4A 5L8DA 3QK6A 4U4XA 3DP8A 1XT8A 3FXQA 4LVQA 4O8MA 1SW4A 1Y1MA 3IAZA 5BWJA 2H25A 5TP9A 5ICTA 4R9FA 3K6WA 4OANA 2RC8A 1EH3A 3N5LA 4XFEA 4X9TA 4NEDA 3SDFA 4H8IA 4P3LA 3O29A 4JBZA 4I1DA 1WDNA 4P0GA 3RT6B 4R75A 3CI8A 3OSQA 1NNTA 1MQDA 2AIXA 3MP6A 4PE3A 1MQGA 4ELQA 4N17A 1JEVA 1FQDA 1JVXA 5KCJB 1B1HA 1B9JA 4TLMB 1IMAA 2QSXA 2Y7PA 3FVOA 3KZGA 4X04A 4R72A 4ZDMA 2I0CA 3KOSA 3V83A 1KWHA 3LSLA 2DWHA 5IKBA 3MWBA 3O2AA 3GXAA 1A8FA 1Q9DA 3MUQA 4QFKA 5H8FB 3IK6B 1G0IA 4KPTA 3S9EA 1LSTA 3KN7A 1GVCA 3OEKA 5AA1A 5J1DA 1I6QA 1A40A 4JB7A 5TPAA 3MPKA 3DP6A 2XXWA 4IY6A 3FV1A 2THIA 4RK2A 3FBPA 4LQ2A 1JEUA 4N8GA 3K6VA 1VFDA 1P99A 1GTKA 5FTIA 3HFUA 2QL3A 2F97A 3MAMA 1YYZA 4YMBA 1DK4A 3EHUA 2QFLA 1LCTA 3EPEA 2PMSA 1NUWA 3CSBA 4MJOA 1NV2A 5ELVA 2P3NA 4Z0IA 3S9MC 1IMEA 1Q1KA 3MP8A 4TLLB 1R1NA 4OVPA 3VXBA 1NV3A 5KDTB 4PC9A 1MY2A 4ZZAA 5TU0A 2OWZA 4H67A 1ZMGA 4MFIA 4QBAA 1DPPA 4DLDA 4F19A 1D9YA 2WYKA 4IR8A 1FCKA 3O97A 1NV0A 3PUXE 3M3FA 3TMGA 2B4LA 3OO9A 1AOVA 3TTMA 2ONSA 4OVQA 1ZJLA 2HAVA 2OBGA 4G2ZA 2PFYA 4KHZE 3TKDA 4H5FA 2DS9A 1FQFA 2ZYNA 1UTBA 4MLVA 4NWDA 5JTYB 4PQJA 4RA1A 3LV0A 5I57A 1B32A 2CEXA 2ZNSA 2WBDA 4NF4A 4JSDA 3KSXA 4MIJA 2XXUA 3TODA 4ZEIA 3M3KA 2I48A 1LFGA 1IXCA 4OXVA 2PT1A 4N15A 3VLWA 3PPOA 1H3DA 5I56B 4EQ7A 4OEUA 4LATA 4DXUA 1JW1A 1UIUA 2RC7A 2WYPA 2I49A 3H6VA 5I59A 4HXVA 1LBWA 1YPNA 4NWCA 3UORA 5EQ7A 5IZ3A 2V3TA 3MZBA 3G3GA 4HS7A 3T93B 1B05A 4FECA 5DYHA 5BUUA 4NN3A 2ONKE 1M5FA 2X7QA 1UTBB 3MVXA 5LTCA 2I6EA 4F31B 2FA7A 2FYIA 2QMXA 3VLVA 2FIXA 4PBHA 5JEIA 1H76A 4N4UA 3BFTA 1PB9A 4NAPA 1DSNA 2CZKA 4G4PA 5I2KB 1LBYA 4L17A 3FIRA 1M5BA 1DCUA 3NOHA 1GGGA 1OLAA 1Y4TA 2W7YA 1XS5A 3OO6A 1BK4A 4LZ8A 4MCOA 1Z7NE 2Q88A 3T96B 4PE5B 4EXKA 4C1TA 2GQ1A 3W15C 1NV6A 1OLCA 3Q25A 4ND9A 1BIYA 1DTZA 1FPFA 1B5IA 4ISUA 3MYUA 2A5TB 4EF1A 2XXIA 2L5VA 4MH5A 4PFRA 3QMFA 1GV8A 4OERA 3CVGA 3OXNA 3ZKKA 4LN5A 1R9LA 2Q74A 2HXRA 2O6AA 1PDAA 1NH7A 3H06B 2H4IA 5FHOA 4GWWA 2ESNA 3RPLB 2KLFA 1SYHA 2DWAA 1N7XA 4O3AA 3G3FA 3OSRA 3TFLA 3N26A 1B46A 1ZIUA 4NF8B 4KYEA 3T22A 2DXYA 1NNPA 3PUYE 3UK4A 5CMBA 3N94A 2REJA 1ZKBA 4F1VA 3FJGA 1B7ZA 1IQ7A 2O7UA 1SVXB 2DWJA 4KCDA 3QSLA 4FEDA 1N0TA 4Q5TA 3SEYA 3UIFA 3FVNA 3O28A 3G3HA 4DI3D 1N3WA 2PBWA 3S9LC 3EHTA 1P1UA 4P56A 2MKZA 4PTKA 4E0XA 1Y3NA 4RJZA 3OMBA 3ZS6A 4O94A 4PFIA 3IFCA 3H6TA 4R6KA 2HXWA 4NG7A 1IXIA 3V89B 3QAXA 4FATA 1US4A 4O3BA 4EUOA 1Y20A 4F3BA 1K9YA 2DE4A 1QW0A 2IA4A 4ZECA 4YKJA 2RF1A 5DW8A 5DEXB 2H5YA 2XD2A 3C4MA 4GL8A 2RINA 1D4NA 2KQZA 4NF8A 4H6DA 1UIVA 4XKPA 3AXFA 4QSEA 1IXGA 4TOZA 3GLBA 3MVYA 4JWXA 2GH9A 3MVZA 1YXIA 2Q2CA 3RTWB 1ZU0A 2DE3A 3MZ9A 4LUBA 1SPIA 1Y9UA 1IMFA 1LBBA 1NNKA 2XXVA 4GD5A 1EZPA 1R9QA 3KJTA 4I8CA 2HAUA 1SQYA 4IO3A 4LONB 2Y5LA 5I2NA 5EYFA 3QIMA 5AA4A 2O84X 3C33A 3WAFA 3IX1A 4KI0E 3THIA 2UXAA 1MXWA 2O1LA 1NNFA 1IEJA 4GLIA 3IOUA 3T9UA 3TQLA 2DOJA 1P1NA 2VPOA 1FPIA 2VD2A 1FTMA 1QUIA 1B3LA 4MHFA 4DZ1A 4PFWA 3CHGA 4THIA 4JVIA 1H45A 4OVRA 1L5TA 3CSGA 1XVXA 2HZKA 2GFEA 3ODBA 4YB6A 2XWKA 3PV0E 2FNCA 3C31A 2HQ0A 5CMCA 1B0LA 4G68A 4ZEBA 2RCBA 4P8BA 5CC2A 1OQHA 3GZGA 3B6TA 1TT1A 2Q9TA 3O6GA 1B4ZA 2UVHA 4AB5A 5H8FA 1PC3A 4ZS9A 1NI9A 1FSAA 1NUZA 1POTA 3IJXB 4I3EA 2ANJA 3HO7A 4MMPA 1S9TA 3Q26A 4H5GA 5KCJA 3CFLA 3KC1A 4BDRA 4UABA 4EDPA 1MM6A 4YAHX 4U22A 5EYGA 2QRYA 3V5AA 2V4CA 3TAJA 4H45A 1IZ1A 2NXOA 2Y84A 3VVEA 4OFLA 4NF4B 3RT8A 5I57B 3KN8A 1MDQA 2NOOA 3L6GA 1ZLQA 4PDHA 3PMWA 3FXUA 3UN6A 3RY3A 3RPLA 5I58A 2H99A 5CRYA 3I5OA 1UTHB 3VVDA 3MVWA 1RDZA 1XC1A 2XA5A 2V3QA 3D4CA 4N8YA 4DXBA 2OX3A 3FASA 3TCHA 4PFUA 3TDJA 2XXPA 2A5TA 2Z23A 4HCWA 3HSTA 5KDTA 3IORA 3H6UA 3K6UA 2H9BA 1TXFA 4OA4A 4YKKA 1OIBA 5EHMA 4QXDA 4GL0A 4MF3A 3ROJA 2E0SA 3IB1A 2XX7A 1NV7A 4OVJA 3D1RA 4EF2A 3TTKA 4X48A 2V25A 1MS7A 2LAOA 1MDP1 1RDYA 2V3UA 4GIZA 4RPNA 1N3XA 1Y4CA 2ZZWA 1MY1A 1DTGA 4PFTA 4OFOA 1JNFA 3PPRA 4JVCA 3KGCA 5IZ3B 2V84A 1MQJA 4QFLA 1QKBA 1URDA 3LSWA 3SEXA 1OMPA 4GFRA 3PMXA 2B4MA 3LC8A 4DE8A 2ZZVA 1HSJA 3V8XB 5DVIA 5I56A 1VE4A 2OPEA 2F7BA 1O7TA 4I40A 3FXRA 1UQWA 5DTBA 2PX1A 5AA3A 1HSLA 2GHAA 4F3GA 4ONYA 1B0HA 4HE1A 1II5A 4R6HA 5JK4A 4PCDA 4RK9A 3C34A 3PUZE 1I6BA 2FVZA 2QVUA 4EQBA 4O3CA 3QUJA 5HM4B 1SI0A 4DCYA 1FQAA 4U21A 5JTYA 3OOAA 2ABHA 2M8CA 2P0SA 1VR5A 1MXYA 3HHGA 3U94A 2HEUA 4C1UA 2ZXTA 2VT5A 2G93A 4JWYA 4GX4A 3MZ1A 3A09A 2O7IA 3C9HA 4JSOA 2NVUB 4X1DA 2DYXA 4ZE8A 4QRZA 5ET6A 4LP2B 5F24A 3E13X 2VOZA 4QFPA 4PGNA 4KD5A 5ET8A 3PD9A 2F35A 3D4GA 4IO6A 5I2NB 4XTCQ 3N6UA 1P1QA 4NF6A 5L9MA 1WVJA 1MQIA 3LUZA 4POXA 4Q0CA 3LBSA 2YJPA 5FHNA 2B3FA 4N6PA 1KA0A 4XEQA 1NUYA 4PAKA 4NGUA 1SYIA 4FAJA 2F78A 1ZBMA 5FTHA 3RNNA 3ECRA 4R2FA 4NTLA 3FJMA 4NHBA 4OZ9A 4P11A 3R7XA 2XXQA 4R73A 4GWOA 5DEXA 5IM2A 3U1OA 2XD3A 3MC2A 3M8UA 4GWYA 3T9XB 3QUFA 4YB7A 3K00A 1FRPA 2YLNA 5FHMA 4QSDA 1FPEA 4H46A 5HBCA 3LR1A 3G3JA 4OESA 4I62A 3PU5A 3K4UA 1FJ9A 1KZ8A 2QPQA 3SEWA 3UA8A 3Q28A 3SEVA 4P1EA 5ESYA 2XX8A 1O63A 1B7UA 4F3SA 3BBRA 3G3KA 1LEVA 4XKQA 3DLNA 5AE4A 1Y1ZA 3U72A 3MP1A 3CG1A 1MRPA 3K1PA 1PB8A 4OEVA 3U93A 2HCAA 1LGBC 3S9NC 1CNQA 4GX3A 1B3GA 3KEIA 4WEPA 1MXVA 1QJMA 3K0VA 4KYDA 3K1MA 2G29A 5CBSA 1RDXA 2HZLA 4IB2A 1H44A 1MXXA 4MLQA 1OVTA 3UGWA 1PEBA 3CFZA 4TQUQ 1Y3PA 2R8TA 1B58A 1ATGA 4U23A 3TTLA 4XIGQ 4H8JA 4POWA 1CB6A 3M3LA 4R74A 2O68A 2F6GA 4G68C 4OETA 2VHAA 1MPDA 4ZEFA 2O69A 4BDQA 3OELA 4AB6A 2D3IA 3PMVA 3VE1B 1SW1A 4NQ8A 5ET5A 1VFEA 1AWBA 1M5CA 3WAEA 3IJOB 3TELA 4PDDA 4ZZEA 5DVFA 2DDKA 3VVFA 1PBPA 3OEMA 3TZAA 4G8NA 4ESWA 2DWIA 4PETA 1IMCA 1MPBA 1OVBA 3VDFA 2YPNA 5I84A 1SI1A 2XX9A 4KQPA 5AA2B 3SERA 4RXLA 5IZ1A 3GBAA 3IO4A 1JW5A 3KBZA 3IOTA 1LFHA 2OPDA 1VSOA 4I3YA 3TYHA 3VV5A 3A3CA 1SBPA 1ELJA 1PBQA 5I3SA 3IB0A 4ELOA 3PPQA 4OMBA 3ZKLA 1A7LA 5IGAA 4IO5A 1SD3A 3ZSFA 2XWIA 3C32A 1QGXA 3EKIA 1QVSA 2F6PA 1FQBA 2XXXA 1FBFA 5EHSA 1FBHA 5ISUA 3E79A 4MAGA 2RCAA 5I7IA 5LDZA 2O1MA 2OLBA 2PVUA 2ZYMA 4XKNA 4K3FA 2CEYA 3FXBA 4C0RA 4F29A 3G3IA 4YKIA 3MBPA 1YCJA 1FPJA 2Y7WA 3H03A 3B50A 4PGPA 2QS1A 1LBCA 1FJ6A 4ELRA 3H3GA 1TFDA 4XF5A 3C36A 4NE4A 4Z7EA 1D9QA 3BKIB 1EYKA 1A8EA 1LLSA 2WX9A 1US5A 3CFXA 3K2DA 2AL5A 4KYSA 1USYE 1LAGE 2F7CA 2Z8DA 3OO7A 1FW0A 4GWZA 4R6YA 5CM6A 4ESXA 1VDWA 4P47A 4F18A 3QYTA 1AH5A 3ISPA 1LAFE 1JW4A 1RYOA 3B8BA 4G8HA 1URSA 1FTKA 1NUXA 2HPGA 4N6KA 3ILUB 5EQ9A 3FVGA 1JP4A 1O64A 2I3WA 4GWUA 3JYRA 2OK2A 4NF5A 2NWJA 3FGSA 1N04A 5H8QB 2AYSA 4MBPA 4U1OA 2QJEA 4YICA 3P7IA 3H4ZA 2ZMBA 4FBPA 2ZNUA 5LOMA 3QXMA 4GXAA 2XXKA 1T0KA 2Q8MA 4OQOA 4U4SA 4YZZA 3FUZA 2P3VA 4RYAA 5H8NA 4JVDA 2OCUA 4GXSB 3MSTA 3LSXA 5J16A 4GWXA 5M2VA 1MPCA 1AL3A 3E3KA 2DXRA 1JETA 4Q30B 3O6IA 1B2HA 4H0WA 2WKYA 3TUSA 4DIGA 4KXPA 2WEFA 3OO8A 1MM7A 4PFBA 2KR0A 3PPPA 1J1NA 5F1QA 3HN0A 4F39A 1EU8A 2F34A 1ZTYA 3RTFB 1H43A 2R6GE 4PF6A 2UYEA 5DVJA 1LFIA 2Q89A 1B4HA 2NUVA 1NV1A 2PFZA 4KFQA 1URGA 2ONRA 1EZ9A 3IR1A
chains in the Genus database with same CATH topology
5ESYA 2WBBA 5EQ9A 1INPA 1JP4A 2KQZA 3HFUA 3D1RA 4LN5A 1NI9A 2VT5A 4MNCA 1FSAA 1NUZA 4I3YA 3SZPA 1LEVA 1YYZA 2XWOA 1FPGA 2Q74A 4GWUA 2HXRA 4I3EA 1DK4A 4GX4A 4MMPA 2QFLA 3A29A 4GWWA 1NV4A 4GBWA 3RPLB 3U65A 2WYPA 1YXIA 1LBVA 1EYJA 3KC1A 2DVZA 4O7MA 1RDYA 5I3SA 1NUWA 4UABA 5ET6A 5F24A 4MJOA 5EYGA 1NV2A 4O8MA 4HXVA 4YICA 5ET7A 2P3NA 4PGNA 2DE3A 2V4CA 1LBWA 2FBPA 4G61A 5IGAA 1CNQA 1SPIA 1IMBA 4GX3A 4FBPA 5ET8A 1IMEA 1IMFA 2XWIA 1QGXA 5EQ7A 3EKIA 2ZZWA 4OANA 4H45A 2XXKA 1FBPA 3RYDA 4XFEA 1FBFA 5IZ3A 4AS4A 4X9TA 2Q8MA 4GWSA 4N6DA 2VPNA 1RDXA 1FBHA 2HZLA 3E79A 4MNPA 4MX6A 4OVSA 4P3LA 4OVPA 4JVCA 4YZZA 4F1VA 1FBGA 4HCYA 1NV3A 4MAGA 4NX1A 5IZ3B 5I7IA 1IMDA 2Y5LA 3BIHA 5LDZA 4PC9A 5IZZA 1LBZA 2P3VA 4JVDA 2OWZA 1KA1A 1FBCA 4P9KA 2F3BA 3LUZA 3MSTA 4QBAA 1FPKA 5J16A 2CEYA 2BJIA 5FBPA 4NN3A 4F19A 2WYKA 4GWXA 5LTCA 4PDHA 4IR8A 5EYHA 2R8TA 3FXBA 4PE3A 1DBZA 2FIXA 1KA0A 1XI6A 4PBQA 4XEQA 1NV0A 4HE2A 1NUYA 3T0JA 1FBEA 2B4MA 4N17A 1FPJA 4PAKA 4NGUA 1FPBA 4N4UA 4PAFA 4DI3D 3RPLA 2B4LA 2ZZVA 4NAPA 2QVVA 1NV5A 2HHMA 2CZHA 1IMAA 2DE2A 4P56A 3B50A 2QVRA 3KC0A 4PGPA 2MKZA 3T1BA 4HE0A 5EQ8A 1FJ6A 2CZKA 4PTKA 4NHBA 1RDZA 3BIGA 4AS5A 4OVQA 4X04A 4XF5A 4KXPA 4PAIA 2WEFA 4PFBA 2PFYA 2KR0A 4GBVA 2Y5KA 3GYYA 1K9ZA 2XA5A 2VPOA 2F3DA 2V3QA 1D9QA 1FPIA 1LBYA 4I40A 1FBDA 3PTYA 4MEVA 1EYKA 1DCUA 2WX9A 3NOHA 4MHFA 4N8YA 4PBHA 5IM2A 4O94A 4PFIA 2OX3A 4NQ8A 3IFAA 3IFCA 3CHGA 5EQAA 2ZZXA 5ET5A 4JVIA 1BK4A 4GWYA 2PCRA 1Q9DA 4MCOA 4N91A 1AWBA 1YZ0A 3LV0A 2F5XA 4HE1A 4NG7A 1G0IA 4GWZA 1FRPA 4OVRA 4HCWA 4PDDA 1FTAA 4PCDA 5A5LA 2CEXA 4PF6A 5CM6A 5JK4A 2DDKA 2FHYA 4GX6A 4OVTA 2WBDA 5J1DA 1LBXA 1FPEA 2FIEA 4H46A 2FVZA 2GQ1A 1NV6A 1EYIA 2QVUA 1K9YA 2HZKA 2XWKA 4P1LA 4X8RA 1VDWA 4P47A 4F18A 2DE4A 4MIJA 4OA4A 4PETA 1IMCA 1NV1A 4PF8A 1FPFA 3ISPA 4MNIA 3MYUA 5T3JA 1FJ9A 3FBPA 1KZ8A 4QXDA 3W9VA 2PFZA 2QPQA 1FPDA 1FPLA 4N8GA 4P8BA 4O7IA 2L5VA 3B8BA 4M1VA 3E78A 5IZ1A 1G0HA 3ROJA 5DW8A 2XWVA 4NF0A 4PFRA 5I5PA 1NUXA 2HPGA 4N6KA 4F1UA 2Q9TA 3QMFA 4N81A 2CZIA 3KBZA 4N15A 4DI4B 3W9WA 4P1EA 2JJKA 1NV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ESY A;  2WBB A;  5EQ9 A;  1INP A;  1JP4 A;  3D1R A;  1NI9 A;  2VT5 A;  1FSA A;  1NUZ A;  4I3Y A;  1LEV A;  1YYZ A;  1FPG A;  2Q74 A;  4GWU A;  4I3E A;  1DK4 A;  4GX4 A;  2QFL A;  3A29 A;  4GWW A;  1NV4 A;  4GBW A;  3RPL B;  1YXI A;  1LBV A;  1EYJ A;  3KC1 A;  1RDY A;  5I3S A;  1NUW A;  5ET6 A;  5F24 A;  4MJO A;  5EYG A;  1NV2 A;  4HXV A;  5ET7 A;  2P3N A;  1LBW A;  2FBP A;  4G61 A;  1CNQ A;  1SPI A;  1IMB A;  4GX3 A;  4FBP A;  5ET8 A;  1IME A;  1IMF A;  1QGX A;  5EQ7 A;  4H45 A;  1FBP A;  3RYD A;  1FBF A;  5IZ3 A;  4AS4 A;  2Q8M A;  4GWS A;  1RDX A;  1FBH A;  1FBG A;  1NV3 A;  5IZ3 B;  1IMD A;  2Y5L A;  3BIH A;  5LDZ A;  1LBZ A;  2P3V A;  2OWZ A;  1KA1 A;  1FBC A;  2F3B A;  3LUZ A;  1FPK A;  5J16 A;  2BJI A;  5FBP A;  4GWX A;  4IR8 A;  5EYH A;  2R8T A;  1DBZ A;  2FIX A;  1KA0 A;  1XI6 A;  1NV0 A;  4HE2 A;  1NUY A;  3T0J A;  1FBE A;  1FPJ A;  1FPB A;  3RPL A;  2QVV A;  1NV5 A;  2HHM A;  2CZH A;  1IMA A;  2QVR A;  3KC0 A;  4HE0 A;  5EQ8 A;  1FJ6 A;  2CZK A;  4PTK A;  1RDZ A;  3BIG A;  4AS5 A;  4KXP A;  2WEF A;  4GBV A;  2Y5K A;  1K9Z A;  2F3D A;  1D9Q A;  1FPI A;  1LBY A;  4I40 A;  1FBD A;  1EYK A;  1DCU A;  2OX3 A;  3IFA A;  3IFC A;  5EQA A;  5ET5 A;  1BK4 A;  4GWY A;  2PCR A;  1Q9D A;  1AWB A;  1YZ0 A;  3LV0 A;  4HE1 A;  1G0I A;  4GWZ A;  1FRP A;  1FTA A;  5A5L A;  2DDK A;  2FHY A;  4GX6 A;  2WBD A;  1LBX A;  1FPE A;  2FIE A;  4H46 A;  2FVZ A;  2GQ1 A;  1NV6 A;  1EYI A;  2QVU A;  1K9Y A;  1VDW A;  1IMC A;  1NV1 A;  1FPF A;  5T3J A;  1FJ9 A;  3FBP A;  1KZ8 A;  4QXD A;  1FPD A;  1FPL A;  4O7I A;  3B8B A;  5IZ1 A;  1G0H A;  3ROJ A;  5DW8 A;  1NUX A;  3QMF A;  4N81 A;  2CZI A;  3KBZ A;  2JJK A;  1NV7 A; 
#chains in the Genus database with same CATH topology
 4RNS A;  3RN8 A;  2UVI A;  2XWO A;  3CG3 A;  4UAC A;  2GRV A;  3CR9 A;  4PFY A;  4GVO A;  4F2Q A;  3U65 A;  4OTE A;  1N84 A;  3IB2 A;  3IOW A;  1SW5 A;  4N07 A;  2QMW A;  4AQ4 A;  4FEB A;  1B5H A;  5ET7 A;  2FBP A;  3F11 A;  3KN3 A;  1BKA A;  1FBP A;  1B6H A;  4X1B A;  4AS4 A;  4NF6 B;  4GWS A;  4WED A;  2E1S A;  3BIH A;  3SET A;  1LBZ A;  2X26 A;  4G68 B;  1B40 A;  5H8N B;  1KA1 A;  4ELP A;  1FBC A;  2BJI A;  3IOV A;  2Z22 A;  1QUJ A;  1DBZ A;  4UA8 A;  1A99 A;  3VLU A;  4KR5 A;  1IIW A;  2QVV A;  1UTH A;  2DE2 A;  2H98 A;  2Y7R A;  1IUD A;  1WOD A;  4IGT A;  5H8Q A;  4DDD A;  3GYY A;  3TCG A;  4MEV A;  3PTY A;  1B1X A;  3EQ1 A;  3BFU A;  3KBR A;  4HW8 A;  3IFA A;  1S7Y A;  3B6W A;  3T9V A;  5A5L A;  2P1S A;  1QKA A;  4GRK A;  1MH4 A;  3MQ9 A;  3PUW E;  4P0I A;  2F8D A;  5T3J A;  3H7M A;  3W9V A;  2XXH A;  4M1V A;  1G0H A;  1B51 A;  2IEE A;  3H6W A;  2UVG A;  4I9D A;  5A5X B;  4IY5 A;  4ZED A;  2Y7K A;  3CIJ A;  1FPG A;  3LSF B;  1XOC A;  3A29 A;  1NV4 A;  4OHN A;  2OJT A;  5L9S A;  1MXU A;  4GQO A;  5B70 A;  2AL4 A;  4QHQ A;  4R2B A;  5H8H B;  4Q8R A;  4JXI A;  1S50 A;  2RKM A;  4U2R A;  4N6D A;  4MNP A;  4MX6 A;  3UP9 A;  4IGR A;  1LAH E;  4HCY A;  2REG A;  2B65 A;  4ECF A;  2UYF A;  1I69 A;  3KOT A;  2PYY A;  3HPI A;  4RY1 A;  4KCC A;  1BTJ A;  3MW0 A;  5H8H A;  2XXR A;  3K01 A;  4PAF A;  1FBE A;  1XVY A;  2A5S A;  3SKP A;  2CZH A;  4E0W A;  1IXH A;  5I59 B;  1DMB A;  3OD7 A;  1Y3Q A;  3U92 A;  4FOR A;  4PAI A;  3I6V A;  4GBV A;  3FZV A;  3FJ7 A;  3EHS A;  1A54 A;  3R6U A;  1MQH A;  3VXC A;  5ITP A;  3O9P A;  2ZZX A;  1R6Z A;  2Q8J A;  4N91 A;  4G77 A;  4GF8 A;  4YU0 A;  3MJN A;  1EYI A;  4EXL A;  5AA2 A;  4WXJ A;  4OFJ A;  3GBB A;  1AIV A;  3KJ7 A;  2ZYO A;  1Q35 A;  5F7V A;  5TP9 B;  4NMY A;  5ITO A;  5ICQ A;  2DVZ A;  4XKR A;  5K2X A;  3PUV E;  4YKP A;  3ONM A;  3O6H A;  1B52 A;  5H8S A;  1JQF A;  1MXZ A;  3IO6 A;  1QUK A;  2ALU A;  5IAI A;  1DOT A;  2O51 A;  4H1X A;  4OVS A;  5CMK A;  1A55 A;  3PGF A;  4P9K A;  3R26 A;  4QSC A;  3HV1 A;  3E9X A;  4PBQ A;  4BDN A;  4HE2 A;  1FQE A;  3DP4 A;  1BLF A;  2F7A A;  1NFT A;  2Z8E A;  2D5W A;  2BJJ X;  3CRB A;  3T66 A;  1FTL A;  4BDM A;  4RPO A;  3ILT B;  1B3F A;  2F3D A;  4JWO A;  4YB5 A;  1NL5 A;  2B3B A;  2ZNT A;  1D9V A;  2VP1 A;  1RKM A;  3TQW A;  2DVC A;  3FVK A;  3HHF A;  1YTV A;  4GOT A;  2DSF A;  3G7W A;  3TTN A;  3SEU A;  2FHY A;  4IO2 A;  4OVT A;  3RUM A;  1LBX A;  3KSJ A;  3S4U A;  2XXY A;  3S2V A;  5AA2 D;  1PB7 A;  1MG1 A;  4EQ9 A;  2OZZ A;  2CMO A;  3KG2 A;  3E78 A;  3B6Q A;  5I5P A;  2I4B A;  3FD3 A;  2HFB A;  4N81 A;  2CZI A;  3EN3 A;  1DPE A;  4R9G A;  2WBB A;  3C35 A;  4F22 A;  1B5J A;  4MNC A;  3RGY A;  4IO7 A;  1ANF A;  1I6A A;  4F3P A;  3I3V A;  5A5X A;  4GBW A;  3Q29 A;  2QS4 A;  4O7M A;  3DM0 A;  3FV2 A;  2XXT A;  1N76 A;  1JVY A;  4G61 A;  1IMB A;  4FE8 A;  3TTR A;  3TPA A;  4H65 A;  5AA4 B;  3RYD A;  1MH3 A;  3HCQ A;  3A3U A;  1HSE A;  2I4C A;  3JZJ A;  1FBG A;  4NX1 A;  1IMD A;  3RLF E;  5IZZ A;  1POY 1;  1LAX A;  1FTO A;  3T9H B;  1USY H;  5FBP A;  4LZ5 A;  5EYH A;  2I3V A;  4ZE9 A;  2UVJ A;  4M4G A;  2P2A A;  3JV9 A;  5CI5 A;  4XXU A;  2QVR A;  3T1B A;  3LUY A;  1BP5 A;  4HE0 A;  2DQV A;  5CBR A;  1TFA A;  5I58 B;  2QS2 A;  5L9O A;  2R71 A;  4F2O A;  1K9Z A;  3PD8 A;  4OEN A;  1FBD A;  1QUL A;  4NF5 B;  3EF7 A;  3TEP A;  4DCX A;  4HTG A;  2OWT A;  2Y7I A;  1IIT A;  5EQA A;  1LB9 A;  4LZ7 A;  2VGQ A;  2PCR A;  2XHD A;  1YZ0 A;  1TWY A;  2F5X A;  1LB8 A;  4OYV A;  1FTA A;  4G8M A;  4GX6 A;  2FIE A;  2R9J A;  4FIM A;  1P1W A;  4WKM A;  4X8R A;  3L6H A;  1M5E A;  2ZYK A;  4MNI A;  4OWD A;  1FPL A;  2QS3 A;  4O7I A;  3RPW A;  2DP8 A;  3B7D A;  4F1U A;  4DI4 B;  1SDX A;  2Q2A A;  1GR2 A;  2GHB A;  1NMU A;  1MY0 A;  3SZP A;  4LQ5 A;  4BDL A;  2I58 A;  1Z7M E;  3PPN A;  4QFN A;  2I0B A;  4F1Y A;  4FJP A;  3SES A;  4BLA A;  4BDO A;  4IO4 A;  3RQT A;  3FAT A;  2VPN A;  3OEN A;  1RYX A;  3Q27 A;  2D21 A;  2PT2 A;  1AMF A;  3IL1 B;  2F3B A;  1YAE A;  1FPK A;  1N7W A;  5TPA B;  5KZT A;  3USD A;  2VD3 A;  4PP0 A;  3N6T A;  4JDF A;  1XI6 A;  3T0J A;  1NH8 A;  4QFO A;  1FPB A;  5HPQ A;  3U8Q A;  1SW2 A;  1NV5 A;  1B3E A;  2HHM A;  2F36 A;  3K6X A;  3TCF A;  3KC0 A;  5EQ8 A;  4N13 A;  4AS5 A;  3BIG A;  1FTJ A;  3O66 A;  1D3K A;  2X7P A;  2Y5K A;  3K02 A;  4U1Z A;  1P1O A;  3VFJ A;  5B7D A;  1OQG A;  1NKX A;  4LA9 A;  3E4R A;  4P1L A;  2CZL A;  1MY3 A;  3MPL A;  4YMA A;  4PF8 A;  4ZEK A;  3DEL B;  1FPD A;  2Z8F A;  2XWV A;  4NF0 A;  2OWS A;  1B7H A;  3KFM A;  1EZO A;  1XHY A;  3K1N A;  3W9W A;  2JJK A;  1LBV A;  1B3H A;  1M5D A;  1INP A;  1FQC A;  5I2K A;  4QF9 A;  2V93 A;  5CMM A;  4DXC A;  5DT6 A;  1F9B A;  2RC9 A;  1LCF A;  1CE2 A;  1EYJ A;  5K2Y A;  1MY4 A;  5L8D A;  3QK6 A;  4U4X A;  3DP8 A;  1XT8 A;  3FXQ A;  4LVQ A;  4O8M A;  1SW4 A;  1Y1M A;  3IAZ A;  5BWJ A;  2H25 A;  5TP9 A;  5ICT A;  4R9F A;  3K6W A;  4OAN A;  2RC8 A;  1EH3 A;  3N5L A;  4XFE A;  4X9T A;  4NED A;  3SDF A;  4H8I A;  4P3L A;  3O29 A;  4JBZ A;  4I1D A;  1WDN A;  4P0G A;  3RT6 B;  4R75 A;  3CI8 A;  3OSQ A;  1NNT A;  1MQD A;  2AIX A;  3MP6 A;  4PE3 A;  1MQG A;  4ELQ A;  4N17 A;  1JEV A;  1FQD A;  1JVX A;  5KCJ B;  1B1H A;  1B9J A;  4TLM B;  1IMA A;  2QSX A;  2Y7P A;  3FVO A;  3KZG A;  4X04 A;  4R72 A;  4ZDM A;  2I0C A;  3KOS A;  3V83 A;  1KWH A;  3LSL A;  2DWH A;  5IKB A;  3MWB A;  3O2A A;  3GXA A;  1A8F A;  1Q9D A;  3MUQ A;  4QFK A;  5H8F B;  3IK6 B;  1G0I A;  4KPT A;  3S9E A;  1LST A;  3KN7 A;  1GVC A;  3OEK A;  5AA1 A;  5J1D A;  1I6Q A;  1A40 A;  4JB7 A;  5TPA A;  3MPK A;  3DP6 A;  2XXW A;  4IY6 A;  3FV1 A;  2THI A;  4RK2 A;  3FBP A;  4LQ2 A;  1JEU A;  4N8G A;  3K6V A;  1VFD A;  1P99 A;  1GTK A;  5FTI A;  3HFU A;  2QL3 A;  2F97 A;  3MAM A;  1YYZ A;  4YMB A;  1DK4 A;  3EHU A;  2QFL A;  1LCT A;  3EPE A;  2PMS A;  1NUW A;  3CSB A;  4MJO A;  1NV2 A;  5ELV A;  2P3N A;  4Z0I A;  3S9M C;  1IME A;  1Q1K A;  3MP8 A;  4TLL B;  1R1N A;  4OVP A;  3VXB A;  1NV3 A;  5KDT B;  4PC9 A;  1MY2 A;  4ZZA A;  5TU0 A;  2OWZ A;  4H67 A;  1ZMG A;  4MFI A;  4QBA A;  1DPP A;  4DLD A;  4F19 A;  1D9Y A;  2WYK A;  4IR8 A;  1FCK A;  3O97 A;  1NV0 A;  3PUX E;  3M3F A;  3TMG A;  2B4L A;  3OO9 A;  1AOV A;  3TTM A;  2ONS A;  4OVQ A;  1ZJL A;  2HAV A;  2OBG A;  4G2Z A;  2PFY A;  4KHZ E;  3TKD A;  4H5F A;  2DS9 A;  1FQF A;  2ZYN A;  1UTB A;  4MLV A;  4NWD A;  5JTY B;  4PQJ A;  4RA1 A;  3LV0 A;  5I57 A;  1B32 A;  2CEX A;  2ZNS A;  2WBD A;  4NF4 A;  4JSD A;  3KSX A;  4MIJ A;  2XXU A;  3TOD A;  4ZEI A;  3M3K A;  2I48 A;  1LFG A;  1IXC A;  4OXV A;  2PT1 A;  4N15 A;  3VLW A;  3PPO A;  1H3D A;  5I56 B;  4EQ7 A;  4OEU A;  4LAT A;  4DXU A;  1JW1 A;  1UIU A;  2RC7 A;  2WYP A;  2I49 A;  3H6V A;  5I59 A;  4HXV A;  1LBW A;  1YPN A;  4NWC A;  3UOR A;  5EQ7 A;  5IZ3 A;  2V3T A;  3MZB A;  3G3G A;  4HS7 A;  3T93 B;  1B05 A;  4FEC A;  5DYH A;  5BUU A;  4NN3 A;  2ONK E;  1M5F A;  2X7Q A;  1UTB B;  3MVX A;  5LTC A;  2I6E A;  4F31 B;  2FA7 A;  2FYI A;  2QMX A;  3VLV A;  2FIX A;  4PBH A;  5JEI A;  1H76 A;  4N4U A;  3BFT A;  1PB9 A;  4NAP A;  1DSN A;  2CZK A;  4G4P A;  5I2K B;  1LBY A;  4L17 A;  3FIR A;  1M5B A;  1DCU A;  3NOH A;  1GGG A;  1OLA A;  1Y4T A;  2W7Y A;  1XS5 A;  3OO6 A;  1BK4 A;  4LZ8 A;  4MCO A;  1Z7N E;  2Q88 A;  3T96 B;  4PE5 B;  4EXK A;  4C1T A;  2GQ1 A;  3W15 C;  1NV6 A;  1OLC A;  3Q25 A;  4ND9 A;  1BIY A;  1DTZ A;  1FPF A;  1B5I A;  4ISU A;  3MYU A;  2A5T B;  4EF1 A;  2XXI A;  2L5V A;  4MH5 A;  4PFR A;  3QMF A;  1GV8 A;  4OER A;  3CVG A;  3OXN A;  3ZKK A;  4LN5 A;  1R9L A;  2Q74 A;  2HXR A;  2O6A A;  1PDA A;  1NH7 A;  3H06 B;  2H4I A;  5FHO A;  4GWW A;  2ESN A;  3RPL B;  2KLF A;  1SYH A;  2DWA A;  1N7X A;  4O3A A;  3G3F A;  3OSR A;  3TFL A;  3N26 A;  1B46 A;  1ZIU A;  4NF8 B;  4KYE A;  3T22 A;  2DXY A;  1NNP A;  3PUY E;  3UK4 A;  5CMB A;  3N94 A;  2REJ A;  1ZKB A;  4F1V A;  3FJG A;  1B7Z A;  1IQ7 A;  2O7U A;  1SVX B;  2DWJ A;  4KCD A;  3QSL A;  4FED A;  1N0T A;  4Q5T A;  3SEY A;  3UIF A;  3FVN A;  3O28 A;  3G3H A;  4DI3 D;  1N3W A;  2PBW A;  3S9L C;  3EHT A;  1P1U A;  4P56 A;  2MKZ A;  4PTK A;  4E0X A;  1Y3N A;  4RJZ A;  3OMB A;  3ZS6 A;  4O94 A;  4PFI A;  3IFC A;  3H6T A;  4R6K A;  2HXW A;  4NG7 A;  1IXI A;  3V89 B;  3QAX A;  4FAT A;  1US4 A;  4O3B A;  4EUO A;  1Y20 A;  4F3B A;  1K9Y A;  2DE4 A;  1QW0 A;  2IA4 A;  4ZEC A;  4YKJ A;  2RF1 A;  5DW8 A;  5DEX B;  2H5Y A;  2XD2 A;  3C4M A;  4GL8 A;  2RIN A;  1D4N A;  2KQZ A;  4NF8 A;  4H6D A;  1UIV A;  4XKP A;  3AXF A;  4QSE A;  1IXG A;  4TOZ A;  3GLB A;  3MVY A;  4JWX A;  2GH9 A;  3MVZ A;  1YXI A;  2Q2C A;  3RTW B;  1ZU0 A;  2DE3 A;  3MZ9 A;  4LUB A;  1SPI A;  1Y9U A;  1IMF A;  1LBB A;  1NNK A;  2XXV A;  4GD5 A;  1EZP A;  1R9Q A;  3KJT A;  4I8C A;  2HAU A;  1SQY A;  4IO3 A;  4LON B;  2Y5L A;  5I2N A;  5EYF A;  3QIM A;  5AA4 A;  2O84 X;  3C33 A;  3WAF A;  3IX1 A;  4KI0 E;  3THI A;  2UXA A;  1MXW A;  2O1L A;  1NNF A;  1IEJ A;  4GLI A;  3IOU A;  3T9U A;  3TQL A;  2DOJ A;  1P1N A;  2VPO A;  1FPI A;  2VD2 A;  1FTM A;  1QUI A;  1B3L A;  4MHF A;  4DZ1 A;  4PFW A;  3CHG A;  4THI A;  4JVI A;  1H45 A;  4OVR A;  1L5T A;  3CSG A;  1XVX A;  2HZK A;  2GFE A;  3ODB A;  4YB6 A;  2XWK A;  3PV0 E;  2FNC A;  3C31 A;  2HQ0 A;  5CMC A;  1B0L A;  4G68 A;  4ZEB A;  2RCB A;  4P8B A;  5CC2 A;  1OQH A;  3GZG A;  3B6T A;  1TT1 A;  2Q9T A;  3O6G A;  1B4Z A;  2UVH A;  4AB5 A;  5H8F A;  1PC3 A;  4ZS9 A;  1NI9 A;  1FSA A;  1NUZ A;  1POT A;  3IJX B;  4I3E A;  2ANJ A;  3HO7 A;  4MMP A;  1S9T A;  3Q26 A;  4H5G A;  5KCJ A;  3CFL A;  3KC1 A;  4BDR A;  4UAB A;  4EDP A;  1MM6 A;  4YAH X;  4U22 A;  5EYG A;  2QRY A;  3V5A A;  2V4C A;  3TAJ A;  4H45 A;  1IZ1 A;  2NXO A;  2Y84 A;  3VVE A;  4OFL A;  4NF4 B;  3RT8 A;  5I57 B;  3KN8 A;  1MDQ A;  2NOO A;  3L6G A;  1ZLQ A;  4PDH A;  3PMW A;  3FXU A;  3UN6 A;  3RY3 A;  3RPL A;  5I58 A;  2H99 A;  5CRY A;  3I5O A;  1UTH B;  3VVD A;  3MVW A;  1RDZ A;  1XC1 A;  2XA5 A;  2V3Q A;  3D4C A;  4N8Y A;  4DXB A;  2OX3 A;  3FAS A;  3TCH A;  4PFU A;  3TDJ A;  2XXP A;  2A5T A;  2Z23 A;  4HCW A;  3HST A;  5KDT A;  3IOR A;  3H6U A;  3K6U A;  2H9B A;  1TXF A;  4OA4 A;  4YKK A;  1OIB A;  5EHM A;  4QXD A;  4GL0 A;  4MF3 A;  3ROJ A;  2E0S A;  3IB1 A;  2XX7 A;  1NV7 A;  4OVJ A;  3D1R A;  4EF2 A;  3TTK A;  4X48 A;  2V25 A;  1MS7 A;  2LAO A;  1MDP 1;  1RDY A;  2V3U A;  4GIZ A;  4RPN A;  1N3X A;  1Y4C A;  2ZZW A;  1MY1 A;  1DTG A;  4PFT A;  4OFO A;  1JNF A;  3PPR A;  4JVC A;  3KGC A;  5IZ3 B;  2V84 A;  1MQJ A;  4QFL A;  1QKB A;  1URD A;  3LSW A;  3SEX A;  1OMP A;  4GFR A;  3PMX A;  2B4M A;  3LC8 A;  4DE8 A;  2ZZV A;  1HSJ A;  3V8X B;  5DVI A;  5I56 A;  1VE4 A;  2OPE A;  2F7B A;  1O7T A;  4I40 A;  3FXR A;  1UQW A;  5DTB A;  2PX1 A;  5AA3 A;  1HSL A;  2GHA A;  4F3G A;  4ONY A;  1B0H A;  4HE1 A;  1II5 A;  4R6H A;  5JK4 A;  4PCD A;  4RK9 A;  3C34 A;  3PUZ E;  1I6B A;  2FVZ A;  2QVU A;  4EQB A;  4O3C A;  3QUJ A;  5HM4 B;  1SI0 A;  4DCY A;  1FQA A;  4U21 A;  5JTY A;  3OOA A;  2ABH A;  2M8C A;  2P0S A;  1VR5 A;  1MXY A;  3HHG A;  3U94 A;  2HEU A;  4C1U A;  2ZXT A;  2VT5 A;  2G93 A;  4JWY A;  4GX4 A;  3MZ1 A;  3A09 A;  2O7I A;  3C9H A;  4JSO A;  2NVU B;  4X1D A;  2DYX A;  4ZE8 A;  4QRZ A;  5ET6 A;  4LP2 B;  5F24 A;  3E13 X;  2VOZ A;  4QFP A;  4PGN A;  4KD5 A;  5ET8 A;  3PD9 A;  2F35 A;  3D4G A;  4IO6 A;  5I2N B;  4XTC Q;  3N6U A;  1P1Q A;  4NF6 A;  5L9M A;  1WVJ A;  1MQI A;  3LUZ A;  4POX A;  4Q0C A;  3LBS A;  2YJP A;  5FHN A;  2B3F A;  4N6P A;  1KA0 A;  4XEQ A;  1NUY A;  4PAK A;  4NGU A;  1SYI A;  4FAJ A;  2F78 A;  1ZBM A;  5FTH A;  3RNN A;  3ECR A;  4R2F A;  4NTL A;  3FJM A;  4NHB A;  4OZ9 A;  4P11 A;  3R7X A;  2XXQ A;  4R73 A;  4GWO A;  5DEX A;  5IM2 A;  3U1O A;  2XD3 A;  3MC2 A;  3M8U A;  4GWY A;  3T9X B;  3QUF A;  4YB7 A;  3K00 A;  1FRP A;  2YLN A;  5FHM A;  4QSD A;  1FPE A;  4H46 A;  5HBC A;  3LR1 A;  3G3J A;  4OES A;  4I62 A;  3PU5 A;  3K4U A;  1FJ9 A;  1KZ8 A;  2QPQ A;  3SEW A;  3UA8 A;  3Q28 A;  3SEV A;  4P1E A;  5ESY A;  2XX8 A;  1O63 A;  1B7U A;  4F3S A;  3BBR A;  3G3K A;  1LEV A;  4XKQ A;  3DLN A;  5AE4 A;  1Y1Z A;  3U72 A;  3MP1 A;  3CG1 A;  1MRP A;  3K1P A;  1PB8 A;  4OEV A;  3U93 A;  2HCA A;  1LGB C;  3S9N C;  1CNQ A;  4GX3 A;  1B3G A;  3KEI A;  4WEP A;  1MXV A;  1QJM A;  3K0V A;  4KYD A;  3K1M A;  2G29 A;  5CBS A;  1RDX A;  2HZL A;  4IB2 A;  1H44 A;  1MXX A;  4MLQ A;  1OVT A;  3UGW A;  1PEB A;  3CFZ A;  4TQU Q;  1Y3P A;  2R8T A;  1B58 A;  1ATG A;  4U23 A;  3TTL A;  4XIG Q;  4H8J A;  4POW A;  1CB6 A;  3M3L A;  4R74 A;  2O68 A;  2F6G A;  4G68 C;  4OET A;  2VHA A;  1MPD A;  4ZEF A;  2O69 A;  4BDQ A;  3OEL A;  4AB6 A;  2D3I A;  3PMV A;  3VE1 B;  1SW1 A;  4NQ8 A;  5ET5 A;  1VFE A;  1AWB A;  1M5C A;  3WAE A;  3IJO B;  3TEL A;  4PDD A;  4ZZE A;  5DVF A;  2DDK A;  3VVF A;  1PBP A;  3OEM A;  3TZA A;  4G8N A;  4ESW A;  2DWI A;  4PET A;  1IMC A;  1MPB A;  1OVB A;  3VDF A;  2YPN A;  5I84 A;  1SI1 A;  2XX9 A;  4KQP A;  5AA2 B;  3SER A;  4RXL A;  5IZ1 A;  3GBA A;  3IO4 A;  1JW5 A;  3KBZ A;  3IOT A;  1LFH A;  2OPD A;  1VSO A;  4I3Y A;  3TYH A;  3VV5 A;  3A3C A;  1SBP A;  1ELJ A;  1PBQ A;  5I3S A;  3IB0 A;  4ELO A;  3PPQ A;  4OMB A;  3ZKL A;  1A7L A;  5IGA A;  4IO5 A;  1SD3 A;  3ZSF A;  2XWI A;  3C32 A;  1QGX A;  3EKI A;  1QVS A;  2F6P A;  1FQB A;  2XXX A;  1FBF A;  5EHS A;  1FBH A;  5ISU A;  3E79 A;  4MAG A;  2RCA A;  5I7I A;  5LDZ A;  2O1M A;  2OLB A;  2PVU A;  2ZYM A;  4XKN A;  4K3F A;  2CEY A;  3FXB A;  4C0R A;  4F29 A;  3G3I A;  4YKI A;  3MBP A;  1YCJ A;  1FPJ A;  2Y7W A;  3H03 A;  3B50 A;  4PGP A;  2QS1 A;  1LBC A;  1FJ6 A;  4ELR A;  3H3G A;  1TFD A;  4XF5 A;  3C36 A;  4NE4 A;  4Z7E A;  1D9Q A;  3BKI B;  1EYK A;  1A8E A;  1LLS A;  2WX9 A;  1US5 A;  3CFX A;  3K2D A;  2AL5 A;  4KYS A;  1USY E;  1LAG E;  2F7C A;  2Z8D A;  3OO7 A;  1FW0 A;  4GWZ A;  4R6Y A;  5CM6 A;  4ESX A;  1VDW A;  4P47 A;  4F18 A;  3QYT A;  1AH5 A;  3ISP A;  1LAF E;  1JW4 A;  1RYO A;  3B8B A;  4G8H A;  1URS A;  1FTK A;  1NUX A;  2HPG A;  4N6K A;  3ILU B;  5EQ9 A;  3FVG A;  1JP4 A;  1O64 A;  2I3W A;  4GWU A;  3JYR A;  2OK2 A;  4NF5 A;  2NWJ A;  3FGS A;  1N04 A;  5H8Q B;  2AYS A;  4MBP A;  4U1O A;  2QJE A;  4YIC A;  3P7I A;  3H4Z A;  2ZMB A;  4FBP A;  2ZNU A;  5LOM A;  3QXM A;  4GXA A;  2XXK A;  1T0K A;  2Q8M A;  4OQO A;  4U4S A;  4YZZ A;  3FUZ A;  2P3V A;  4RYA A;  5H8N A;  4JVD A;  2OCU A;  4GXS B;  3MST A;  3LSX A;  5J16 A;  4GWX A;  5M2V A;  1MPC A;  1AL3 A;  3E3K A;  2DXR A;  1JET A;  4Q30 B;  3O6I A;  1B2H A;  4H0W A;  2WKY A;  3TUS A;  4DIG A;  4KXP A;  2WEF A;  3OO8 A;  1MM7 A;  4PFB A;  2KR0 A;  3PPP A;  1J1N A;  5F1Q A;  3HN0 A;  4F39 A;  1EU8 A;  2F34 A;  1ZTY A;  3RTF B;  1H43 A;  2R6G E;  4PF6 A;  2UYE A;  5DVJ A;  1LFI A;  2Q89 A;  1B4H A;  2NUV A;  1NV1 A;  2PFZ A;  4KFQ A;  1URG A;  2ONR A;  1EZ9 A;  3IR1 A; 
#chains in the Genus database with same CATH homology
 5ESY A;  2WBB A;  5EQ9 A;  1INP A;  1JP4 A;  2KQZ A;  3HFU A;  3D1R A;  4LN5 A;  1NI9 A;  2VT5 A;  4MNC A;  1FSA A;  1NUZ A;  4I3Y A;  3SZP A;  1LEV A;  1YYZ A;  2XWO A;  1FPG A;  2Q74 A;  4GWU A;  2HXR A;  4I3E A;  1DK4 A;  4GX4 A;  4MMP A;  2QFL A;  3A29 A;  4GWW A;  1NV4 A;  4GBW A;  3RPL B;  3U65 A;  2WYP A;  1YXI A;  1LBV A;  1EYJ A;  3KC1 A;  2DVZ A;  4O7M A;  1RDY A;  5I3S A;  1NUW A;  4UAB A;  5ET6 A;  5F24 A;  4MJO A;  5EYG A;  1NV2 A;  4O8M A;  4HXV A;  4YIC A;  5ET7 A;  2P3N A;  4PGN A;  2DE3 A;  2V4C A;  1LBW A;  2FBP A;  4G61 A;  5IGA A;  1CNQ A;  1SPI A;  1IMB A;  4GX3 A;  4FBP A;  5ET8 A;  1IME A;  1IMF A;  2XWI A;  1QGX A;  5EQ7 A;  3EKI A;  2ZZW A;  4OAN A;  4H45 A;  2XXK A;  1FBP A;  3RYD A;  4XFE A;  1FBF A;  5IZ3 A;  4AS4 A;  4X9T A;  2Q8M A;  4GWS A;  4N6D A;  2VPN A;  1RDX A;  1FBH A;  2HZL A;  3E79 A;  4MNP A;  4MX6 A;  4OVS A;  4P3L A;  4OVP A;  4JVC A;  4YZZ A;  4F1V A;  1FBG A;  4HCY A;  1NV3 A;  4MAG A;  4NX1 A;  5IZ3 B;  5I7I A;  1IMD A;  2Y5L A;  3BIH A;  5LDZ A;  4PC9 A;  5IZZ A;  1LBZ A;  2P3V A;  4JVD A;  2OWZ A;  1KA1 A;  1FBC A;  4P9K A;  2F3B A;  3LUZ A;  3MST A;  4QBA A;  1FPK A;  5J16 A;  2CEY A;  2BJI A;  5FBP A;  4NN3 A;  4F19 A;  2WYK A;  4GWX A;  5LTC A;  4PDH A;  4IR8 A;  5EYH A;  2R8T A;  3FXB A;  4PE3 A;  1DBZ A;  2FIX A;  1KA0 A;  1XI6 A;  4PBQ A;  4XEQ A;  1NV0 A;  4HE2 A;  1NUY A;  3T0J A;  1FBE A;  2B4M A;  4N17 A;  1FPJ A;  4PAK A;  4NGU A;  1FPB A;  4N4U A;  4PAF A;  4DI3 D;  3RPL A;  2B4L A;  2ZZV A;  4NAP A;  2QVV A;  1NV5 A;  2HHM A;  2CZH A;  1IMA A;  2DE2 A;  4P56 A;  3B50 A;  2QVR A;  3KC0 A;  4PGP A;  2MKZ A;  3T1B A;  4HE0 A;  5EQ8 A;  1FJ6 A;  2CZK A;  4PTK A;  4NHB A;  1RDZ A;  3BIG A;  4AS5 A;  4OVQ A;  4X04 A;  4XF5 A;  4KXP A;  4PAI A;  2WEF A;  4PFB A;  2PFY A;  2KR0 A;  4GBV A;  2Y5K A;  3GYY A;  1K9Z A;  2XA5 A;  2VPO A;  2F3D A;  2V3Q A;  1D9Q A;  1FPI A;  1LBY A;  4I40 A;  1FBD A;  3PTY A;  4MEV A;  1EYK A;  1DCU A;  2WX9 A;  3NOH A;  4MHF A;  4N8Y A;  4PBH A;  5IM2 A;  4O94 A;  4PFI A;  2OX3 A;  4NQ8 A;  3IFA A;  3IFC A;  3CHG A;  5EQA A;  2ZZX A;  5ET5 A;  4JVI A;  1BK4 A;  4GWY A;  2PCR A;  1Q9D A;  4MCO A;  4N91 A;  1AWB A;  1YZ0 A;  3LV0 A;  2F5X A;  4HE1 A;  4NG7 A;  1G0I A;  4GWZ A;  1FRP A;  4OVR A;  4HCW A;  4PDD A;  1FTA A;  4PCD A;  5A5L A;  2CEX A;  4PF6 A;  5CM6 A;  5JK4 A;  2DDK A;  2FHY A;  4GX6 A;  4OVT A;  2WBD A;  5J1D A;  1LBX A;  1FPE A;  2FIE A;  4H46 A;  2FVZ A;  2GQ1 A;  1NV6 A;  1EYI A;  2QVU A;  1K9Y A;  2HZK A;  2XWK A;  4P1L A;  4X8R A;  1VDW A;  4P47 A;  4F18 A;  2DE4 A;  4MIJ A;  4OA4 A;  4PET A;  1IMC A;  1NV1 A;  4PF8 A;  1FPF A;  3ISP A;  4MNI A;  3MYU A;  5T3J A;  1FJ9 A;  3FBP A;  1KZ8 A;  4QXD A;  3W9V A;  2PFZ A;  2QPQ A;  1FPD A;  1FPL A;  4N8G A;  4P8B A;  4O7I A;  2L5V A;  3B8B A;  4M1V A;  3E78 A;  5IZ1 A;  1G0H A;  3ROJ A;  5DW8 A;  2XWV A;  4NF0 A;  4PFR A;  5I5P A;  1NUX A;  2HPG A;  4N6K A;  4F1U A;  2Q9T A;  3QMF A;  4N81 A;  2CZI A;  3KBZ A;  4N15 A;  4DI4 B;  3W9W A;  4P1E A;  2JJK A;  1NV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...