4GWUA

Crystal structure of fru 2,6-bisphosphate complexes of porcine liver fructose-1,6-bisphosphatase with filled central cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
307
Chain Sequence
IVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAIHRAVRKAKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMVNGVNCFMYDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSPEDVTELLEIYQKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Hydrophobic Central Cavity in Fructose-1,6-bisphosphatase is Essential for the Synergism in AMP/Fru 2,6-bisphosphate Inhibition
rcsb
source organism Sus scrofa
molecule tags Hydrolase
total genus 95
structure length 307
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4gwuA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4gwuA02
1FBEA 3LUZA 5ET8A 2WBBA 3FBPA 1YZ0A 5I3SA 4HE1A 1NV3A 3KBZA 1NUWA 5FBPA 1KZ8A 3KC0A 4H45A 4HE0A 4GWUA 1FPFA 2HHMA 1FPIA 3D1RA 4G61A 4GWYA 2OWZA 4KXPA 1FPBA 1FPKA 1XI6A 2Q8MA 4HE2A 3QMFA 5EQ7A 4AS5A 1NV5A 1LEVA 2FIEA 2F3BA 5EYGA 1INPA 1FSAA 2FIXA 2P3NA 2QVRA 3RPLA 1G0HA 3IFAA 1NV1A 1NI9A 4I3YA 1JP4A 2GQ1A 1FBHA 5EQ8A 4PTKA 1FPLA 1DCUA 2CZKA 1IMEA 1RDXA 3BIHA 5ET6A 2Y5KA 4IR8A 1NV7A 1NV2A 5ET7A 5LDZA 1IMCA 1K9YA 1FPGA 1NV0A 1DBZA 2DDKA 5ET5A 1NUYA 2FBPA 1FPJA 2F3DA 2P3VA 2QVVA 2PCRA 1RDYA 1SPIA 1LBZA 1IMFA 5EQ9A 1D9QA 4GWSA 1LBWA 1DK4A 1IMDA 1FPEA 5DW8A 1FBDA 1FBPA 1Q9DA 3B8BA 1AWBA 3LV0A 4GWZA 1EYJA 1BK4A 1RDZA 4GBWA 4I40A 5T3JA 1EYIA 4GX3A 3A29A 5EYHA 1FBCA 1YXIA 1LBYA 1FPDA 1YYZA 2BJIA 4GWXA 4HXVA 5IZ1A 1EYKA 1IMAA 3KC1A 1KA1A 1NV6A 1G0IA 1QGXA 3RYDA 5J16A 4MJOA 5ESYA 2OX3A 5EQAA 2CZIA 4GWWA 2FVZA 4I3EA 2WBDA 3IFCA 5IZ3B 2VT5A 5IZ3A 1NUZA 5F24A 1LBXA 1FJ6A 2FHYA 2JJKA 4AS4A 2CZHA 2QFLA 3T0JA 1IMBA 2QVUA 4GX4A 4GX6A 1NUXA 1FRPA 4FBPA 4N81A 2Q74A 1NV4A 4H46A 1FJ9A 4GBVA 3RPLB 1KA0A 2R8TA 1LBVA 2Y5LA 4O7IA 1FTAA 1K9ZA 2WEFA 3BIGA 1VDWA 1FBFA 5A5LA 3ROJA 4QXDA 1FBGA 1CNQA
chains in the Genus database with same CATH superfamily
2Y7IA 4X1BA 1XS5A 3KZGA 1IITA 4ZE9A 2O51A 3T93B 2O69A 2XXYA 2HXRA 4ZE8A 3VE1B 1JW1A 2P2AA 2X7PA 3H6WA 5ICTA 1QJMA 1NH7A 2I4BA 1USYH 1NI9A 3CVGA 4GD5A 1FTLA 1MY2A 4NTLA 5DVJA 4EXLA 1XVXA 1FQCA 1CB6A 3KOSA 4YZZA 3OXNA 4KFQA 2Y7PA 4NMYA 1IMFA 3D4GA 2XXWA 2UVIA 4P1LA 3GZGA 1VFDA 1II5A 3OSQA 2F6GA 4XF5A 4L17A 4GBWA 4LA9A 4EUOA 4GX3A 3A3CA 2D5WA 1BTJA 4GWXA 2I3VA 4ELQA 4QSCA 4GWWA 4OESA 1LAXA 5IZ3B 1B52A 5CMKA 4MH5A 3Q25A 4PAFA 4YKPA 1FTOA 3TTKA 4LONB 2XA5A 4DIGA 1PBQA 1MXZA 3K01A 1FJ9A 1LBVA 1MY3A 3SETA 3PU5A 1EZ9A 1LB9A 1RKMA 1LBCA 4F19A 3KSXA 3RPWA 2PT1A 2Z23A 1MG1A 2ONSA 3OO7A 2VHAA 2WX9A 4NE4A 4C1UA 5HPQA 3TCFA 3SEUA 2HHMA 1B3EA 3JV9A 4G61A 4Q5TA 4Q30B 5JTYA 5I84A 3GYYA 4RK2A 1ZJLA 1LLSA 1NV1A 2Q9TA 4PC9A 2GQ1A 4BDOA 1Y1MA 4AB6A 2DVCA 2UYEA 3KBRA 3LUYA 1P99A 3VXCA 4OFOA 5IM2A 2ZNSA 3SEWA 3OEMA 3E9XA 2RCAA 3PPNA 5BWJA 2HFBA 1M5EA 5DTBA 4P3LA 4OEUA 1FPEA 2M8CA 3EHSA 4N6PA 1SDXA 3W9VA 1B0HA 4IY5A 4KPTA 3LV0A 1TWYA 1JQFA 1A55A 5T3JA 3SERA 3CHGA 3MZ9A 3QUJA 1H45A 1KA1A 2Y7KA 1G0IA 5H8NA 4MJOA 4QSEA 3FJ7A 4H5GA 3TCGA 1LB8A 2O1LA 3EN3A 3CFLA 5AA3A 4ZECA 2H98A 4H8IA 1FQDA 2PFYA 1IUDA 3DP4A 3S4UA 2QL3A 1B0LA 5I2NB 2MKZA 3K1NA 1FTAA 2RINA 1F9BA 3UN6A 1TT1A 2I0CA 2CZLA 1T0KA 2A5TB 5LTCA 3T22A 4E0XA 2DS9A 3B6TA 5KDTA 1I6BA 2XD2A 4ZEIA 1JETA 2O7UA 4C0RA 4R73A 1JVYA 3TFLA 4Q0CA 1MQHA 4OFLA 1P1UA 3C4MA 3LC8A 2D3IA 3PMWA 4DXBA 4H1XA 1NFTA 2D21A 4DCXA 1BLFA 3VVFA 3PPOA 1FBHA 3HPIA 3TQWA 1QUJA 3IB2A 4ESWA 2FYIA 1FQEA 3EHTA 3B6QA 1B3LA 3Q29A 1XVYA 3MVYA 2DE3A 4TLLB 3CRBA 3TPAA 4U4XA 3FXUA 1Q9DA 3B8BA 1P1OA 1FW0A 1MDP1 4WEPA 4P0GA 4ZDMA 4G68A 4YMAA 2XWOA 3M3LA 1YYZA 3K0VA 3UP9A 2R71A 3DM0A 1N7XA 3PMVA 4NF5A 1S7YA 5A5XB 1WODA 4G8NA 1POTA 2QS1A 2E0SA 2CZHA 4YKIA 1H44A 2QVUA 2NXOA 2ZNTA 5TPAA 3MPKA 1FRPA 4ZEKA 4HCWA 1B2HA 2ZXTA 1B46A 1NV4A 4WKMA 1MDQA 3EF7A 1JW5A 5EHSA 3H4ZA 1B51A 1IXCA 1MS7A 4ELRA 3UORA 4DLDA 2HAVA 5TP9A 4MFIA 2X26A 3GBAA 4OVTA 4F2OA 1SYHA 4OXVA 3VV5A 2BJJX 3PTYA 3QAXA 4O3CA 1FPBA 3QMFA 1LGBC 2E1SA 2O7IA 4ND9A 3E78A 2P3NA 3O29A 1ATGA 3Q27A 4PTKA 3UK4A 5TU0A 4MNIA 4IR8A 1L5TA 1A99A 3T9HB 3PPRA 5ET5A 1DBZA 2FBPA 3QXMA 2QJEA 1I6AA 3TTMA 4DE8A 4ECFA 3TQLA 4QFNA 4OETA 2FA7A 1SPIA 3V89B 1B4HA 1A54A 3TUSA 4OA4A 2ZYOA 1QW0A 1SI0A 3RT8A 2ZYKA 3ZKLA 4JWYA 1SW4A 3ISPA 4Q8RA 4KD5A 5TPAB 4EXKA 3A29A 4PE3A 2DQVA 4X9TA 4YU0A 3QIMA 1B7UA 2KLFA 4PF8A 4N6DA 1QGXA 3U8QA 5J16A 3G3GA 3KFMA 3K00A 1MM7A 4O7MA 2DWIA 2DE2A 5TP9B 4TQUQ 2XXPA 2ZZVA 1QUIA 4HTGA 3VXBA 2DYXA 1WVJA 1EZPA 1MH4A 4H8JA 2Q89A 4GVOA 3ILUB 3TTNA 5I5PA 3IJOB 2ZMBA 2CMOA 3SEXA 2QS2A 2Y5LA 3BIGA 4MX6A 2H9BA 1MXVA 1TFAA 2XXTA 2XXQA 1NNTA 4IB2A 1FBEA 4HE1A 1FQBA 5FBPA 1NUWA 1LAFE 4GWUA 4JVDA 4KXPA 3R7XA 1LSTA 2FIEA 2F3BA 5AA4A 2DE4A 2IEEA 4N4UA 2UVGA 1JP4A 1SBPA 4PDDA 4DXUA 4R75A 1MXWA 4OZ9A 2L5VA 1K9YA 2UXAA 4N6KA 4RYAA 2QVVA 3DP6A 2HEUA 1O7TA 2YJPA 1HSEA 2UVJA 2ZYNA 2QRYA 5H8HB 3OO8A 1IIWA 4RA1A 3MAMA 4F3GA 1AWBA 3OO9A 2VP1A 4NN3A 3EPEA 3OEKA 2QS4A 1RDZA 2B65A 5BUUA 4F22A 4NF6A 3MUQA 1SYIA 3B6WA 5ITPA 4OERA 4OVPA 1DTZA 4K3FA 3MQ9A 4NF8A 2OX3A 1R9QA 2CZIA 4FECA 5AA2A 1LFIA 2HQ0A 4QSDA 4XIGQ 2REGA 4MF3A 3RNNA 1D9YA 1PB7A 1LFGA 4X8RA 4MBPA 1A8FA 3T9UA 3TYHA 1NNFA 1N84A 3KEIA 3HHFA 4I9DA 5ELVA 4GBVA 3E13X 4O7IA 4P56A 1JW4A 1ZBMA 2ZYMA 4TLMB 4GL8A 4IO6A 5HM4B 1CNQA 4OHNA 5L9MA 3N26A 3BBRA 4BLAA 5EHMA 1GTKA 3I5OA 1I69A 1B5IA 2F97A 3D1RA 1FPIA 1ZTYA 4XFEA 4GXSB 1OVTA 2DP8A 1XT8A 3PUZE 3K6WA 1B32A 2V4CA 2Y7RA 4OTEA 4C1TA 4U1OA 5J1DA 1QULA 1Y4TA 4PQJA 4QRZA 2DDKA 3C32A 3M3KA 3DLNA 4JSOA 4Z0IA 2F3DA 4PETA 2PBWA 3RTWB 1LBZA 5EQ9A 3K6XA 5IZZA 1B6HA 3MPLA 1GVCA 1Z7NE 4FEBA 1NKXA 1MM6A 5I2KA 3OELA 4N07A 5F1QA 3TTRA 2B3BA 5I59A 2BJIA 3UGWA 4OVQA 5B70A 4ELOA 3EKIA 4IO2A 2XX7A 3K6VA 1NNKA 1MXXA 4JB7A 1IMBA 4FIMA 1UTHA 2DOJA 1OLCA 4OVSA 3OO6A 1YTVA 3PMXA 1B5HA 3FD3A 4H0WA 1UTBA 4FORA 3OD7A 2WEFA 3VDFA 1H76A 4R6YA 3O9PA 1BP5A 2Z22A 3PUXE 3N94A 4N15A 4I62A 3Q28A 2Y7WA 3VLUA 3E4RA 3VVDA 1JVXA 1KZ8A 5ITOA 2AIXA 3ILTB 4HE0A 3IOVA 2HCAA 4JSDA 3T1BA 3IORA 4OVRA 4OENA 4OEVA 4IGRA 4P11A 4MNPA 4QFPA 3PUVE 4NF0A 2HAUA 1OMPA 1DSNA 1ELJA 3U65A 1PB9A 4U23A 4ZS9A 2NWJA 3O6IA 1QVSA 2I58A 4GWSA 4OANA 3SEYA 3KSJA 4F39A 5DW8A 4GWZA 1EYJA 4KHZE 1HSLA 5K2XA 2V3UA 4Z7EA 4WXJA 1LBYA 4R9FA 4LZ5A 4GF8A 3HO7A 2RC8A 4RY1A 3H03A 1GGGA 3CG1A 2WBDA 5IGAA 3IFCA 3O66A 4YKKA 4QFKA 1MQJA 3G3HA 3T0JA 2Q88A 4KCCA 4BDRA 4P1EA 3MP8A 4RJZA 3B50A 2WKYA 1JEVA 4H6DA 5KCJA 1URDA 4ESXA 3C33A 5JK4A 1KA0A 1N0TA 1OQGA 3FBPA 3RT6B 1IZ1A 1LFHA 1FTJA 2P0SA 4PP0A 2AL5A 4DZ1A 5JTYB 1XI6A 3PUWE 1LEVA 3DELB 4NQ8A 3MYUA 4PBHA 4M1VA 4N91A 4I3YA 3MVXA 4F1VA 2XWIA 4U1ZA 1IMEA 5DVFA 1A40A 4GIZA 4U22A 4N13A 4RPNA 1AOVA 2B3FA 4LATA 3JYRA 4IO3A 1OQHA 4G4PA 1IXHA 1PB8A 2XXIA 3IK6B 3TMGA 4MLQA 1B1XA 1RDYA 1DPEA 2DWAA 4OFJA 1DK4A 1M5CA 5K2YA 2XWKA 1SI1A 4EDPA 2ONRA 1NH8A 3HCQA 3MP1A 3CFXA 2DXYA 3KJTA 4HXVA 5H8NB 4G8HA 3PV0E 3KN7A 1PDAA 4N8YA 4R9GA 1B58A 4QF9A 1MPCA 3VVEA 4JXIA 1FJ6A 3P7IA 5DEXA 4DCYA 4KYSA 2REJA 3U94A 4ELPA 4PFWA 1EU8A 4UA8A 1UIVA 2DSFA 3C31A 4JVCA 1YAEA 3O6GA 4PFBA 2F6PA 1XOCA 4G77A 5FHMA 1QKAA 4U4SA 1FBGA 3V5AA 3UA8A 4P47A 5KDTB 4YAHX 3FZVA 4H5FA 3LR1A 3IX1A 1B05A 3IOWA 4PE5B 4U21A 3LSWA 2VD2A 1DOTA 1S50A 5CBSA 4KQPA 5EYGA 1FSAA 4LVQA 2QVRA 2OWTA 4PGNA 5IAIA 4YMBA 2ALUA 4XXUA 3FJGA 3N6UA 2I49A 1BKAA 3G7WA 1LBBA 3TZAA 3PPPA 4PDHA 4ZEFA 4ZZEA 5I57A 1Z7ME 1FPGA 1XHYA 2F7AA 1NUYA 3OENA 5I58A 3VFJA 2X7QA 3RLFE 4UABA 3CI8A 3K02A 4F31B 3A09A 1IMDA 2XXKA 2KR0A 5DEXB 4X1DA 2IA4A 1R9LA 4G68B 4YB7A 2ZZXA 2F7BA 1Q35A 4ISUA 2G93A 2PFZA 1O64A 3IAZA 3H3GA 4NF5B 3PD8A 5F7VA 3T9VA 2XWVA 1R1NA 4R74A 4NF4A 1ZLQA 1B5JA 3C35A 5CMMA 2KQZA 2Q8JA 4GX6A 2OZZA 1VSOA 4I8CA 3L6HA 4OMBA 3TDJA 2RCBA 2O1MA 3TCHA 3CSGA 2V84A 3ROJA 1A8EA 2W7YA 1US5A 4EF2A 4NAPA 3SZPA 3N6TA 3K6UA 3H06B 2XXUA 4LQ5A 2ZNUA 1B1HA 5DVIA 5I58B 2Z8DA 4H45A 2V93A 3WAEA 4GWYA 1N76A 2OWZA 4FJPA 1Y4CA 4GOTA 4HE2A 4AS5A 1TXFA 4R2BA 1MH3A 3SESA 2OPDA 1QUKA 4PBQA 2AYSA 1AL3A 4DI3D 1WDNA 3ECRA 4U2RA 3HFUA 3G3KA 3S9NC 1RDXA 1SVXB 1R6ZA 4R6HA 3FV2A 4XKQA 3H6TA 4YB6A 4BDMA 4FATA 1MPBA 4YICA 2GH9A 1B7HA 4OQOA 3OOAA 1A7LA 4F18A 4ZZAA 1DPPA 1O63A 4RK9A 1BK4A 1LCFA 4QHQA 4KCDA 4OYVA 2CEXA 4F3PA 1FPDA 1S9TA 1B4ZA 2RF1A 1NV6A 4GFRA 2OCUA 1ANFA 4YB5A 5I7IA 3S9EA 3FV1A 2YLNA 4QBAA 5F24A 3C36A 2FHYA 3THIA 5CBRA 3R6UA 3S9MC 4GX4A 3GXAA 1B3GA 2DXRA 2F36A 4N81A 2DWJA 4OVJA 1MRPA 5AE4A 4P0IA 5HBCA 4F2QA 4POWA 4DDDA 3FGSA 3T66A 3U72A 3RQTA 2QPQA 2G29A 3MVZA 5FHNA 1YZ0A 3O97A 4RNSA 5CRYA 3GBBA 4JWXA 3TKDA 1FPFA 3ONMA 2PYYA 1LCTA 4P8BA 1YPNA 5AA4B 3HSTA 4GL0A 3RN8A 2ZZWA 3MZBA 2Q2CA 4XEQA 2RKMA 1NV2A 1ZKBA 5B7DA 1NV0A 1VR5A 3RGYA 4HW8A 1MQDA 2ESNA 3KG2A 3TEPA 4NG7A 3DP8A 1OLAA 1FBDA 1EH3A 2NOOA 4IGTA 2OPEA 4I40A 1EYIA 4NF6B 3SDFA 1KWHA 4LQ2A 5IZ1A 1P1WA 2Z8FA 3IJXB 4PFYA 1RYOA 1ZU0A 4NF8B 3KGCA 5EQAA 3Q26A 4JBZA 2FVZA 1AMFA 4NHBA 5AA2B 4P9KA 4MNCA 2F8DA 5IZ3A 1SD3A 3PPQA 1NUZA 2PVUA 4R72A 1AH5A 1PEBA 2QFLA 3I6VA 1MQGA 3FXQA 3CSBA 4LUBA 1B7ZA 3LSLA 3QUFA 2XXHA 3RUMA 3V8XB 3FVOA 4O3BA 4I1DA 2V25A 1M5DA 2UYFA 2HZKA 4JDFA 2R8TA 1K9ZA 5A5LA 2HXWA 5AA1A 3ODBA 2H99A 5I3SA 2XHDA 2I3WA 4H65A 4XTCQ 4NEDA 2O84X 5M2VA 3O2AA 4ONYA 3E3KA 4MAGA 1M5BA 2VD3A 1N04A 4F1YA 4WEDA 2I6EA 4DI4B 1FTMA 2FIXA 1USYE 2CEYA 2F34A 1UQWA 3EHUA 4NWCA 3HN0A 5ET6A 2Y5KA 2I4CA 2P1SA 2PT2A 4HS7A 3ZSFA 1IMCA 5L9OA 3K2DA 4MIJA 1J1NA 4PFIA 1FPJA 3T96B 4QFLA 4EF1A 4F1UA 2V3TA 2OJTA 4OWDA 3RY3A 2NUVA 5I2KB 1Y3QA 5I59B 1IQ7A 1MQIA 5CI5A 2I48A 1URSA 3D4CA 5ESYA 1GR2A 3K1MA 3OMBA 3VLWA 5CMCA 2PMSA 3C9HA 3W15C 3MC2A 4POXA 4E0WA 3FVNA 3PD9A 3SEVA 2JJKA 3KN8A 2Z8EA 1UTHB 2RC9A 5EYFA 1LAGE 1JEUA 4PGPA 1LAHE 3IB0A 4EQ9A 1UTBB 4LP2B 3RTFB 2Y84A 1D4NA 3T9XB 5I2NA 1JNFA 2GFEA 2OBGA 2A5TA 2WBBA 4KR5A 3KBZA 2VOZA 1Y3PA 3EQ1A 1PBPA 1MY0A 1FPKA 1DTGA 3W9WA 2Q8MA 5EQ7A 3U1OA 2PX1A 5IKBA 4NX1A 4KYDA 1N3WA 1OVBA 3FXBA 4F3SA 1YCJA 4HCYA 1SW5A 1IXGA 1CE2A 4MCOA 4FEDA 3MP6A 1H3DA 2F7CA 4ZEBA 3CG3A 2F5XA 4GXAA 4YKJA 2GHAA 2P3VA 2PCRA 4XKNA 1MXUA 1NNPA 3PUYE 5L8DA 1NL5A 3MJNA 4BDLA 2QMXA 4F3BA 1FBCA 3QYTA 4G68C 2DWHA 3KC1A 1N3XA 2Q2AA 5A5XA 2F78A 3K4UA 2GHBA 2ONKE 3BKIB 1LBXA 1MXYA 1FQFA 3QSLA 4O94A 1Y3NA 1NUXA 3SKPA 5KCJB 4FAJA 3KOTA 3OSRA 3F11A 2QS3A 1QKBA 1XC1A 2H25A 1B9JA 4X04A 3FIRA 1IXIA 5ICQA 5CMBA 3ZKKA 1VDWA 2XXRA 3IOTA 2I0BA 3MSTA 5ET8A 4EQ7A 2H4IA 3HV1A 4PFUA 3KC0A 1PC3A 3IR1A 2QMWA 1NV5A 1RYXA 3MVWA 3RPLA 3H7MA 2A5SA 1OIBA 1EZOA 2CZKA 1VE4A 3BIHA 2H5YA 5ET7A 4N17A 2ABHA 4JVIA 4MEVA 1MY1A 2XXVA 4PF6A 4LN5A 2DVZA 1D9QA 3LSXA 1LBWA 2F35A 2QSXA 3FATA 1FBPA 1NMUA 5L9SA 3S9LC 4R2FA 2HZLA 3LBSA 1B3FA 5EYHA 5LOMA 2O6AA 1EYKA 1MPDA 4THIA 3MZ1A 5DT6A 4G8MA 4NWDA 2R6GE 3IOUA 4GRKA 5H8SA 2VT5A 4GWOA 2YPNA 3H6UA 4GLIA 4AS4A 3O6HA 2WYPA 4PAKA 5H8FA 3FUZA 1N7WA 4H67A 1D9VA 3QK6A 4ZEDA 3RPLB 3A3UA 2XX8A 3MWBA 4MLVA 2NVUB 4RPOA 2LAOA 1URGA 4DXCA 5I56A 1NV3A 5CM6A 3UIFA 5AA2D 4EQBA 3FVKA 4F29A 5KZTA 4PFTA 4LZ7A 3MW0A 3LSFB 5DYHA 5FHOA 1IEJA 2VPOA 3HHGA 4MMPA 5EQ8A 4O8MA 2AL4A 2XX9A 1P1QA 1FTKA 1UIUA 5I57B 4IO5A 4IO7A 3R26A 3U92A 4FE8A 4UACA 1GV8A 2ANJA 5H8QA 3BFUA 1SQYA 3IL1B 1P1NA 2GRVA 5H8HA 2R9JA 2THIA 5H8FB 1B40A 3IO6A 3S2VA 5CC2A 1TFDA 1IMAA 1FCKA 2RC7A 4N8GA 3G3IA 1VFEA 4I3EA 1FQAA 2VGQA 5JEIA 4NF4B 3V83A 4JWOA 5I56B 1DMBA 4RXLA 1Y1ZA 3FVGA 3TTLA 4H46A 5FTIA 2OLBA 4QFOA 1FBFA 3E79A 3JZJA 4XKPA 3LUZA 3TODA 3I3VA 4M4GA 3TAJA 1ZMGA 4KYEA 3K1PA 3CFZA 3N5LA 5ISUA 1D3KA 2XD3A 5H8QB 3ZS6A 1AIVA 1Y9UA 4X48A 2OK2A 3FXRA 4IY6A 1SW1A 4AB5A 4PAIA 1INPA 2WYKA 4GQOA 1G0HA 4PCDA 3IFAA 3CIJA 4BDQA 2FNCA 3VLVA 4LZ8A 2B4LA 1FPLA 1DCUA 4TOZA 4AQ4A 1Q1KA 3B7DA 1NV7A 5LDZA 2B4MA 3NOHA 1M5FA 3G3FA 3TELA 3AXFA 4G2ZA 2XXXA 3CR9A 1HSJA 2O68A 4BDNA 4O3AA 3WAFA 1H43A 1MY4A 2VPNA 1US4A 3M3FA 4PFRA 4NGUA 3FASA 3PGFA 3M8UA 1YXIA 1I6QA 3KJ7A 3RYDA 2HPGA 3H6VA 3MBPA 2V3QA 1POY1 4R6KA 3IB1A 4KI0E 3G3JA 1Y20A 1ZIUA 2OWSA 3U93A 4XKRA 1BIYA 3L6GA 3IO4A 3O28A 3BFTA 3GLBA 4FBPA 2Q74A 2UVHA 3FJMA 5FTHA 1B3HA 3USDA 4MHFA 3C34A 4QXDA 4IO4A 3KN3A 1SW2A
chains in the Genus database with same CATH topology
1FBEA 2WBBA 4HE1A 3KBZA 5FBPA 1NUWA 2HXRA 4GWUA 4JVDA 4KXPA 1FPKA 3W9WA 2Q8MA 5EQ7A 2FIEA 2F3BA 2DE4A 5EYGA 1FSAA 2QVRA 4NX1A 4PGNA 1NI9A 3FXBA 4N4UA 1JP4A 4HCYA 4PDDA 4MCOA 2L5VA 4PDHA 4YZZA 1K9YA 1FPGA 2F5XA 1NUYA 4N6KA 2P3VA 2QVVA 2PCRA 1IMFA 4UABA 1IMDA 2XXKA 2KR0A 4P1LA 1AWBA 4NN3A 4XF5A 2ZZXA 1RDZA 4GBWA 4GX3A 1FBCA 4GWXA 2PFZA 3KC1A 4OVPA 2OX3A 2CZIA 4GWWA 2XWVA 5IZ3B 1LBXA 4X8RA 4O94A 2KQZA 4PAFA 4GX6A 1NUXA 2XA5A 4X04A 1FJ9A 4GBVA 1LBVA 4O7IA 4P56A 1VDWA 3ROJA 4F19A 3MSTA 1CNQA 4NAPA 3SZPA 5ET8A 2WX9A 3KC0A 4H45A 2HHMA 1FPIA 3D1RA 4G61A 4GWYA 2OWZA 4XFEA 4HE2A 4AS5A 1NV5A 3GYYA 3RPLA 4PBQA 1NV1A 2Q9TA 4DI3D 4PC9A 2GQ1A 3HFUA 2CZKA 1RDXA 3BIHA 2V4CA 5ET7A 5J1DA 4N17A 2DDKA 4JVIA 5IM2A 4MEVA 2F3DA 4YICA 4PETA 4PF6A 4LN5A 2DVZA 1LBZA 5EQ9A 1D9QA 4P3LA 1LBWA 5IZZA 4F18A 1FPEA 1FBPA 3W9VA 3LV0A 1BK4A 2HZLA 5T3JA 3CHGA 5EYHA 2CEXA 1FPDA 2BJIA 1EYKA 1KA1A 1NV6A 1G0IA 4OVQA 4MJOA 3EKIA 5I7IA 2VT5A 4QBAA 5F24A 2FHYA 4AS4A 2WYPA 4PAKA 1IMBA 4GX4A 2PFYA 4OVSA 4N81A 3RPLB 2MKZA 1FTAA 2WEFA 2QPQA 5LTCA 4N15A 1YZ0A 1NV3A 5CM6A 1KZ8A 4HE0A 1FPFA 4P8BA 3T1BA 4OVRA 2VPOA 4MMPA 4MNPA 5EQ8A 1FBHA 2ZZWA 4O8MA 4XEQA 4NF0A 1NV2A 1NV0A 3U65A 2DE3A 4GWSA 4NG7A 4OANA 5DW8A 1FBDA 1Q9DA 3B8BA 4GWZA 1EYJA 4I40A 1EYIA 2XWOA 1LBYA 1YYZA 5IZ1A 1IMAA 4N8GA 5EQAA 4NHBA 2FVZA 4I3EA 2WBDA 4P9KA 5IGAA 3IFCA 4MNCA 5IZ3A 1NUZA 2CZHA 2QFLA 3T0JA 4P1EA 2QVUA 1FRPA 3B50A 4HCWA 1NV4A 2HZKA 4H46A 5JK4A 1KA0A 2R8TA 1K9ZA 1FBFA 5A5LA 3E79A 3LUZA 3FBPA 4OVTA 5I3SA 3PTYA 4MAGA 1FPBA 1XI6A 3QMFA 1LEVA 4DI4B 4NQ8A 3E78A 3MYUA 4PAIA 1INPA 2FIXA 2P3NA 2CEYA 4PBHA 2WYKA 1G0HA 3IFAA 4PCDA 4M1VA 4N91A 4I3YA 4F1VA 2XWIA 2B4LA 4PTKA 1FPLA 1DCUA 4MNIA 1IMEA 5ET6A 2Y5KA 4IR8A 1NV7A 5LDZA 1IMCA 2B4MA 3NOHA 5ET5A 1DBZA 2FBPA 4MIJA 4PFIA 1FPJA 4F1UA 1RDYA 1SPIA 4OA4A 1DK4A 2XWKA 2VPNA 3ISPA 4PFRA 4NGUA 3A29A 4PE3A 1YXIA 4X9TA 4HXVA 4N6DA 4PF8A 1QGXA 3RYDA 5J16A 5ESYA 2HPGA 2V3QA 4N8YA 4O7MA 2JJKA 1FJ6A 2DE2A 2ZZVA 4PGPA 4JVCA 4PFBA 5I5PA 4FBPA 2Q74A 2Y5LA 4MHFA 3BIGA 4MX6A 4QXDA 1FBGA 4P47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBE A;  3LUZ A;  5ET8 A;  2WBB A;  3FBP A;  1YZ0 A;  5I3S A;  4HE1 A;  1NV3 A;  3KBZ A;  1NUW A;  5FBP A;  1KZ8 A;  3KC0 A;  4H45 A;  4HE0 A;  4GWU A;  1FPF A;  2HHM A;  1FPI A;  3D1R A;  4G61 A;  4GWY A;  2OWZ A;  4KXP A;  1FPB A;  1FPK A;  1XI6 A;  2Q8M A;  4HE2 A;  3QMF A;  5EQ7 A;  4AS5 A;  1NV5 A;  1LEV A;  2FIE A;  2F3B A;  5EYG A;  1INP A;  1FSA A;  2FIX A;  2P3N A;  2QVR A;  3RPL A;  1G0H A;  3IFA A;  1NV1 A;  1NI9 A;  4I3Y A;  1JP4 A;  2GQ1 A;  1FBH A;  5EQ8 A;  4PTK A;  1FPL A;  1DCU A;  2CZK A;  1IME A;  1RDX A;  3BIH A;  5ET6 A;  2Y5K A;  4IR8 A;  1NV7 A;  1NV2 A;  5ET7 A;  5LDZ A;  1IMC A;  1K9Y A;  1FPG A;  1NV0 A;  1DBZ A;  2DDK A;  5ET5 A;  1NUY A;  2FBP A;  1FPJ A;  2F3D A;  2P3V A;  2QVV A;  2PCR A;  1RDY A;  1SPI A;  1LBZ A;  1IMF A;  5EQ9 A;  1D9Q A;  4GWS A;  1LBW A;  1DK4 A;  1IMD A;  1FPE A;  5DW8 A;  1FBD A;  1FBP A;  1Q9D A;  3B8B A;  1AWB A;  3LV0 A;  4GWZ A;  1EYJ A;  1BK4 A;  1RDZ A;  4GBW A;  4I40 A;  5T3J A;  1EYI A;  4GX3 A;  3A29 A;  5EYH A;  1FBC A;  1YXI A;  1LBY A;  1FPD A;  1YYZ A;  2BJI A;  4GWX A;  4HXV A;  5IZ1 A;  1EYK A;  1IMA A;  3KC1 A;  1KA1 A;  1NV6 A;  1G0I A;  1QGX A;  3RYD A;  5J16 A;  4MJO A;  5ESY A;  2OX3 A;  5EQA A;  2CZI A;  4GWW A;  2FVZ A;  4I3E A;  2WBD A;  3IFC A;  5IZ3 B;  2VT5 A;  5IZ3 A;  1NUZ A;  5F24 A;  1LBX A;  1FJ6 A;  2FHY A;  2JJK A;  4AS4 A;  2CZH A;  2QFL A;  3T0J A;  1IMB A;  2QVU A;  4GX4 A;  4GX6 A;  1NUX A;  1FRP A;  4FBP A;  4N81 A;  2Q74 A;  1NV4 A;  4H46 A;  1FJ9 A;  4GBV A;  3RPL B;  1KA0 A;  2R8T A;  1LBV A;  2Y5L A;  4O7I A;  1FTA A;  1K9Z A;  2WEF A;  3BIG A;  1VDW A;  1FBF A;  5A5L A;  3ROJ A;  4QXD A;  1FBG A;  1CNQ A; 
#chains in the Genus database with same CATH topology
 2Y7I A;  4X1B A;  1XS5 A;  3KZG A;  1IIT A;  4ZE9 A;  2O51 A;  3T93 B;  2O69 A;  2XXY A;  2HXR A;  4ZE8 A;  3VE1 B;  1JW1 A;  2P2A A;  2X7P A;  3H6W A;  5ICT A;  1QJM A;  1NH7 A;  2I4B A;  1USY H;  1NI9 A;  3CVG A;  4GD5 A;  1FTL A;  1MY2 A;  4NTL A;  5DVJ A;  4EXL A;  1XVX A;  1FQC A;  1CB6 A;  3KOS A;  4YZZ A;  3OXN A;  4KFQ A;  2Y7P A;  4NMY A;  1IMF A;  3D4G A;  2XXW A;  2UVI A;  4P1L A;  3GZG A;  1VFD A;  1II5 A;  3OSQ A;  2F6G A;  4XF5 A;  4L17 A;  4GBW A;  4LA9 A;  4EUO A;  4GX3 A;  3A3C A;  2D5W A;  1BTJ A;  4GWX A;  2I3V A;  4ELQ A;  4QSC A;  4GWW A;  4OES A;  1LAX A;  5IZ3 B;  1B52 A;  5CMK A;  4MH5 A;  3Q25 A;  4PAF A;  4YKP A;  1FTO A;  3TTK A;  4LON B;  2XA5 A;  4DIG A;  1PBQ A;  1MXZ A;  3K01 A;  1FJ9 A;  1LBV A;  1MY3 A;  3SET A;  3PU5 A;  1EZ9 A;  1LB9 A;  1RKM A;  1LBC A;  4F19 A;  3KSX A;  3RPW A;  2PT1 A;  2Z23 A;  1MG1 A;  2ONS A;  3OO7 A;  2VHA A;  2WX9 A;  4NE4 A;  4C1U A;  5HPQ A;  3TCF A;  3SEU A;  2HHM A;  1B3E A;  3JV9 A;  4G61 A;  4Q5T A;  4Q30 B;  5JTY A;  5I84 A;  3GYY A;  4RK2 A;  1ZJL A;  1LLS A;  1NV1 A;  2Q9T A;  4PC9 A;  2GQ1 A;  4BDO A;  1Y1M A;  4AB6 A;  2DVC A;  2UYE A;  3KBR A;  3LUY A;  1P99 A;  3VXC A;  4OFO A;  5IM2 A;  2ZNS A;  3SEW A;  3OEM A;  3E9X A;  2RCA A;  3PPN A;  5BWJ A;  2HFB A;  1M5E A;  5DTB A;  4P3L A;  4OEU A;  1FPE A;  2M8C A;  3EHS A;  4N6P A;  1SDX A;  3W9V A;  1B0H A;  4IY5 A;  4KPT A;  3LV0 A;  1TWY A;  1JQF A;  1A55 A;  5T3J A;  3SER A;  3CHG A;  3MZ9 A;  3QUJ A;  1H45 A;  1KA1 A;  2Y7K A;  1G0I A;  5H8N A;  4MJO A;  4QSE A;  3FJ7 A;  4H5G A;  3TCG A;  1LB8 A;  2O1L A;  3EN3 A;  3CFL A;  5AA3 A;  4ZEC A;  2H98 A;  4H8I A;  1FQD A;  2PFY A;  1IUD A;  3DP4 A;  3S4U A;  2QL3 A;  1B0L A;  5I2N B;  2MKZ A;  3K1N A;  1FTA A;  2RIN A;  1F9B A;  3UN6 A;  1TT1 A;  2I0C A;  2CZL A;  1T0K A;  2A5T B;  5LTC A;  3T22 A;  4E0X A;  2DS9 A;  3B6T A;  5KDT A;  1I6B A;  2XD2 A;  4ZEI A;  1JET A;  2O7U A;  4C0R A;  4R73 A;  1JVY A;  3TFL A;  4Q0C A;  1MQH A;  4OFL A;  1P1U A;  3C4M A;  3LC8 A;  2D3I A;  3PMW A;  4DXB A;  4H1X A;  1NFT A;  2D21 A;  4DCX A;  1BLF A;  3VVF A;  3PPO A;  1FBH A;  3HPI A;  3TQW A;  1QUJ A;  3IB2 A;  4ESW A;  2FYI A;  1FQE A;  3EHT A;  3B6Q A;  1B3L A;  3Q29 A;  1XVY A;  3MVY A;  2DE3 A;  4TLL B;  3CRB A;  3TPA A;  4U4X A;  3FXU A;  1Q9D A;  3B8B A;  1P1O A;  1FW0 A;  1MDP 1;  4WEP A;  4P0G A;  4ZDM A;  4G68 A;  4YMA A;  2XWO A;  3M3L A;  1YYZ A;  3K0V A;  3UP9 A;  2R71 A;  3DM0 A;  1N7X A;  3PMV A;  4NF5 A;  1S7Y A;  5A5X B;  1WOD A;  4G8N A;  1POT A;  2QS1 A;  2E0S A;  2CZH A;  4YKI A;  1H44 A;  2QVU A;  2NXO A;  2ZNT A;  5TPA A;  3MPK A;  1FRP A;  4ZEK A;  4HCW A;  1B2H A;  2ZXT A;  1B46 A;  1NV4 A;  4WKM A;  1MDQ A;  3EF7 A;  1JW5 A;  5EHS A;  3H4Z A;  1B51 A;  1IXC A;  1MS7 A;  4ELR A;  3UOR A;  4DLD A;  2HAV A;  5TP9 A;  4MFI A;  2X26 A;  3GBA A;  4OVT A;  4F2O A;  1SYH A;  4OXV A;  3VV5 A;  2BJJ X;  3PTY A;  3QAX A;  4O3C A;  1FPB A;  3QMF A;  1LGB C;  2E1S A;  2O7I A;  4ND9 A;  3E78 A;  2P3N A;  3O29 A;  1ATG A;  3Q27 A;  4PTK A;  3UK4 A;  5TU0 A;  4MNI A;  4IR8 A;  1L5T A;  1A99 A;  3T9H B;  3PPR A;  5ET5 A;  1DBZ A;  2FBP A;  3QXM A;  2QJE A;  1I6A A;  3TTM A;  4DE8 A;  4ECF A;  3TQL A;  4QFN A;  4OET A;  2FA7 A;  1SPI A;  3V89 B;  1B4H A;  1A54 A;  3TUS A;  4OA4 A;  2ZYO A;  1QW0 A;  1SI0 A;  3RT8 A;  2ZYK A;  3ZKL A;  4JWY A;  1SW4 A;  3ISP A;  4Q8R A;  4KD5 A;  5TPA B;  4EXK A;  3A29 A;  4PE3 A;  2DQV A;  4X9T A;  4YU0 A;  3QIM A;  1B7U A;  2KLF A;  4PF8 A;  4N6D A;  1QGX A;  3U8Q A;  5J16 A;  3G3G A;  3KFM A;  3K00 A;  1MM7 A;  4O7M A;  2DWI A;  2DE2 A;  5TP9 B;  4TQU Q;  2XXP A;  2ZZV A;  1QUI A;  4HTG A;  3VXB A;  2DYX A;  1WVJ A;  1EZP A;  1MH4 A;  4H8J A;  2Q89 A;  4GVO A;  3ILU B;  3TTN A;  5I5P A;  3IJO B;  2ZMB A;  2CMO A;  3SEX A;  2QS2 A;  2Y5L A;  3BIG A;  4MX6 A;  2H9B A;  1MXV A;  1TFA A;  2XXT A;  2XXQ A;  1NNT A;  4IB2 A;  1FBE A;  4HE1 A;  1FQB A;  5FBP A;  1NUW A;  1LAF E;  4GWU A;  4JVD A;  4KXP A;  3R7X A;  1LST A;  2FIE A;  2F3B A;  5AA4 A;  2DE4 A;  2IEE A;  4N4U A;  2UVG A;  1JP4 A;  1SBP A;  4PDD A;  4DXU A;  4R75 A;  1MXW A;  4OZ9 A;  2L5V A;  1K9Y A;  2UXA A;  4N6K A;  4RYA A;  2QVV A;  3DP6 A;  2HEU A;  1O7T A;  2YJP A;  1HSE A;  2UVJ A;  2ZYN A;  2QRY A;  5H8H B;  3OO8 A;  1IIW A;  4RA1 A;  3MAM A;  4F3G A;  1AWB A;  3OO9 A;  2VP1 A;  4NN3 A;  3EPE A;  3OEK A;  2QS4 A;  1RDZ A;  2B65 A;  5BUU A;  4F22 A;  4NF6 A;  3MUQ A;  1SYI A;  3B6W A;  5ITP A;  4OER A;  4OVP A;  1DTZ A;  4K3F A;  3MQ9 A;  4NF8 A;  2OX3 A;  1R9Q A;  2CZI A;  4FEC A;  5AA2 A;  1LFI A;  2HQ0 A;  4QSD A;  4XIG Q;  2REG A;  4MF3 A;  3RNN A;  1D9Y A;  1PB7 A;  1LFG A;  4X8R A;  4MBP A;  1A8F A;  3T9U A;  3TYH A;  1NNF A;  1N84 A;  3KEI A;  3HHF A;  4I9D A;  5ELV A;  4GBV A;  3E13 X;  4O7I A;  4P56 A;  1JW4 A;  1ZBM A;  2ZYM A;  4TLM B;  4GL8 A;  4IO6 A;  5HM4 B;  1CNQ A;  4OHN A;  5L9M A;  3N26 A;  3BBR A;  4BLA A;  5EHM A;  1GTK A;  3I5O A;  1I69 A;  1B5I A;  2F97 A;  3D1R A;  1FPI A;  1ZTY A;  4XFE A;  4GXS B;  1OVT A;  2DP8 A;  1XT8 A;  3PUZ E;  3K6W A;  1B32 A;  2V4C A;  2Y7R A;  4OTE A;  4C1T A;  4U1O A;  5J1D A;  1QUL A;  1Y4T A;  4PQJ A;  4QRZ A;  2DDK A;  3C32 A;  3M3K A;  3DLN A;  4JSO A;  4Z0I A;  2F3D A;  4PET A;  2PBW A;  3RTW B;  1LBZ A;  5EQ9 A;  3K6X A;  5IZZ A;  1B6H A;  3MPL A;  1GVC A;  1Z7N E;  4FEB A;  1NKX A;  1MM6 A;  5I2K A;  3OEL A;  4N07 A;  5F1Q A;  3TTR A;  2B3B A;  5I59 A;  2BJI A;  3UGW A;  4OVQ A;  5B70 A;  4ELO A;  3EKI A;  4IO2 A;  2XX7 A;  3K6V A;  1NNK A;  1MXX A;  4JB7 A;  1IMB A;  4FIM A;  1UTH A;  2DOJ A;  1OLC A;  4OVS A;  3OO6 A;  1YTV A;  3PMX A;  1B5H A;  3FD3 A;  4H0W A;  1UTB A;  4FOR A;  3OD7 A;  2WEF A;  3VDF A;  1H76 A;  4R6Y A;  3O9P A;  1BP5 A;  2Z22 A;  3PUX E;  3N94 A;  4N15 A;  4I62 A;  3Q28 A;  2Y7W A;  3VLU A;  3E4R A;  3VVD A;  1JVX A;  1KZ8 A;  5ITO A;  2AIX A;  3ILT B;  4HE0 A;  3IOV A;  2HCA A;  4JSD A;  3T1B A;  3IOR A;  4OVR A;  4OEN A;  4OEV A;  4IGR A;  4P11 A;  4MNP A;  4QFP A;  3PUV E;  4NF0 A;  2HAU A;  1OMP A;  1DSN A;  1ELJ A;  3U65 A;  1PB9 A;  4U23 A;  4ZS9 A;  2NWJ A;  3O6I A;  1QVS A;  2I58 A;  4GWS A;  4OAN A;  3SEY A;  3KSJ A;  4F39 A;  5DW8 A;  4GWZ A;  1EYJ A;  4KHZ E;  1HSL A;  5K2X A;  2V3U A;  4Z7E A;  4WXJ A;  1LBY A;  4R9F A;  4LZ5 A;  4GF8 A;  3HO7 A;  2RC8 A;  4RY1 A;  3H03 A;  1GGG A;  3CG1 A;  2WBD A;  5IGA A;  3IFC A;  3O66 A;  4YKK A;  4QFK A;  1MQJ A;  3G3H A;  3T0J A;  2Q88 A;  4KCC A;  4BDR A;  4P1E A;  3MP8 A;  4RJZ A;  3B50 A;  2WKY A;  1JEV A;  4H6D A;  5KCJ A;  1URD A;  4ESX A;  3C33 A;  5JK4 A;  1KA0 A;  1N0T A;  1OQG A;  3FBP A;  3RT6 B;  1IZ1 A;  1LFH A;  1FTJ A;  2P0S A;  4PP0 A;  2AL5 A;  4DZ1 A;  5JTY B;  1XI6 A;  3PUW E;  1LEV A;  3DEL B;  4NQ8 A;  3MYU A;  4PBH A;  4M1V A;  4N91 A;  4I3Y A;  3MVX A;  4F1V A;  2XWI A;  4U1Z A;  1IME A;  5DVF A;  1A40 A;  4GIZ A;  4U22 A;  4N13 A;  4RPN A;  1AOV A;  2B3F A;  4LAT A;  3JYR A;  4IO3 A;  1OQH A;  4G4P A;  1IXH A;  1PB8 A;  2XXI A;  3IK6 B;  3TMG A;  4MLQ A;  1B1X A;  1RDY A;  1DPE A;  2DWA A;  4OFJ A;  1DK4 A;  1M5C A;  5K2Y A;  2XWK A;  1SI1 A;  4EDP A;  2ONR A;  1NH8 A;  3HCQ A;  3MP1 A;  3CFX A;  2DXY A;  3KJT A;  4HXV A;  5H8N B;  4G8H A;  3PV0 E;  3KN7 A;  1PDA A;  4N8Y A;  4R9G A;  1B58 A;  4QF9 A;  1MPC A;  3VVE A;  4JXI A;  1FJ6 A;  3P7I A;  5DEX A;  4DCY A;  4KYS A;  2REJ A;  3U94 A;  4ELP A;  4PFW A;  1EU8 A;  4UA8 A;  1UIV A;  2DSF A;  3C31 A;  4JVC A;  1YAE A;  3O6G A;  4PFB A;  2F6P A;  1XOC A;  4G77 A;  5FHM A;  1QKA A;  4U4S A;  1FBG A;  3V5A A;  3UA8 A;  4P47 A;  5KDT B;  4YAH X;  3FZV A;  4H5F A;  3LR1 A;  3IX1 A;  1B05 A;  3IOW A;  4PE5 B;  4U21 A;  3LSW A;  2VD2 A;  1DOT A;  1S50 A;  5CBS A;  4KQP A;  5EYG A;  1FSA A;  4LVQ A;  2QVR A;  2OWT A;  4PGN A;  5IAI A;  4YMB A;  2ALU A;  4XXU A;  3FJG A;  3N6U A;  2I49 A;  1BKA A;  3G7W A;  1LBB A;  3TZA A;  3PPP A;  4PDH A;  4ZEF A;  4ZZE A;  5I57 A;  1Z7M E;  1FPG A;  1XHY A;  2F7A A;  1NUY A;  3OEN A;  5I58 A;  3VFJ A;  2X7Q A;  3RLF E;  4UAB A;  3CI8 A;  3K02 A;  4F31 B;  3A09 A;  1IMD A;  2XXK A;  2KR0 A;  5DEX B;  4X1D A;  2IA4 A;  1R9L A;  4G68 B;  4YB7 A;  2ZZX A;  2F7B A;  1Q35 A;  4ISU A;  2G93 A;  2PFZ A;  1O64 A;  3IAZ A;  3H3G A;  4NF5 B;  3PD8 A;  5F7V A;  3T9V A;  2XWV A;  1R1N A;  4R74 A;  4NF4 A;  1ZLQ A;  1B5J A;  3C35 A;  5CMM A;  2KQZ A;  2Q8J A;  4GX6 A;  2OZZ A;  1VSO A;  4I8C A;  3L6H A;  4OMB A;  3TDJ A;  2RCB A;  2O1M A;  3TCH A;  3CSG A;  2V84 A;  3ROJ A;  1A8E A;  2W7Y A;  1US5 A;  4EF2 A;  4NAP A;  3SZP A;  3N6T A;  3K6U A;  3H06 B;  2XXU A;  4LQ5 A;  2ZNU A;  1B1H A;  5DVI A;  5I58 B;  2Z8D A;  4H45 A;  2V93 A;  3WAE A;  4GWY A;  1N76 A;  2OWZ A;  4FJP A;  1Y4C A;  4GOT A;  4HE2 A;  4AS5 A;  1TXF A;  4R2B A;  1MH3 A;  3SES A;  2OPD A;  1QUK A;  4PBQ A;  2AYS A;  1AL3 A;  4DI3 D;  1WDN A;  3ECR A;  4U2R A;  3HFU A;  3G3K A;  3S9N C;  1RDX A;  1SVX B;  1R6Z A;  4R6H A;  3FV2 A;  4XKQ A;  3H6T A;  4YB6 A;  4BDM A;  4FAT A;  1MPB A;  4YIC A;  2GH9 A;  1B7H A;  4OQO A;  3OOA A;  1A7L A;  4F18 A;  4ZZA A;  1DPP A;  1O63 A;  4RK9 A;  1BK4 A;  1LCF A;  4QHQ A;  4KCD A;  4OYV A;  2CEX A;  4F3P A;  1FPD A;  1S9T A;  1B4Z A;  2RF1 A;  1NV6 A;  4GFR A;  2OCU A;  1ANF A;  4YB5 A;  5I7I A;  3S9E A;  3FV1 A;  2YLN A;  4QBA A;  5F24 A;  3C36 A;  2FHY A;  3THI A;  5CBR A;  3R6U A;  3S9M C;  4GX4 A;  3GXA A;  1B3G A;  2DXR A;  2F36 A;  4N81 A;  2DWJ A;  4OVJ A;  1MRP A;  5AE4 A;  4P0I A;  5HBC A;  4F2Q A;  4POW A;  4DDD A;  3FGS A;  3T66 A;  3U72 A;  3RQT A;  2QPQ A;  2G29 A;  3MVZ A;  5FHN A;  1YZ0 A;  3O97 A;  4RNS A;  5CRY A;  3GBB A;  4JWX A;  3TKD A;  1FPF A;  3ONM A;  2PYY A;  1LCT A;  4P8B A;  1YPN A;  5AA4 B;  3HST A;  4GL0 A;  3RN8 A;  2ZZW A;  3MZB A;  2Q2C A;  4XEQ A;  2RKM A;  1NV2 A;  1ZKB A;  5B7D A;  1NV0 A;  1VR5 A;  3RGY A;  4HW8 A;  1MQD A;  2ESN A;  3KG2 A;  3TEP A;  4NG7 A;  3DP8 A;  1OLA A;  1FBD A;  1EH3 A;  2NOO A;  4IGT A;  2OPE A;  4I40 A;  1EYI A;  4NF6 B;  3SDF A;  1KWH A;  4LQ2 A;  5IZ1 A;  1P1W A;  2Z8F A;  3IJX B;  4PFY A;  1RYO A;  1ZU0 A;  4NF8 B;  3KGC A;  5EQA A;  3Q26 A;  4JBZ A;  2FVZ A;  1AMF A;  4NHB A;  5AA2 B;  4P9K A;  4MNC A;  2F8D A;  5IZ3 A;  1SD3 A;  3PPQ A;  1NUZ A;  2PVU A;  4R72 A;  1AH5 A;  1PEB A;  2QFL A;  3I6V A;  1MQG A;  3FXQ A;  3CSB A;  4LUB A;  1B7Z A;  3LSL A;  3QUF A;  2XXH A;  3RUM A;  3V8X B;  3FVO A;  4O3B A;  4I1D A;  2V25 A;  1M5D A;  2UYF A;  2HZK A;  4JDF A;  2R8T A;  1K9Z A;  5A5L A;  2HXW A;  5AA1 A;  3ODB A;  2H99 A;  5I3S A;  2XHD A;  2I3W A;  4H65 A;  4XTC Q;  4NED A;  2O84 X;  5M2V A;  3O2A A;  4ONY A;  3E3K A;  4MAG A;  1M5B A;  2VD3 A;  1N04 A;  4F1Y A;  4WED A;  2I6E A;  4DI4 B;  1FTM A;  2FIX A;  1USY E;  2CEY A;  2F34 A;  1UQW A;  3EHU A;  4NWC A;  3HN0 A;  5ET6 A;  2Y5K A;  2I4C A;  2P1S A;  2PT2 A;  4HS7 A;  3ZSF A;  1IMC A;  5L9O A;  3K2D A;  4MIJ A;  1J1N A;  4PFI A;  1FPJ A;  3T96 B;  4QFL A;  4EF1 A;  4F1U A;  2V3T A;  2OJT A;  4OWD A;  3RY3 A;  2NUV A;  5I2K B;  1Y3Q A;  5I59 B;  1IQ7 A;  1MQI A;  5CI5 A;  2I48 A;  1URS A;  3D4C A;  5ESY A;  1GR2 A;  3K1M A;  3OMB A;  3VLW A;  5CMC A;  2PMS A;  3C9H A;  3W15 C;  3MC2 A;  4POX A;  4E0W A;  3FVN A;  3PD9 A;  3SEV A;  2JJK A;  3KN8 A;  2Z8E A;  1UTH B;  2RC9 A;  5EYF A;  1LAG E;  1JEU A;  4PGP A;  1LAH E;  3IB0 A;  4EQ9 A;  1UTB B;  4LP2 B;  3RTF B;  2Y84 A;  1D4N A;  3T9X B;  5I2N A;  1JNF A;  2GFE A;  2OBG A;  2A5T A;  2WBB A;  4KR5 A;  3KBZ A;  2VOZ A;  1Y3P A;  3EQ1 A;  1PBP A;  1MY0 A;  1FPK A;  1DTG A;  3W9W A;  2Q8M A;  5EQ7 A;  3U1O A;  2PX1 A;  5IKB A;  4NX1 A;  4KYD A;  1N3W A;  1OVB A;  3FXB A;  4F3S A;  1YCJ A;  4HCY A;  1SW5 A;  1IXG A;  1CE2 A;  4MCO A;  4FED A;  3MP6 A;  1H3D A;  2F7C A;  4ZEB A;  3CG3 A;  2F5X A;  4GXA A;  4YKJ A;  2GHA A;  2P3V A;  2PCR A;  4XKN A;  1MXU A;  1NNP A;  3PUY E;  5L8D A;  1NL5 A;  3MJN A;  4BDL A;  2QMX A;  4F3B A;  1FBC A;  3QYT A;  4G68 C;  2DWH A;  3KC1 A;  1N3X A;  2Q2A A;  5A5X A;  2F78 A;  3K4U A;  2GHB A;  2ONK E;  3BKI B;  1LBX A;  1MXY A;  1FQF A;  3QSL A;  4O94 A;  1Y3N A;  1NUX A;  3SKP A;  5KCJ B;  4FAJ A;  3KOT A;  3OSR A;  3F11 A;  2QS3 A;  1QKB A;  1XC1 A;  2H25 A;  1B9J A;  4X04 A;  3FIR A;  1IXI A;  5ICQ A;  5CMB A;  3ZKK A;  1VDW A;  2XXR A;  3IOT A;  2I0B A;  3MST A;  5ET8 A;  4EQ7 A;  2H4I A;  3HV1 A;  4PFU A;  3KC0 A;  1PC3 A;  3IR1 A;  2QMW A;  1NV5 A;  1RYX A;  3MVW A;  3RPL A;  3H7M A;  2A5S A;  1OIB A;  1EZO A;  2CZK A;  1VE4 A;  3BIH A;  2H5Y A;  5ET7 A;  4N17 A;  2ABH A;  4JVI A;  4MEV A;  1MY1 A;  2XXV A;  4PF6 A;  4LN5 A;  2DVZ A;  1D9Q A;  3LSX A;  1LBW A;  2F35 A;  2QSX A;  3FAT A;  1FBP A;  1NMU A;  5L9S A;  3S9L C;  4R2F A;  2HZL A;  3LBS A;  1B3F A;  5EYH A;  5LOM A;  2O6A A;  1EYK A;  1MPD A;  4THI A;  3MZ1 A;  5DT6 A;  4G8M A;  4NWD A;  2R6G E;  3IOU A;  4GRK A;  5H8S A;  2VT5 A;  4GWO A;  2YPN A;  3H6U A;  4GLI A;  4AS4 A;  3O6H A;  2WYP A;  4PAK A;  5H8F A;  3FUZ A;  1N7W A;  4H67 A;  1D9V A;  3QK6 A;  4ZED A;  3RPL B;  3A3U A;  2XX8 A;  3MWB A;  4MLV A;  2NVU B;  4RPO A;  2LAO A;  1URG A;  4DXC A;  5I56 A;  1NV3 A;  5CM6 A;  3UIF A;  5AA2 D;  4EQB A;  3FVK A;  4F29 A;  5KZT A;  4PFT A;  4LZ7 A;  3MW0 A;  3LSF B;  5DYH A;  5FHO A;  1IEJ A;  2VPO A;  3HHG A;  4MMP A;  5EQ8 A;  4O8M A;  2AL4 A;  2XX9 A;  1P1Q A;  1FTK A;  1UIU A;  5I57 B;  4IO5 A;  4IO7 A;  3R26 A;  3U92 A;  4FE8 A;  4UAC A;  1GV8 A;  2ANJ A;  5H8Q A;  3BFU A;  1SQY A;  3IL1 B;  1P1N A;  2GRV A;  5H8H A;  2R9J A;  2THI A;  5H8F B;  1B40 A;  3IO6 A;  3S2V A;  5CC2 A;  1TFD A;  1IMA A;  1FCK A;  2RC7 A;  4N8G A;  3G3I A;  1VFE A;  4I3E A;  1FQA A;  2VGQ A;  5JEI A;  4NF4 B;  3V83 A;  4JWO A;  5I56 B;  1DMB A;  4RXL A;  1Y1Z A;  3FVG A;  3TTL A;  4H46 A;  5FTI A;  2OLB A;  4QFO A;  1FBF A;  3E79 A;  3JZJ A;  4XKP A;  3LUZ A;  3TOD A;  3I3V A;  4M4G A;  3TAJ A;  1ZMG A;  4KYE A;  3K1P A;  3CFZ A;  3N5L A;  5ISU A;  1D3K A;  2XD3 A;  5H8Q B;  3ZS6 A;  1AIV A;  1Y9U A;  4X48 A;  2OK2 A;  3FXR A;  4IY6 A;  1SW1 A;  4AB5 A;  4PAI A;  1INP A;  2WYK A;  4GQO A;  1G0H A;  4PCD A;  3IFA A;  3CIJ A;  4BDQ A;  2FNC A;  3VLV A;  4LZ8 A;  2B4L A;  1FPL A;  1DCU A;  4TOZ A;  4AQ4 A;  1Q1K A;  3B7D A;  1NV7 A;  5LDZ A;  2B4M A;  3NOH A;  1M5F A;  3G3F A;  3TEL A;  3AXF A;  4G2Z A;  2XXX A;  3CR9 A;  1HSJ A;  2O68 A;  4BDN A;  4O3A A;  3WAF A;  1H43 A;  1MY4 A;  2VPN A;  1US4 A;  3M3F A;  4PFR A;  4NGU A;  3FAS A;  3PGF A;  3M8U A;  1YXI A;  1I6Q A;  3KJ7 A;  3RYD A;  2HPG A;  3H6V A;  3MBP A;  2V3Q A;  1POY 1;  4R6K A;  3IB1 A;  4KI0 E;  3G3J A;  1Y20 A;  1ZIU A;  2OWS A;  3U93 A;  4XKR A;  1BIY A;  3L6G A;  3IO4 A;  3O28 A;  3BFT A;  3GLB A;  4FBP A;  2Q74 A;  2UVH A;  3FJM A;  5FTH A;  1B3H A;  3USD A;  4MHF A;  3C34 A;  4QXD A;  4IO4 A;  3KN3 A;  1SW2 A; 
#chains in the Genus database with same CATH homology
 1FBE A;  2WBB A;  4HE1 A;  3KBZ A;  5FBP A;  1NUW A;  2HXR A;  4GWU A;  4JVD A;  4KXP A;  1FPK A;  3W9W A;  2Q8M A;  5EQ7 A;  2FIE A;  2F3B A;  2DE4 A;  5EYG A;  1FSA A;  2QVR A;  4NX1 A;  4PGN A;  1NI9 A;  3FXB A;  4N4U A;  1JP4 A;  4HCY A;  4PDD A;  4MCO A;  2L5V A;  4PDH A;  4YZZ A;  1K9Y A;  1FPG A;  2F5X A;  1NUY A;  4N6K A;  2P3V A;  2QVV A;  2PCR A;  1IMF A;  4UAB A;  1IMD A;  2XXK A;  2KR0 A;  4P1L A;  1AWB A;  4NN3 A;  4XF5 A;  2ZZX A;  1RDZ A;  4GBW A;  4GX3 A;  1FBC A;  4GWX A;  2PFZ A;  3KC1 A;  4OVP A;  2OX3 A;  2CZI A;  4GWW A;  2XWV A;  5IZ3 B;  1LBX A;  4X8R A;  4O94 A;  2KQZ A;  4PAF A;  4GX6 A;  1NUX A;  2XA5 A;  4X04 A;  1FJ9 A;  4GBV A;  1LBV A;  4O7I A;  4P56 A;  1VDW A;  3ROJ A;  4F19 A;  3MST A;  1CNQ A;  4NAP A;  3SZP A;  5ET8 A;  2WX9 A;  3KC0 A;  4H45 A;  2HHM A;  1FPI A;  3D1R A;  4G61 A;  4GWY A;  2OWZ A;  4XFE A;  4HE2 A;  4AS5 A;  1NV5 A;  3GYY A;  3RPL A;  4PBQ A;  1NV1 A;  2Q9T A;  4DI3 D;  4PC9 A;  2GQ1 A;  3HFU A;  2CZK A;  1RDX A;  3BIH A;  2V4C A;  5ET7 A;  5J1D A;  4N17 A;  2DDK A;  4JVI A;  5IM2 A;  4MEV A;  2F3D A;  4YIC A;  4PET A;  4PF6 A;  4LN5 A;  2DVZ A;  1LBZ A;  5EQ9 A;  1D9Q A;  4P3L A;  1LBW A;  5IZZ A;  4F18 A;  1FPE A;  1FBP A;  3W9V A;  3LV0 A;  1BK4 A;  2HZL A;  5T3J A;  3CHG A;  5EYH A;  2CEX A;  1FPD A;  2BJI A;  1EYK A;  1KA1 A;  1NV6 A;  1G0I A;  4OVQ A;  4MJO A;  3EKI A;  5I7I A;  2VT5 A;  4QBA A;  5F24 A;  2FHY A;  4AS4 A;  2WYP A;  4PAK A;  1IMB A;  4GX4 A;  2PFY A;  4OVS A;  4N81 A;  3RPL B;  2MKZ A;  1FTA A;  2WEF A;  2QPQ A;  5LTC A;  4N15 A;  1YZ0 A;  1NV3 A;  5CM6 A;  1KZ8 A;  4HE0 A;  1FPF A;  4P8B A;  3T1B A;  4OVR A;  2VPO A;  4MMP A;  4MNP A;  5EQ8 A;  1FBH A;  2ZZW A;  4O8M A;  4XEQ A;  4NF0 A;  1NV2 A;  1NV0 A;  3U65 A;  2DE3 A;  4GWS A;  4NG7 A;  4OAN A;  5DW8 A;  1FBD A;  1Q9D A;  3B8B A;  4GWZ A;  1EYJ A;  4I40 A;  1EYI A;  2XWO A;  1LBY A;  1YYZ A;  5IZ1 A;  1IMA A;  4N8G A;  5EQA A;  4NHB A;  2FVZ A;  4I3E A;  2WBD A;  4P9K A;  5IGA A;  3IFC A;  4MNC A;  5IZ3 A;  1NUZ A;  2CZH A;  2QFL A;  3T0J A;  4P1E A;  2QVU A;  1FRP A;  3B50 A;  4HCW A;  1NV4 A;  2HZK A;  4H46 A;  5JK4 A;  1KA0 A;  2R8T A;  1K9Z A;  1FBF A;  5A5L A;  3E79 A;  3LUZ A;  3FBP A;  4OVT A;  5I3S A;  3PTY A;  4MAG A;  1FPB A;  1XI6 A;  3QMF A;  1LEV A;  4DI4 B;  4NQ8 A;  3E78 A;  3MYU A;  4PAI A;  1INP A;  2FIX A;  2P3N A;  2CEY A;  4PBH A;  2WYK A;  1G0H A;  3IFA A;  4PCD A;  4M1V A;  4N91 A;  4I3Y A;  4F1V A;  2XWI A;  2B4L A;  4PTK A;  1FPL A;  1DCU A;  4MNI A;  1IME A;  5ET6 A;  2Y5K A;  4IR8 A;  1NV7 A;  5LDZ A;  1IMC A;  2B4M A;  3NOH A;  5ET5 A;  1DBZ A;  2FBP A;  4MIJ A;  4PFI A;  1FPJ A;  4F1U A;  1RDY A;  1SPI A;  4OA4 A;  1DK4 A;  2XWK A;  2VPN A;  3ISP A;  4PFR A;  4NGU A;  3A29 A;  4PE3 A;  1YXI A;  4X9T A;  4HXV A;  4N6D A;  4PF8 A;  1QGX A;  3RYD A;  5J16 A;  5ESY A;  2HPG A;  2V3Q A;  4N8Y A;  4O7M A;  2JJK A;  1FJ6 A;  2DE2 A;  2ZZV A;  4PGP A;  4JVC A;  4PFB A;  5I5P A;  4FBP A;  2Q74 A;  2Y5L A;  4MHF A;  3BIG A;  4MX6 A;  4QXD A;  1FBG A;  4P47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...