4GWUA

Crystal structure of fru 2,6-bisphosphate complexes of porcine liver fructose-1,6-bisphosphatase with filled central cavity
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
326
structure length
307
Chain Sequence
IVTLTRFVMEEGRKARGTGEMTQLLNSLCTAVKAIHRAVRKAKKLDVLSNDLVINVLKSSFATCVLVSEEDKNAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSIGTIFGIYRKNSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMVNGVNCFMYDPAIGEFILVDRDVKIKKKGSIYSINEGYAKEFDPAITEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFMYPANKKSPKGKLRLLYECNPMAYVMEKAGGLATTGKEAVLDIVPTDIHQRAPIILGSPEDVTELLEIYQKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Hydrophobic Central Cavity in Fructose-1,6-bisphosphatase is Essential for the Synergism in AMP/Fru 2,6-bisphosphate Inhibition
rcsb
source organism Sus scrofa
total genus 95
structure length 307
sequence length 326
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4gwuA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4gwuA02
1LBVA 1FTAA 1D9QA 4GWZA 1CNQA 1FBDA 5FBPA 1FPIA 1AWBA 3A29A 1FBHA 2FVZA 2QVUA 4GWSA 1EYJA 2Y5LA 1LEVA 4HXVA 3KC1A 4FBPA 2P3NA 3RPLA 1QGXA 1FBPA 1DCUA 1NV4A 1NI9A 3KC0A 3IFCA 2BJIA 4G61A 4HE2A 4I40A 1G0IA 3FBPA 4I3EA 2QVRA 1YXIA 1FBCA 1FPJA 1KA1A 1EYKA 2FHYA 5LDZA 1YYZA 1NUZA 2JJKA 4QXDA 2DDKA 1EYIA 1IMBA 5ET8A 3LUZA 4HE0A 1G0HA 5IZ1A 1INPA 2OX3A 4N81A 5EQ8A 1NV6A 1DK4A 2F3DA 5IZ3B 1FPFA 5EYGA 1K9ZA 1FPEA 1IMDA 1IMFA 1LBXA 5ET6A 1FPLA 4GWXA 1K9YA 1NUYA 1FJ9A 4H45A 4O7IA 2CZHA 1NUXA 1RDYA 4AS5A 2HHMA 5DW8A 2R8TA 5EQ9A 1FPGA 1SPIA 1LBZA 1IMAA 5EQ7A 3BIGA 5EQAA 5EYHA 1NV7A 1FPDA 2FIXA 1FRPA 3T0JA 3ROJA 1BK4A 1LBWA 3KBZA 1IMCA 4KXPA 1JP4A 3QMFA 1NV5A 1Q9DA 4AS4A 2CZIA 2QVVA 4GBVA 5ET5A 2FBPA 2FIEA 1FBEA 2Q8MA 1FBGA 2PCRA 4GWYA 2P3VA 1NV0A 3IFAA 1KZ8A 1FBFA 5ESYA 4GX3A 4MJOA 5IZ3A 1DBZA 3B8BA 1NUWA 2Y5KA 1RDXA 1FSAA 1VDWA 3LV0A 4I3YA 4GWUA 3RPLB 1KA0A 5T3JA 5I3SA 4H46A 2Q74A 5ET7A 2WBBA 1FJ6A 2VT5A 2OWZA 4GBWA 1IMEA 2WEFA 4PTKA 4GX4A 1FPBA 4IR8A 3BIHA 1RDZA 1NV2A 4HE1A 5J16A 2CZKA 4GWWA 2QFLA 2F3BA 1NV1A 2WBDA 1LBYA 1XI6A 4GX6A 1YZ0A 2GQ1A 3RYDA 5F24A 1FPKA 3D1RA 1NV3A 5A5LA
chains in the Genus database with same CATH superfamily
1FQDA 1UTBB 3DP6A 1FQBA 3KOTA 4F3BA 1SDXA 5I5PA 2Z8EA 3QUJA 4IY5A 3M8UA 2X7PA 5KCJA 4HE2A 3LSFB 4PFBA 3PU5A 4RJZA 3S9NC 3HHFA 2H9BA 2JJKA 1A8EA 2PT2A 5DT6A 4M4GA 5H8HA 3FIRA 4R6KA 1IMDA 1O63A 2VGQA 5I58B 5ICQA 1IZ1A 4O7IA 2WX9A 2XXVA 4GL0A 2R8TA 1IUDA 4NAPA 1AIVA 2DQVA 2QMXA 2QSXA 4XKRA 3ROJA 2HCAA 4NF5B 1SW1A 3ODBA 3T66A 3T9UA 5EYFA 2KQZA 4MIJA 4RXLA 4GWYA 4DXBA 1GR2A 2V3TA 2Q2AA 3MWBA 5IZ3A 1NUWA 5DVFA 1RDXA 2R71A 3IO6A 1PEBA 3ISPA 3HPIA 2VT5A 4NN3A 1M5EA 3RUMA 4OYVA 2F6GA 1D3KA 4YMAA 1Y1ZA 2DS9A 2ZYNA 1JEVA 3O97A 1UQWA 4LZ7A 1GV8A 1FQCA 1IEJA 4GWZA 1I69A 3FJMA 4DI4B 1AWBA 5A5XB 3PD9A 2XWKA 4GWOA 4X8RA 4Q8RA 1Y4CA 3TZAA 2YLNA 1JQFA 1QGXA 1DCUA 5FHOA 4AB6A 1P1UA 4H5FA 3KN7A 3FBPA 2GFEA 3N6UA 2KR0A 2BJJX 4P9KA 4H8JA 4OENA 4R6YA 2HFBA 1XS5A 3C33A 4LQ2A 3OEMA 1IXIA 1MY3A 3PUZE 1VSOA 3RNNA 5ELVA 3U65A 3Q26A 1WVJA 2UXAA 4GL8A 1HSJA 2DOJA 4U1OA 2RKMA 1R9QA 3FV1A 4FIMA 5HPQA 1J1NA 3IB0A 2P0SA 3IL1B 2NOOA 4OFLA 1MQHA 5ET5A 1M5DA 1PDAA 1FBGA 1ELJA 2OWSA 3RTWB 3E9XA 2DXYA 4RY1A 4OEVA 3PPRA 4I3YA 3UIFA 1R6ZA 3O9PA 5L8DA 5KCJB 3FVKA 2ONRA 4UABA 1Y20A 4PBHA 4MLQA 4GD5A 1USYH 4GX4A 2V84A 4I8CA 1NKXA 5CI5A 3CG1A 1T0KA 5H8HB 4R75A 1ZLQA 3CI8A 2E1SA 3UA8A 4L17A 1ZMGA 4HW8A 3H3GA 4BDOA 3A29A 4UA8A 4PF6A 1SVXB 3B50A 2OWTA 3DELB 2RINA 4X1BA 2O7IA 3PPQA 4I3EA 4ELRA 1MY0A 3PTYA 4DZ1A 2Q2CA 5HM4B 1SD3A 2FHYA 4NEDA 3U93A 5KDTA 4YAHX 1LSTA 4ZEBA 2F3DA 5IZ3B 2OLBA 3SESA 1TFDA 1PBPA 1FPLA 1ZJLA 3OO8A 1RDYA 3TEPA 3TUSA 4AB5A 1SW4A 1IMAA 1LFHA 5FHNA 1SW2A 2O7UA 4PFYA 3FVOA 2D5WA 2PBWA 2UVIA 4U23A 2FIEA 4BDNA 3VE1B 3KOSA 5AA4A 3U72A 3ZS6A 4KR5A 1ZBMA 4MJOA 4F2OA 2H5YA 3G3JA 4JVCA 1JEUA 4N8GA 3TMGA 2NVUB 3HHGA 4DCXA 4PETA 1FTLA 2O6AA 3RGYA 4LVQA 2XX9A 2CZKA 2HEUA 4PAFA 3FD3A 1MRPA 3JYRA 2XXTA 3UORA 2PFYA 4O3BA 2XWIA 5ITPA 1N7WA 3E4RA 4FJPA 2B3BA 2O1MA 1Q1KA 2G93A 1UTHA 4F1YA 1LLSA 3M3KA 3PPPA 4HXVA 3WAFA 3KC1A 4YKPA 2P3NA 3S9MC 1GTKA 1SQYA 3IFCA 2BJIA 4RK9A 4F22A 4GIZA 4OVJA 1IIWA 4FEBA 3PGFA 4DLDA 3VFJA 3FVNA 4MBPA 3O29A 2O69A 3ZKLA 3N94A 3SEUA 1QULA 2VD3A 1DK4A 3PPOA 5EYGA 2PX1A 1FPEA 4GWXA 2AL5A 3RQTA 4BDRA 2HHMA 4N4UA 5AE4A 4XFEA 5CBRA 2A5TA 1SYIA 1JW4A 5IAIA 3MVXA 4ZS9A 2QVVA 1MPDA 3Q27A 2A5SA 4NF4A 4OERA 4N6KA 2Q88A 3TTMA 3V8XB 2H98A 4OFOA 3IFAA 1Y4TA 4OVRA 3T9HB 5B7DA 1POY1 1FTJA 2OZZA 1A99A 4JBZA 2IEEA 1BP5A 1FSAA 2I6EA 4WKMA 4Q30B 4QSEA 4ZEIA 4QFKA 3OMBA 4DXCA 4IR8A 1LB8A 4P11A 5KDTB 1M5CA 4LN5A 3BFUA 1XI6A 3SKPA 3SEWA 1OVTA 2V4CA 5I58A 3S4UA 1JW5A 1FBHA 2Y5LA 2UYEA 3VXBA 2F34A 2FNCA 4F19A 4I40A 3PMWA 2REJA 4ELOA 3IR1A 1N76A 2QVRA 4PC9A 3THIA 4POWA 2QPQA 3RN8A 2DDKA 3MVYA 3R6UA 1LAFE 5AA4B 4P56A 1IXHA 4UACA 4N81A 1TWYA 2M8CA 3LSWA 1XOCA 1YPNA 3I6VA 1NUYA 4P8BA 3CFXA 1NUXA 1XVYA 3E3KA 4NF6A 4PGPA 1VFDA 3BIGA 4MAGA 2PVUA 3MSTA 3T0JA 3O66A 1XT8A 1TFAA 3KBZA 4KXPA 1B3HA 4FE8A 1FBEA 2B4MA 4GFRA 1MDP1 4F1VA 3RLFE 1UTHB 3O6IA 1Z7NE 4C1UA 3I5OA 2Z8FA 4IO3A 1B0LA 2XWVA 3MP6A 2OWZA 1GVCA 1I6BA 3IOTA 1NH8A 4GLIA 4RK2A 4YB6A 3VV5A 4EXKA 3ZKKA 4OTEA 4C0RA 4OZ9A 1QKBA 1B52A 3UN6A 3K2DA 4NHBA 2AL4A 3T1BA 2I49A 1FQFA 2F97A 3IOVA 3T22A 1BLFA 4F29A 1LEVA 4WEPA 3P7IA 4IO4A 3OEKA 1PBQA 1N84A 1NV4A 4G68C 2A5TB 2PYYA 5I84A 1N3XA 3MVZA 2UYFA 1FPJA 4R9GA 4NF4B 1P1NA 4THIA 4F3PA 2Q9TA 1DMBA 4F1UA 3K1MA 4KCDA 2XD2A 4YMBA 2ZYMA 1K9YA 2REGA 4O3AA 4QSDA 2V93A 1MDQA 1OQGA 1R9LA 4U1ZA 1JP4A 4G4PA 3S2VA 1I6QA 5CRYA 3UP9A 5DVJA 4XEQA 4DIGA 1MS7A 2I4CA 3C9HA 2F7BA 4RYAA 1O64A 2PCRA 4HCWA 4MF3A 1FBFA 3KBRA 3PUYE 3OOAA 1VDWA 1KA0A 4N15A 4N13A 2Q74A 3HSTA 4RPOA 2UVHA 3L6HA 4P47A 2YPNA 1B2HA 3RTFB 2DSFA 3AXFA 1B46A 1MY1A 4EUOA 1MG1A 5CMKA 3LC8A 2WBDA 1ZIUA 3KN8A 4KYSA 4NWCA 4O94A 2Y7IA 1MXYA 2XHDA 2Y7RA 5I57A 2ZMBA 1Y3QA 1B7ZA 3G7WA 1CNQA 4G77A 3VVDA 3N26A 4FATA 2MKZA 4NF6B 1LFIA 5TPAA 4MCOA 3MUQA 4IY6A 4H8IA 5AA2D 5BWJA 3CRBA 3KEIA 2DVCA 3BKIB 2ANJA 4F31B 3DLNA 2GHAA 3VVEA 2Y7WA 1LBCA 4RNSA 3USDA 4QRZA 1US5A 3W15C 4NF8A 1D9YA 1MXWA 4HCYA 1CE2A 2CZHA 4N6PA 4NTLA 1DSNA 3UGWA 1FPGA 1SPIA 4PE5B 4ELQA 3H03A 4G8HA 5EYHA 4X04A 3V83A 4ZZAA 2XXXA 2I58A 4OHNA 4OFJA 4U22A 2H99A 4YZZA 4GBVA 4ZEFA 1ATGA 4JDFA 4U21A 1S50A 1B1XA 2QMWA 2LAOA 3I3VA 3TCHA 3GBBA 3ZSFA 3KJTA 3E13X 1MQDA 5DYHA 5H8SA 3TTNA 4G8MA 3KSXA 3H6UA 4ZE8A 3TQLA 2D3IA 2F3BA 5L9OA 1LBYA 1EH3A 3LSXA 3MZ1A 1DTGA 1B0HA 5B70A 5A5LA 4E0XA 1MQGA 4LA9A 5ISUA 3TTKA 5FBPA 4YKJA 2PFZA 1OLCA 2FVZA 4LATA 4XKPA 4MFIA 4NG7A 3K01A 4G61A 5CMBA 4WXJA 1B3EA 3GLBA 2HAUA 3FVGA 2XX8A 1OIBA 5HBCA 3SEXA 2XWOA 2NUVA 2XXWA 4MLVA 5ET8A 4F3SA 3VLUA 2F7CA 2I3WA 4JWYA 3BFTA 3EPEA 3HCQA 1POTA 1A40A 1WDNA 2ESNA 3IAZA 1TXFA 5DW8A 1QVSA 5I59A 1IITA 1MXVA 5CC2A 3HV1A 1NV7A 5LOMA 3CFZA 2WYPA 3MPKA 1A55A 4YB7A 4DE8A 3VLVA 4ZZEA 2H25A 3TAJA 1P1OA 2DWHA 5I57B 3K6VA 1QJMA 1EZPA 4FECA 4KHZE 3GZGA 4QFLA 4H67A 3MPLA 2DWIA 3MAMA 5FTIA 1VE4A 2GHBA 3H06B 5TPAB 1DBZA 5KZTA 4ONYA 4KI0E 3A3CA 3SDFA 1NL5A 3BBRA 4U4XA 1RDZA 4HE1A 2Z8DA 2QFLA 1N0TA 3TFLA 4MNCA 4KQPA 1JW1A 2GQ1A 4NF8B 4PCDA 1FPKA 1FTKA 3C4MA 3TCFA 4EQ9A 4QFPA 4PFIA 3TTRA 4NQ8A 3K02A 5I2KB 1D9QA 1B7UA 4KYDA 2VPOA 4YICA 3MVWA 2CMOA 5CM6A 3C32A 4QFNA 3RPLA 1D4NA 4M1VA 1A8FA 2OPDA 2F7AA 3H6VA 5I7IA 4PFTA 1UIUA 2W7YA 5LDZA 1B3LA 2Y84A 3CHGA 3G3KA 4PDHA 3U92A 4N91A 3OO6A 3PUWE 1IMFA 5ET6A 1H44A 2HXWA 2RCBA 1LAXA 2FYIA 1B58A 3F11A 5EHMA 1N7XA 4WEDA 1A54A 4N17A 4ESXA 1JNFA 1WODA 1B32A 3C35A 2XXYA 4OVTA 4DDDA 1B3FA 5CMMA 3H4ZA 4BDQA 4EQ7A 3OXNA 3TODA 3S9LC 2OK2A 3GYYA 4TQUQ 4I9DA 2CZLA 1S7YA 3RT6B 1F9BA 3R26A 1BTJA 4XKNA 1LGBC 3OO9A 1ANFA 2VHAA 3DM0A 3TTLA 1IMEA 4H0WA 1FPBA 3M3FA 4OVQA 4GWWA 1B3GA 2OJTA 3FASA 2QS3A 1Y3NA 4LP2B 1YCJA 3FZVA 3S9EA 5F24A 1NNPA 2IA4A 2O51A 2NXOA 4X1DA 2F6PA 1NV3A 2AYSA 2QRYA 4QHQA 2XXUA 3TYHA 4JWXA 5I59B 2O1LA 2OPEA 4ZE9A 2QVUA 1P99A 5F1QA 1MXUA 1VR5A 1EZ9A 4O8MA 1QKAA 1MM7A 4PFRA 4YKKA 2DWJA 2I0BA 4TLMB 1EYKA 4NF0A 4OQOA 1SBPA 2XXIA 2P2AA 1JVXA 4R2BA 4MX6A 3PV0E 4NX1A 1H3DA 1HSLA 3O6HA 3KFMA 3C34A 4OMBA 2UVJA 2RC9A 4GOTA 4DCYA 5BUUA 1MQJA 3LR1A 1URGA 4PAKA 4PAIA 2X7QA 4NGUA 4R9FA 1FPDA 1N3WA 2DE3A 2UVGA 3EHUA 1BK4A 2QJEA 1PB9A 3MZBA 5F7VA 2DE4A 2FBPA 3E78A 3PMVA 4K3FA 3JV9A 2WYKA 5H8QA 4QF9A 4GXAA 4IGRA 3RPLB 4JB7A 4QBAA 3A3UA 1LCFA 2XXPA 4KYEA 1L5TA 4O3CA 5IGAA 3Q29A 4GXSB 1PB8A 2DXRA 4ZECA 3EKIA 4NE4A 3W9VA 3IORA 2P1SA 4X48A 2I48A 1MXZA 3IB2A 3MC2A 4PGNA 2OCUA 1LB9A 4YKIA 1FBPA 1NI9A 3KC0A 2ZYKA 3B6QA 3CSGA 3O28A 3DP8A 2V25A 3CFLA 2O84X 4P1EA 1YYZA 3FXBA 1EYIA 5TU0A 4TLLB 4OA4A 3PPNA 4FEDA 4NWDA 4HE0A 1G0HA 2OX3A 2HPGA 1N04A 5H8FA 1ZTYA 1LBXA 3Q25A 3PMXA 3R7XA 1FJ9A 3ILTB 4QSCA 2F78A 3B7DA 4PQJA 3CSBA 1Z7ME 1M5FA 1AOVA 4R72A 3H6WA 1B4ZA 2ALUA 4IO7A 3T96B 1GGGA 5IM2A 3FGSA 1IMCA 1UIVA 2I3VA 3QMFA 4AS4A 4EF1A 1MH4A 3KG2A 1NV0A 1H45A 2XD3A 4H6DA 4XKQA 4KD5A 5FTHA 4GWUA 1PB7A 3W9WA 3K6UA 3MYUA 3SEYA 3QK6A 4OANA 2HZKA 4GBWA 1D9VA 1JETA 3C36A 1SW5A 4EQBA 5AA1A 2G29A 2RC7A 1QUJA 4ZEDA 3RYDA 3D1RA 2WKYA 3IJXB 1B9JA 1LBVA 1FBDA 3KN3A 1NNFA 2PMSA 1FPIA 3PUXE 2Z22A 2CEXA 5DVIA 2HQ0A 4X9TA 1MH3A 2PT1A 5I2NA 4JXIA 1YXIA 4GVOA 1Q35A 4QXDA 5DEXA 4NMYA 2F35A 4MNPA 1O7TA 5H8QB 3E79A 1URSA 3QIMA 1B05A 2ZXTA 1NMUA 5IZZA 1M5BA 3IJOB 4P3LA 3FXQA 4LONB 5EQAA 2X26A 3N5LA 2THIA 3MP1A 3K4UA 2ZZVA 5IKBA 4Z7EA 5H8NA 2OBGA 4DI3D 1NFTA 3HO7A 5I2KA 4E0WA 1KZ8A 4LZ8A 3MP8A 1TT1A 2QS4A 3B6WA 5ESYA 1BIYA 3LSLA 3G3FA 2Y7KA 3LV0A 4R2FA 2ONSA 1FJ6A 2FA7A 2ZNSA 3OD7A 3PD8A 4QFOA 3U1OA 2F8DA 4PE3A 3N6TA 3OELA 1NV1A 3CIJA 4G8NA 1SI1A 3EHSA 5H8FB 2QL3A 3FJ7A 3KSJA 4MH5A 4OETA 2RCAA 1MPCA 1B4HA 3LBSA 5LTCA 4GWSA 4PF8A 4IO6A 4I1DA 1B5IA 4BDMA 3FXUA 4H1XA 2V3QA 4ND9A 5AA2A 5I56A 1FBCA 1LFGA 3A09A 4G2ZA 1IMBA 4TOZA 3LUZA 2AIXA 5IZ1A 1INPA 3RPWA 1FPFA 1B6HA 2L5VA 3MBPA 4P0GA 3U94A 3IO4A 3VDFA 1Y1MA 5J1DA 1ZU0A 4MNIA 3OENA 3IX1A 5EQ9A 1YTVA 2O68A 3IOUA 3H7MA 4O7MA 1I6AA 1NH7A 4KCCA 3SZPA 1FRPA 4FORA 3VLWA 4Q0CA 1OQHA 4EF2A 3GBAA 3ILUB 1IXGA 4P1LA 2CZIA 1HSEA 2QS2A 2XA5A 4XTCQ 3QSLA 4DXUA 2Q8MA 2R6GE 4JSDA 2P3VA 3WAEA 3FUZA 1QW0A 1P1WA 2Q8JA 4F2QA 1XHYA 1P1QA 1EZOA 5T3JA 5I3SA 4OVSA 1URDA 5ET7A 1LAGE 2WBBA 5I2NB 3O2AA 1DPPA 3TELA 2DE2A 5DEXB 1CB6A 2HXRA 4IO2A 4F18A 4LZ5A 4XF5A 1IXCA 1YZ0A 2VPNA 4G68A 1DTZA 1B5HA 5ITOA 1FQEA 2H4IA 5TP9A 1FTAA 2RC8A 4BLAA 3K6XA 1II5A 3SEVA 1SYHA 1PC3A 4U2RA 5H8NB 4OVPA 3G3HA 1MY4A 1R1NA 3MZ9A 4H65A 4FAJA 1XC1A 3V5AA 1ZKBA 5EQ8A 1OLAA 3KGCA 2ZZXA 4HS7A 3U8QA 3K1PA 3CR9A 5DTBA 3TDJA 2XXHA 4ISUA 2YJPA 2I0CA 3Q28A 2Z23A 2B3FA 1VFEA 1SI0A 1Y9UA 2FIXA 3OO7A 4KFQA 1LAHE 2DYXA 4ECFA 3T9XB 3HN0A 5AA3A 3C31A 4LUBA 2V3UA 3SETA 3QXMA 4YU0A 4IB2A 3ECRA 3EN3A 3IOWA 3IK6B 1B5JA 1B1HA 3M3LA 4GX3A 2XX7A 3LUYA 2VD2A 4ZEKA 5EHSA 1OMPA 4JSOA 4GRKA 3QYTA 5AA2B 4PTKA 2B4LA 4R6HA 5I56B 3ONMA 3BIHA 5M2VA 4ELPA 4PBQA 5CBSA 3KZGA 4XIGQ 1IQ7A 4GX6A 1H76A 2I4BA 3TPAA 4H5GA 3K0VA 4MMPA 3FJGA 3HFUA 1LCTA 4FBPA 4MEVA 3K6WA 3CG3A 3K00A 1AH5A 3OSQA 4I62A 5JTYA 2QS1A 1B40A 1NUZA 5FHMA 1LBBA 1NNKA 5JEIA 4U4SA 1FQAA 4PFWA 3RY3A 1K9ZA 4LQ5A 2F36A 4C1TA 4Z0IA 1FW0A 4H45A 1UTBA 4KPTA 2NWJA 4AS5A 2GRVA 3PUVE 3CVGA 4PP0A 1QUIA 4N8YA 2KLFA 2GH9A 1AMFA 4JVDA 2E0SA 1RKMA 1LBWA 4BDLA 3L6GA 4XXUA 3VXCA 3O6GA 4G68B 3UK4A 1FCKA 3IB1A 5TP9B 4GQOA 5CMCA 4EXLA 4R74A 3MJNA 4JWOA 2XXQA 2VP1A 4R73A 3NOHA 4H46A 4MHFA 4IGTA 1MY2A 4JVIA 2CEYA 3FV2A 2ZYOA 3MQ9A 4N07A 4ZDMA 3GXAA 1NV2A 5J16A 4NF5A 3JZJA 1USYE 4P0IA 5K2XA 4PDDA 2VOZA 3V89B 1S9TA 4F39A 2ZNTA 2DWAA 4OWDA 4F3GA 1MPBA 4POXA 1A7LA 2Y7PA 1EYJA 5L9SA 4OXVA 1YAEA 3EQ1A 1BKAA 3VVFA 1FTMA 5JK4A 5ICTA 3QAXA 3G3GA 1MXXA 3TCGA 1G0IA 4YB5A 3RT8A 3FXRA 1NNTA 1DPEA 1AL3A 3FATA 1KA1A 1MQIA 2D21A 2F5XA 2ZZWA 4RA1A 4OEUA 1B7HA 3EF7A 4HTGA 3T93B 1H43A 1NV6A 2ZNUA 3SERA 1XVXA 1OVBA 4EDPA 2DVZA 2ONKE 1QUKA 3QUFA 5A5XA 3D4GA 1LBZA 1FTOA 2DP8A 2B65A 5EQ7A 3H6TA 4RPNA 1DOTA 3D4CA 4N6DA 3TKDA 1KWHA 1B51A 5L9MA 4IO5A 2Q89A 1NV5A 1Q9DA 3KJ7A 3K1NA 1US4A 2RF1A 3G3IA 1RYXA 2HAVA 2HZLA 3T9VA 3B8BA 3MW0A 1JVYA 2Y5KA 1MM6A 4OESA 2R9JA 4PFUA 2WEFA 5JTYB 2XXKA 4Q5TA 3OSRA 3EHTA 3DP4A 1EU8A 4AQ4A 1Y3PA 4GF8A 3TQWA 1RYOA 2ABHA 3B6TA 5K2YA 4ESWA 2XXRA
chains in the Genus database with same CATH topology
4NQ8A 1D9QA 2VPOA 4YICA 5I5PA 1FBHA 5LTCA 4GWSA 4PF8A 2Y5LA 5CM6A 3RPLA 4F19A 4M1VA 4I40A 4HE2A 2V3QA 4PFBA 2QVRA 4PC9A 1FBCA 5I7IA 5LDZA 2JJKA 2QPQA 2DDKA 1IMBA 3LUZA 4P56A 3CHGA 5IZ1A 1INPA 4PDHA 4N81A 4N91A 1FPFA 2L5VA 1IMDA 1IMFA 5ET6A 1NUYA 4O7IA 2WX9A 4P8BA 5J1DA 1NUXA 4MNIA 2R8TA 5EQ9A 4PGPA 4NAPA 4O7MA 4N17A 3BIGA 4MAGA 3SZPA 1FRPA 3MSTA 3T0JA 3ROJA 4OVTA 3KBZA 4KXPA 4P1LA 2CZIA 2XA5A 2KQZA 4MIJA 1FBEA 2Q8MA 2B4MA 4GWYA 3GYYA 2P3VA 4F1VA 5IZ3A 1NUWA 1RDXA 5T3JA 5I3SA 4OVSA 5ET7A 2WBBA 3ISPA 2VT5A 4NN3A 2XWVA 2OWZA 1IMEA 1FPBA 2DE2A 4OVQA 4GWWA 2HXRA 4F18A 4XF5A 1YZ0A 2VPNA 5F24A 4NHBA 3T1BA 1NV3A 1FTAA 4GWZA 4DI4B 1AWBA 2XWKA 2QVUA 4X8RA 1LEVA 1QGXA 4O8MA 1DCUA 1NV4A 4PFRA 3FBPA 4OVPA 2KR0A 1FPJA 4P9KA 1EYKA 4NF0A 4MX6A 4NX1A 2Q9TA 5EQ8A 4F1UA 2ZZXA 1K9YA 3U65A 4PAKA 4PAIA 4NGUA 1FPDA 2FIXA 2DE3A 1BK4A 1JP4A 4XEQA 5ET5A 2DE4A 2FBPA 3E78A 1FBGA 2PCRA 4HCWA 1FBFA 4GX3A 2WYKA 1VDWA 4I3YA 3RPLB 4QBAA 1KA0A 4N15A 2Q74A 4UABA 4PBHA 4PTKA 4P47A 2B4LA 4GX4A 5IGAA 3BIHA 4PBQA 3EKIA 2WBDA 3W9VA 4GX6A 4O94A 1CNQA 4MMPA 3A29A 2MKZA 4PF6A 3HFUA 4MCOA 4PGNA 3B50A 4FBPA 4MEVA 1FBPA 1NI9A 3KC0A 4I3EA 3PTYA 2FHYA 4P1EA 1YYZA 1NUZA 3FXBA 1EYIA 4OA4A 4HE0A 1G0HA 2OX3A 2HPGA 2F3DA 5IZ3B 1K9ZA 1LBXA 1FPLA 4HCYA 1FJ9A 4H45A 2CZHA 1RDYA 4AS5A 1FPGA 1SPIA 1IMAA 4N8YA 5EYHA 4X04A 4JVDA 1LBWA 5IM2A 1IMCA 4YZZA 3QMFA 4AS4A 4GBVA 2FIEA 1NV0A 4MJOA 4GWUA 3NOHA 4JVCA 3W9WA 4H46A 4N8GA 4MHFA 3MYUA 4OANA 2HZKA 4GBWA 4JVIA 4PETA 2CEYA 1NV2A 5J16A 2CZKA 4PAFA 2F3BA 1LBYA 2PFYA 4PDDA 3RYDA 3D1RA 5A5LA 1LBVA 2XWIA 1FBDA 5FBPA 1FPIA 2PFZA 2CEXA 2FVZA 1EYJA 4HXVA 3KC1A 4X9TA 2P3NA 4NG7A 5JK4A 4G61A 3IFCA 2BJIA 1G0IA 1YXIA 1KA1A 4QXDA 2F5XA 2ZZWA 2XWOA 5ET8A 4MNPA 1NV6A 1DK4A 5EYGA 1FPEA 3E79A 4GWXA 5IZZA 2DVZA 2HHMA 4N4UA 5DW8A 4XFEA 1LBZA 4P3LA 5EQ7A 5EQAA 1NV7A 4N6DA 2WYPA 2ZZVA 4DI3D 1NV5A 1Q9DA 2QVVA 4N6KA 3IFAA 1KZ8A 2HZLA 4OVRA 5ESYA 1DBZA 3B8BA 2Y5KA 1FSAA 3LV0A 1FJ6A 2WEFA 2XXKA 4IR8A 1RDZA 4HE1A 4PE3A 2QFLA 4LN5A 1NV1A 1XI6A 4MNCA 2GQ1A 4PCDA 1FPKA 4PFIA 2V4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBV A;  1FTA A;  1D9Q A;  4GWZ A;  1CNQ A;  1FBD A;  5FBP A;  1FPI A;  1AWB A;  3A29 A;  1FBH A;  2FVZ A;  2QVU A;  4GWS A;  1EYJ A;  2Y5L A;  1LEV A;  4HXV A;  3KC1 A;  4FBP A;  2P3N A;  3RPL A;  1QGX A;  1FBP A;  1DCU A;  1NV4 A;  1NI9 A;  3KC0 A;  3IFC A;  2BJI A;  4G61 A;  4HE2 A;  4I40 A;  1G0I A;  3FBP A;  4I3E A;  2QVR A;  1YXI A;  1FBC A;  1FPJ A;  1KA1 A;  1EYK A;  2FHY A;  5LDZ A;  1YYZ A;  1NUZ A;  2JJK A;  4QXD A;  2DDK A;  1EYI A;  1IMB A;  5ET8 A;  3LUZ A;  4HE0 A;  1G0H A;  5IZ1 A;  1INP A;  2OX3 A;  4N81 A;  5EQ8 A;  1NV6 A;  1DK4 A;  2F3D A;  5IZ3 B;  1FPF A;  5EYG A;  1K9Z A;  1FPE A;  1IMD A;  1IMF A;  1LBX A;  5ET6 A;  1FPL A;  4GWX A;  1K9Y A;  1NUY A;  1FJ9 A;  4H45 A;  4O7I A;  2CZH A;  1NUX A;  1RDY A;  4AS5 A;  2HHM A;  5DW8 A;  2R8T A;  5EQ9 A;  1FPG A;  1SPI A;  1LBZ A;  1IMA A;  5EQ7 A;  3BIG A;  5EQA A;  5EYH A;  1NV7 A;  1FPD A;  2FIX A;  1FRP A;  3T0J A;  3ROJ A;  1BK4 A;  1LBW A;  3KBZ A;  1IMC A;  4KXP A;  1JP4 A;  3QMF A;  1NV5 A;  1Q9D A;  4AS4 A;  2CZI A;  2QVV A;  4GBV A;  5ET5 A;  2FBP A;  2FIE A;  1FBE A;  2Q8M A;  1FBG A;  2PCR A;  4GWY A;  2P3V A;  1NV0 A;  3IFA A;  1KZ8 A;  1FBF A;  5ESY A;  4GX3 A;  4MJO A;  5IZ3 A;  1DBZ A;  3B8B A;  1NUW A;  2Y5K A;  1RDX A;  1FSA A;  1VDW A;  3LV0 A;  4I3Y A;  4GWU A;  3RPL B;  1KA0 A;  5T3J A;  5I3S A;  4H46 A;  2Q74 A;  5ET7 A;  2WBB A;  1FJ6 A;  2VT5 A;  2OWZ A;  4GBW A;  1IME A;  2WEF A;  4PTK A;  4GX4 A;  1FPB A;  4IR8 A;  3BIH A;  1RDZ A;  1NV2 A;  4HE1 A;  5J16 A;  2CZK A;  4GWW A;  2QFL A;  2F3B A;  1NV1 A;  2WBD A;  1LBY A;  1XI6 A;  4GX6 A;  1YZ0 A;  2GQ1 A;  3RYD A;  5F24 A;  1FPK A;  3D1R A;  1NV3 A;  5A5L A; 
#chains in the Genus database with same CATH topology
 1FQD A;  1UTB B;  3DP6 A;  1FQB A;  3KOT A;  4F3B A;  1SDX A;  5I5P A;  2Z8E A;  3QUJ A;  4IY5 A;  3M8U A;  2X7P A;  5KCJ A;  4HE2 A;  3LSF B;  4PFB A;  3PU5 A;  4RJZ A;  3S9N C;  3HHF A;  2H9B A;  2JJK A;  1A8E A;  2PT2 A;  5DT6 A;  4M4G A;  5H8H A;  3FIR A;  4R6K A;  1IMD A;  1O63 A;  2VGQ A;  5I58 B;  5ICQ A;  1IZ1 A;  4O7I A;  2WX9 A;  2XXV A;  4GL0 A;  2R8T A;  1IUD A;  4NAP A;  1AIV A;  2DQV A;  2QMX A;  2QSX A;  4XKR A;  3ROJ A;  2HCA A;  4NF5 B;  1SW1 A;  3ODB A;  3T66 A;  3T9U A;  5EYF A;  2KQZ A;  4MIJ A;  4RXL A;  4GWY A;  4DXB A;  1GR2 A;  2V3T A;  2Q2A A;  3MWB A;  5IZ3 A;  1NUW A;  5DVF A;  1RDX A;  2R71 A;  3IO6 A;  1PEB A;  3ISP A;  3HPI A;  2VT5 A;  4NN3 A;  1M5E A;  3RUM A;  4OYV A;  2F6G A;  1D3K A;  4YMA A;  1Y1Z A;  2DS9 A;  2ZYN A;  1JEV A;  3O97 A;  1UQW A;  4LZ7 A;  1GV8 A;  1FQC A;  1IEJ A;  4GWZ A;  1I69 A;  3FJM A;  4DI4 B;  1AWB A;  5A5X B;  3PD9 A;  2XWK A;  4GWO A;  4X8R A;  4Q8R A;  1Y4C A;  3TZA A;  2YLN A;  1JQF A;  1QGX A;  1DCU A;  5FHO A;  4AB6 A;  1P1U A;  4H5F A;  3KN7 A;  3FBP A;  2GFE A;  3N6U A;  2KR0 A;  2BJJ X;  4P9K A;  4H8J A;  4OEN A;  4R6Y A;  2HFB A;  1XS5 A;  3C33 A;  4LQ2 A;  3OEM A;  1IXI A;  1MY3 A;  3PUZ E;  1VSO A;  3RNN A;  5ELV A;  3U65 A;  3Q26 A;  1WVJ A;  2UXA A;  4GL8 A;  1HSJ A;  2DOJ A;  4U1O A;  2RKM A;  1R9Q A;  3FV1 A;  4FIM A;  5HPQ A;  1J1N A;  3IB0 A;  2P0S A;  3IL1 B;  2NOO A;  4OFL A;  1MQH A;  5ET5 A;  1M5D A;  1PDA A;  1FBG A;  1ELJ A;  2OWS A;  3RTW B;  3E9X A;  2DXY A;  4RY1 A;  4OEV A;  3PPR A;  4I3Y A;  3UIF A;  1R6Z A;  3O9P A;  5L8D A;  5KCJ B;  3FVK A;  2ONR A;  4UAB A;  1Y20 A;  4PBH A;  4MLQ A;  4GD5 A;  1USY H;  4GX4 A;  2V84 A;  4I8C A;  1NKX A;  5CI5 A;  3CG1 A;  1T0K A;  5H8H B;  4R75 A;  1ZLQ A;  3CI8 A;  2E1S A;  3UA8 A;  4L17 A;  1ZMG A;  4HW8 A;  3H3G A;  4BDO A;  3A29 A;  4UA8 A;  4PF6 A;  1SVX B;  3B50 A;  2OWT A;  3DEL B;  2RIN A;  4X1B A;  2O7I A;  3PPQ A;  4I3E A;  4ELR A;  1MY0 A;  3PTY A;  4DZ1 A;  2Q2C A;  5HM4 B;  1SD3 A;  2FHY A;  4NED A;  3U93 A;  5KDT A;  4YAH X;  1LST A;  4ZEB A;  2F3D A;  5IZ3 B;  2OLB A;  3SES A;  1TFD A;  1PBP A;  1FPL A;  1ZJL A;  3OO8 A;  1RDY A;  3TEP A;  3TUS A;  4AB5 A;  1SW4 A;  1IMA A;  1LFH A;  5FHN A;  1SW2 A;  2O7U A;  4PFY A;  3FVO A;  2D5W A;  2PBW A;  2UVI A;  4U23 A;  2FIE A;  4BDN A;  3VE1 B;  3KOS A;  5AA4 A;  3U72 A;  3ZS6 A;  4KR5 A;  1ZBM A;  4MJO A;  4F2O A;  2H5Y A;  3G3J A;  4JVC A;  1JEU A;  4N8G A;  3TMG A;  2NVU B;  3HHG A;  4DCX A;  4PET A;  1FTL A;  2O6A A;  3RGY A;  4LVQ A;  2XX9 A;  2CZK A;  2HEU A;  4PAF A;  3FD3 A;  1MRP A;  3JYR A;  2XXT A;  3UOR A;  2PFY A;  4O3B A;  2XWI A;  5ITP A;  1N7W A;  3E4R A;  4FJP A;  2B3B A;  2O1M A;  1Q1K A;  2G93 A;  1UTH A;  4F1Y A;  1LLS A;  3M3K A;  3PPP A;  4HXV A;  3WAF A;  3KC1 A;  4YKP A;  2P3N A;  3S9M C;  1GTK A;  1SQY A;  3IFC A;  2BJI A;  4RK9 A;  4F22 A;  4GIZ A;  4OVJ A;  1IIW A;  4FEB A;  3PGF A;  4DLD A;  3VFJ A;  3FVN A;  4MBP A;  3O29 A;  2O69 A;  3ZKL A;  3N94 A;  3SEU A;  1QUL A;  2VD3 A;  1DK4 A;  3PPO A;  5EYG A;  2PX1 A;  1FPE A;  4GWX A;  2AL5 A;  3RQT A;  4BDR A;  2HHM A;  4N4U A;  5AE4 A;  4XFE A;  5CBR A;  2A5T A;  1SYI A;  1JW4 A;  5IAI A;  3MVX A;  4ZS9 A;  2QVV A;  1MPD A;  3Q27 A;  2A5S A;  4NF4 A;  4OER A;  4N6K A;  2Q88 A;  3TTM A;  3V8X B;  2H98 A;  4OFO A;  3IFA A;  1Y4T A;  4OVR A;  3T9H B;  5B7D A;  1POY 1;  1FTJ A;  2OZZ A;  1A99 A;  4JBZ A;  2IEE A;  1BP5 A;  1FSA A;  2I6E A;  4WKM A;  4Q30 B;  4QSE A;  4ZEI A;  4QFK A;  3OMB A;  4DXC A;  4IR8 A;  1LB8 A;  4P11 A;  5KDT B;  1M5C A;  4LN5 A;  3BFU A;  1XI6 A;  3SKP A;  3SEW A;  1OVT A;  2V4C A;  5I58 A;  3S4U A;  1JW5 A;  1FBH A;  2Y5L A;  2UYE A;  3VXB A;  2F34 A;  2FNC A;  4F19 A;  4I40 A;  3PMW A;  2REJ A;  4ELO A;  3IR1 A;  1N76 A;  2QVR A;  4PC9 A;  3THI A;  4POW A;  2QPQ A;  3RN8 A;  2DDK A;  3MVY A;  3R6U A;  1LAF E;  5AA4 B;  4P56 A;  1IXH A;  4UAC A;  4N81 A;  1TWY A;  2M8C A;  3LSW A;  1XOC A;  1YPN A;  3I6V A;  1NUY A;  4P8B A;  3CFX A;  1NUX A;  1XVY A;  3E3K A;  4NF6 A;  4PGP A;  1VFD A;  3BIG A;  4MAG A;  2PVU A;  3MST A;  3T0J A;  3O66 A;  1XT8 A;  1TFA A;  3KBZ A;  4KXP A;  1B3H A;  4FE8 A;  1FBE A;  2B4M A;  4GFR A;  1MDP 1;  4F1V A;  3RLF E;  1UTH B;  3O6I A;  1Z7N E;  4C1U A;  3I5O A;  2Z8F A;  4IO3 A;  1B0L A;  2XWV A;  3MP6 A;  2OWZ A;  1GVC A;  1I6B A;  3IOT A;  1NH8 A;  4GLI A;  4RK2 A;  4YB6 A;  3VV5 A;  4EXK A;  3ZKK A;  4OTE A;  4C0R A;  4OZ9 A;  1QKB A;  1B52 A;  3UN6 A;  3K2D A;  4NHB A;  2AL4 A;  3T1B A;  2I49 A;  1FQF A;  2F97 A;  3IOV A;  3T22 A;  1BLF A;  4F29 A;  1LEV A;  4WEP A;  3P7I A;  4IO4 A;  3OEK A;  1PBQ A;  1N84 A;  1NV4 A;  4G68 C;  2A5T B;  2PYY A;  5I84 A;  1N3X A;  3MVZ A;  2UYF A;  1FPJ A;  4R9G A;  4NF4 B;  1P1N A;  4THI A;  4F3P A;  2Q9T A;  1DMB A;  4F1U A;  3K1M A;  4KCD A;  2XD2 A;  4YMB A;  2ZYM A;  1K9Y A;  2REG A;  4O3A A;  4QSD A;  2V93 A;  1MDQ A;  1OQG A;  1R9L A;  4U1Z A;  1JP4 A;  4G4P A;  3S2V A;  1I6Q A;  5CRY A;  3UP9 A;  5DVJ A;  4XEQ A;  4DIG A;  1MS7 A;  2I4C A;  3C9H A;  2F7B A;  4RYA A;  1O64 A;  2PCR A;  4HCW A;  4MF3 A;  1FBF A;  3KBR A;  3PUY E;  3OOA A;  1VDW A;  1KA0 A;  4N15 A;  4N13 A;  2Q74 A;  3HST A;  4RPO A;  2UVH A;  3L6H A;  4P47 A;  2YPN A;  1B2H A;  3RTF B;  2DSF A;  3AXF A;  1B46 A;  1MY1 A;  4EUO A;  1MG1 A;  5CMK A;  3LC8 A;  2WBD A;  1ZIU A;  3KN8 A;  4KYS A;  4NWC A;  4O94 A;  2Y7I A;  1MXY A;  2XHD A;  2Y7R A;  5I57 A;  2ZMB A;  1Y3Q A;  1B7Z A;  3G7W A;  1CNQ A;  4G77 A;  3VVD A;  3N26 A;  4FAT A;  2MKZ A;  4NF6 B;  1LFI A;  5TPA A;  4MCO A;  3MUQ A;  4IY6 A;  4H8I A;  5AA2 D;  5BWJ A;  3CRB A;  3KEI A;  2DVC A;  3BKI B;  2ANJ A;  4F31 B;  3DLN A;  2GHA A;  3VVE A;  2Y7W A;  1LBC A;  4RNS A;  3USD A;  4QRZ A;  1US5 A;  3W15 C;  4NF8 A;  1D9Y A;  1MXW A;  4HCY A;  1CE2 A;  2CZH A;  4N6P A;  4NTL A;  1DSN A;  3UGW A;  1FPG A;  1SPI A;  4PE5 B;  4ELQ A;  3H03 A;  4G8H A;  5EYH A;  4X04 A;  3V83 A;  4ZZA A;  2XXX A;  2I58 A;  4OHN A;  4OFJ A;  4U22 A;  2H99 A;  4YZZ A;  4GBV A;  4ZEF A;  1ATG A;  4JDF A;  4U21 A;  1S50 A;  1B1X A;  2QMW A;  2LAO A;  3I3V A;  3TCH A;  3GBB A;  3ZSF A;  3KJT A;  3E13 X;  1MQD A;  5DYH A;  5H8S A;  3TTN A;  4G8M A;  3KSX A;  3H6U A;  4ZE8 A;  3TQL A;  2D3I A;  2F3B A;  5L9O A;  1LBY A;  1EH3 A;  3LSX A;  3MZ1 A;  1DTG A;  1B0H A;  5B70 A;  5A5L A;  4E0X A;  1MQG A;  4LA9 A;  5ISU A;  3TTK A;  5FBP A;  4YKJ A;  2PFZ A;  1OLC A;  2FVZ A;  4LAT A;  4XKP A;  4MFI A;  4NG7 A;  3K01 A;  4G61 A;  5CMB A;  4WXJ A;  1B3E A;  3GLB A;  2HAU A;  3FVG A;  2XX8 A;  1OIB A;  5HBC A;  3SEX A;  2XWO A;  2NUV A;  2XXW A;  4MLV A;  5ET8 A;  4F3S A;  3VLU A;  2F7C A;  2I3W A;  4JWY A;  3BFT A;  3EPE A;  3HCQ A;  1POT A;  1A40 A;  1WDN A;  2ESN A;  3IAZ A;  1TXF A;  5DW8 A;  1QVS A;  5I59 A;  1IIT A;  1MXV A;  5CC2 A;  3HV1 A;  1NV7 A;  5LOM A;  3CFZ A;  2WYP A;  3MPK A;  1A55 A;  4YB7 A;  4DE8 A;  3VLV A;  4ZZE A;  2H25 A;  3TAJ A;  1P1O A;  2DWH A;  5I57 B;  3K6V A;  1QJM A;  1EZP A;  4FEC A;  4KHZ E;  3GZG A;  4QFL A;  4H67 A;  3MPL A;  2DWI A;  3MAM A;  5FTI A;  1VE4 A;  2GHB A;  3H06 B;  5TPA B;  1DBZ A;  5KZT A;  4ONY A;  4KI0 E;  3A3C A;  3SDF A;  1NL5 A;  3BBR A;  4U4X A;  1RDZ A;  4HE1 A;  2Z8D A;  2QFL A;  1N0T A;  3TFL A;  4MNC A;  4KQP A;  1JW1 A;  2GQ1 A;  4NF8 B;  4PCD A;  1FPK A;  1FTK A;  3C4M A;  3TCF A;  4EQ9 A;  4QFP A;  4PFI A;  3TTR A;  4NQ8 A;  3K02 A;  5I2K B;  1D9Q A;  1B7U A;  4KYD A;  2VPO A;  4YIC A;  3MVW A;  2CMO A;  5CM6 A;  3C32 A;  4QFN A;  3RPL A;  1D4N A;  4M1V A;  1A8F A;  2OPD A;  2F7A A;  3H6V A;  5I7I A;  4PFT A;  1UIU A;  2W7Y A;  5LDZ A;  1B3L A;  2Y84 A;  3CHG A;  3G3K A;  4PDH A;  3U92 A;  4N91 A;  3OO6 A;  3PUW E;  1IMF A;  5ET6 A;  1H44 A;  2HXW A;  2RCB A;  1LAX A;  2FYI A;  1B58 A;  3F11 A;  5EHM A;  1N7X A;  4WED A;  1A54 A;  4N17 A;  4ESX A;  1JNF A;  1WOD A;  1B32 A;  3C35 A;  2XXY A;  4OVT A;  4DDD A;  1B3F A;  5CMM A;  3H4Z A;  4BDQ A;  4EQ7 A;  3OXN A;  3TOD A;  3S9L C;  2OK2 A;  3GYY A;  4TQU Q;  4I9D A;  2CZL A;  1S7Y A;  3RT6 B;  1F9B A;  3R26 A;  1BTJ A;  4XKN A;  1LGB C;  3OO9 A;  1ANF A;  2VHA A;  3DM0 A;  3TTL A;  1IME A;  4H0W A;  1FPB A;  3M3F A;  4OVQ A;  4GWW A;  1B3G A;  2OJT A;  3FAS A;  2QS3 A;  1Y3N A;  4LP2 B;  1YCJ A;  3FZV A;  3S9E A;  5F24 A;  1NNP A;  2IA4 A;  2O51 A;  2NXO A;  4X1D A;  2F6P A;  1NV3 A;  2AYS A;  2QRY A;  4QHQ A;  2XXU A;  3TYH A;  4JWX A;  5I59 B;  2O1L A;  2OPE A;  4ZE9 A;  2QVU A;  1P99 A;  5F1Q A;  1MXU A;  1VR5 A;  1EZ9 A;  4O8M A;  1QKA A;  1MM7 A;  4PFR A;  4YKK A;  2DWJ A;  2I0B A;  4TLM B;  1EYK A;  4NF0 A;  4OQO A;  1SBP A;  2XXI A;  2P2A A;  1JVX A;  4R2B A;  4MX6 A;  3PV0 E;  4NX1 A;  1H3D A;  1HSL A;  3O6H A;  3KFM A;  3C34 A;  4OMB A;  2UVJ A;  2RC9 A;  4GOT A;  4DCY A;  5BUU A;  1MQJ A;  3LR1 A;  1URG A;  4PAK A;  4PAI A;  2X7Q A;  4NGU A;  4R9F A;  1FPD A;  1N3W A;  2DE3 A;  2UVG A;  3EHU A;  1BK4 A;  2QJE A;  1PB9 A;  3MZB A;  5F7V A;  2DE4 A;  2FBP A;  3E78 A;  3PMV A;  4K3F A;  3JV9 A;  2WYK A;  5H8Q A;  4QF9 A;  4GXA A;  4IGR A;  3RPL B;  4JB7 A;  4QBA A;  3A3U A;  1LCF A;  2XXP A;  4KYE A;  1L5T A;  4O3C A;  5IGA A;  3Q29 A;  4GXS B;  1PB8 A;  2DXR A;  4ZEC A;  3EKI A;  4NE4 A;  3W9V A;  3IOR A;  2P1S A;  4X48 A;  2I48 A;  1MXZ A;  3IB2 A;  3MC2 A;  4PGN A;  2OCU A;  1LB9 A;  4YKI A;  1FBP A;  1NI9 A;  3KC0 A;  2ZYK A;  3B6Q A;  3CSG A;  3O28 A;  3DP8 A;  2V25 A;  3CFL A;  2O84 X;  4P1E A;  1YYZ A;  3FXB A;  1EYI A;  5TU0 A;  4TLL B;  4OA4 A;  3PPN A;  4FED A;  4NWD A;  4HE0 A;  1G0H A;  2OX3 A;  2HPG A;  1N04 A;  5H8F A;  1ZTY A;  1LBX A;  3Q25 A;  3PMX A;  3R7X A;  1FJ9 A;  3ILT B;  4QSC A;  2F78 A;  3B7D A;  4PQJ A;  3CSB A;  1Z7M E;  1M5F A;  1AOV A;  4R72 A;  3H6W A;  1B4Z A;  2ALU A;  4IO7 A;  3T96 B;  1GGG A;  5IM2 A;  3FGS A;  1IMC A;  1UIV A;  2I3V A;  3QMF A;  4AS4 A;  4EF1 A;  1MH4 A;  3KG2 A;  1NV0 A;  1H45 A;  2XD3 A;  4H6D A;  4XKQ A;  4KD5 A;  5FTH A;  4GWU A;  1PB7 A;  3W9W A;  3K6U A;  3MYU A;  3SEY A;  3QK6 A;  4OAN A;  2HZK A;  4GBW A;  1D9V A;  1JET A;  3C36 A;  1SW5 A;  4EQB A;  5AA1 A;  2G29 A;  2RC7 A;  1QUJ A;  4ZED A;  3RYD A;  3D1R A;  2WKY A;  3IJX B;  1B9J A;  1LBV A;  1FBD A;  3KN3 A;  1NNF A;  2PMS A;  1FPI A;  3PUX E;  2Z22 A;  2CEX A;  5DVI A;  2HQ0 A;  4X9T A;  1MH3 A;  2PT1 A;  5I2N A;  4JXI A;  1YXI A;  4GVO A;  1Q35 A;  4QXD A;  5DEX A;  4NMY A;  2F35 A;  4MNP A;  1O7T A;  5H8Q B;  3E79 A;  1URS A;  3QIM A;  1B05 A;  2ZXT A;  1NMU A;  5IZZ A;  1M5B A;  3IJO B;  4P3L A;  3FXQ A;  4LON B;  5EQA A;  2X26 A;  3N5L A;  2THI A;  3MP1 A;  3K4U A;  2ZZV A;  5IKB A;  4Z7E A;  5H8N A;  2OBG A;  4DI3 D;  1NFT A;  3HO7 A;  5I2K A;  4E0W A;  1KZ8 A;  4LZ8 A;  3MP8 A;  1TT1 A;  2QS4 A;  3B6W A;  5ESY A;  1BIY A;  3LSL A;  3G3F A;  2Y7K A;  3LV0 A;  4R2F A;  2ONS A;  1FJ6 A;  2FA7 A;  2ZNS A;  3OD7 A;  3PD8 A;  4QFO A;  3U1O A;  2F8D A;  4PE3 A;  3N6T A;  3OEL A;  1NV1 A;  3CIJ A;  4G8N A;  1SI1 A;  3EHS A;  5H8F B;  2QL3 A;  3FJ7 A;  3KSJ A;  4MH5 A;  4OET A;  2RCA A;  1MPC A;  1B4H A;  3LBS A;  5LTC A;  4GWS A;  4PF8 A;  4IO6 A;  4I1D A;  1B5I A;  4BDM A;  3FXU A;  4H1X A;  2V3Q A;  4ND9 A;  5AA2 A;  5I56 A;  1FBC A;  1LFG A;  3A09 A;  4G2Z A;  1IMB A;  4TOZ A;  3LUZ A;  2AIX A;  5IZ1 A;  1INP A;  3RPW A;  1FPF A;  1B6H A;  2L5V A;  3MBP A;  4P0G A;  3U94 A;  3IO4 A;  3VDF A;  1Y1M A;  5J1D A;  1ZU0 A;  4MNI A;  3OEN A;  3IX1 A;  5EQ9 A;  1YTV A;  2O68 A;  3IOU A;  3H7M A;  4O7M A;  1I6A A;  1NH7 A;  4KCC A;  3SZP A;  1FRP A;  4FOR A;  3VLW A;  4Q0C A;  1OQH A;  4EF2 A;  3GBA A;  3ILU B;  1IXG A;  4P1L A;  2CZI A;  1HSE A;  2QS2 A;  2XA5 A;  4XTC Q;  3QSL A;  4DXU A;  2Q8M A;  2R6G E;  4JSD A;  2P3V A;  3WAE A;  3FUZ A;  1QW0 A;  1P1W A;  2Q8J A;  4F2Q A;  1XHY A;  1P1Q A;  1EZO A;  5T3J A;  5I3S A;  4OVS A;  1URD A;  5ET7 A;  1LAG E;  2WBB A;  5I2N B;  3O2A A;  1DPP A;  3TEL A;  2DE2 A;  5DEX B;  1CB6 A;  2HXR A;  4IO2 A;  4F18 A;  4LZ5 A;  4XF5 A;  1IXC A;  1YZ0 A;  2VPN A;  4G68 A;  1DTZ A;  1B5H A;  5ITO A;  1FQE A;  2H4I A;  5TP9 A;  1FTA A;  2RC8 A;  4BLA A;  3K6X A;  1II5 A;  3SEV A;  1SYH A;  1PC3 A;  4U2R A;  5H8N B;  4OVP A;  3G3H A;  1MY4 A;  1R1N A;  3MZ9 A;  4H65 A;  4FAJ A;  1XC1 A;  3V5A A;  1ZKB A;  5EQ8 A;  1OLA A;  3KGC A;  2ZZX A;  4HS7 A;  3U8Q A;  3K1P A;  3CR9 A;  5DTB A;  3TDJ A;  2XXH A;  4ISU A;  2YJP A;  2I0C A;  3Q28 A;  2Z23 A;  2B3F A;  1VFE A;  1SI0 A;  1Y9U A;  2FIX A;  3OO7 A;  4KFQ A;  1LAH E;  2DYX A;  4ECF A;  3T9X B;  3HN0 A;  5AA3 A;  3C31 A;  4LUB A;  2V3U A;  3SET A;  3QXM A;  4YU0 A;  4IB2 A;  3ECR A;  3EN3 A;  3IOW A;  3IK6 B;  1B5J A;  1B1H A;  3M3L A;  4GX3 A;  2XX7 A;  3LUY A;  2VD2 A;  4ZEK A;  5EHS A;  1OMP A;  4JSO A;  4GRK A;  3QYT A;  5AA2 B;  4PTK A;  2B4L A;  4R6H A;  5I56 B;  3ONM A;  3BIH A;  5M2V A;  4ELP A;  4PBQ A;  5CBS A;  3KZG A;  4XIG Q;  1IQ7 A;  4GX6 A;  1H76 A;  2I4B A;  3TPA A;  4H5G A;  3K0V A;  4MMP A;  3FJG A;  3HFU A;  1LCT A;  4FBP A;  4MEV A;  3K6W A;  3CG3 A;  3K00 A;  1AH5 A;  3OSQ A;  4I62 A;  5JTY A;  2QS1 A;  1B40 A;  1NUZ A;  5FHM A;  1LBB A;  1NNK A;  5JEI A;  4U4S A;  1FQA A;  4PFW A;  3RY3 A;  1K9Z A;  4LQ5 A;  2F36 A;  4C1T A;  4Z0I A;  1FW0 A;  4H45 A;  1UTB A;  4KPT A;  2NWJ A;  4AS5 A;  2GRV A;  3PUV E;  3CVG A;  4PP0 A;  1QUI A;  4N8Y A;  2KLF A;  2GH9 A;  1AMF A;  4JVD A;  2E0S A;  1RKM A;  1LBW A;  4BDL A;  3L6G A;  4XXU A;  3VXC A;  3O6G A;  4G68 B;  3UK4 A;  1FCK A;  3IB1 A;  5TP9 B;  4GQO A;  5CMC A;  4EXL A;  4R74 A;  3MJN A;  4JWO A;  2XXQ A;  2VP1 A;  4R73 A;  3NOH A;  4H46 A;  4MHF A;  4IGT A;  1MY2 A;  4JVI A;  2CEY A;  3FV2 A;  2ZYO A;  3MQ9 A;  4N07 A;  4ZDM A;  3GXA A;  1NV2 A;  5J16 A;  4NF5 A;  3JZJ A;  1USY E;  4P0I A;  5K2X A;  4PDD A;  2VOZ A;  3V89 B;  1S9T A;  4F39 A;  2ZNT A;  2DWA A;  4OWD A;  4F3G A;  1MPB A;  4POX A;  1A7L A;  2Y7P A;  1EYJ A;  5L9S A;  4OXV A;  1YAE A;  3EQ1 A;  1BKA A;  3VVF A;  1FTM A;  5JK4 A;  5ICT A;  3QAX A;  3G3G A;  1MXX A;  3TCG A;  1G0I A;  4YB5 A;  3RT8 A;  3FXR A;  1NNT A;  1DPE A;  1AL3 A;  3FAT A;  1KA1 A;  1MQI A;  2D21 A;  2F5X A;  2ZZW A;  4RA1 A;  4OEU A;  1B7H A;  3EF7 A;  4HTG A;  3T93 B;  1H43 A;  1NV6 A;  2ZNU A;  3SER A;  1XVX A;  1OVB A;  4EDP A;  2DVZ A;  2ONK E;  1QUK A;  3QUF A;  5A5X A;  3D4G A;  1LBZ A;  1FTO A;  2DP8 A;  2B65 A;  5EQ7 A;  3H6T A;  4RPN A;  1DOT A;  3D4C A;  4N6D A;  3TKD A;  1KWH A;  1B51 A;  5L9M A;  4IO5 A;  2Q89 A;  1NV5 A;  1Q9D A;  3KJ7 A;  3K1N A;  1US4 A;  2RF1 A;  3G3I A;  1RYX A;  2HAV A;  2HZL A;  3T9V A;  3B8B A;  3MW0 A;  1JVY A;  2Y5K A;  1MM6 A;  4OES A;  2R9J A;  4PFU A;  2WEF A;  5JTY B;  2XXK A;  4Q5T A;  3OSR A;  3EHT A;  3DP4 A;  1EU8 A;  4AQ4 A;  1Y3P A;  4GF8 A;  3TQW A;  1RYO A;  2ABH A;  3B6T A;  5K2Y A;  4ESW A;  2XXR A; 
#chains in the Genus database with same CATH homology
 4NQ8 A;  1D9Q A;  2VPO A;  4YIC A;  5I5P A;  1FBH A;  5LTC A;  4GWS A;  4PF8 A;  2Y5L A;  5CM6 A;  3RPL A;  4F19 A;  4M1V A;  4I40 A;  4HE2 A;  2V3Q A;  4PFB A;  2QVR A;  4PC9 A;  1FBC A;  5I7I A;  5LDZ A;  2JJK A;  2QPQ A;  2DDK A;  1IMB A;  3LUZ A;  4P56 A;  3CHG A;  5IZ1 A;  1INP A;  4PDH A;  4N81 A;  4N91 A;  1FPF A;  2L5V A;  1IMD A;  1IMF A;  5ET6 A;  1NUY A;  4O7I A;  2WX9 A;  4P8B A;  5J1D A;  1NUX A;  4MNI A;  2R8T A;  5EQ9 A;  4PGP A;  4NAP A;  4O7M A;  4N17 A;  3BIG A;  4MAG A;  3SZP A;  1FRP A;  3MST A;  3T0J A;  3ROJ A;  4OVT A;  3KBZ A;  4KXP A;  4P1L A;  2CZI A;  2XA5 A;  2KQZ A;  4MIJ A;  1FBE A;  2Q8M A;  2B4M A;  4GWY A;  3GYY A;  2P3V A;  4F1V A;  5IZ3 A;  1NUW A;  1RDX A;  5T3J A;  5I3S A;  4OVS A;  5ET7 A;  2WBB A;  3ISP A;  2VT5 A;  4NN3 A;  2XWV A;  2OWZ A;  1IME A;  1FPB A;  2DE2 A;  4OVQ A;  4GWW A;  2HXR A;  4F18 A;  4XF5 A;  1YZ0 A;  2VPN A;  5F24 A;  4NHB A;  3T1B A;  1NV3 A;  1FTA A;  4GWZ A;  4DI4 B;  1AWB A;  2XWK A;  2QVU A;  4X8R A;  1LEV A;  1QGX A;  4O8M A;  1DCU A;  1NV4 A;  4PFR A;  3FBP A;  4OVP A;  2KR0 A;  1FPJ A;  4P9K A;  1EYK A;  4NF0 A;  4MX6 A;  4NX1 A;  2Q9T A;  5EQ8 A;  4F1U A;  2ZZX A;  1K9Y A;  3U65 A;  4PAK A;  4PAI A;  4NGU A;  1FPD A;  2FIX A;  2DE3 A;  1BK4 A;  1JP4 A;  4XEQ A;  5ET5 A;  2DE4 A;  2FBP A;  3E78 A;  1FBG A;  2PCR A;  4HCW A;  1FBF A;  4GX3 A;  2WYK A;  1VDW A;  4I3Y A;  3RPL B;  4QBA A;  1KA0 A;  4N15 A;  2Q74 A;  4UAB A;  4PBH A;  4PTK A;  4P47 A;  2B4L A;  4GX4 A;  5IGA A;  3BIH A;  4PBQ A;  3EKI A;  2WBD A;  3W9V A;  4GX6 A;  4O94 A;  1CNQ A;  4MMP A;  3A29 A;  2MKZ A;  4PF6 A;  3HFU A;  4MCO A;  4PGN A;  3B50 A;  4FBP A;  4MEV A;  1FBP A;  1NI9 A;  3KC0 A;  4I3E A;  3PTY A;  2FHY A;  4P1E A;  1YYZ A;  1NUZ A;  3FXB A;  1EYI A;  4OA4 A;  4HE0 A;  1G0H A;  2OX3 A;  2HPG A;  2F3D A;  5IZ3 B;  1K9Z A;  1LBX A;  1FPL A;  4HCY A;  1FJ9 A;  4H45 A;  2CZH A;  1RDY A;  4AS5 A;  1FPG A;  1SPI A;  1IMA A;  4N8Y A;  5EYH A;  4X04 A;  4JVD A;  1LBW A;  5IM2 A;  1IMC A;  4YZZ A;  3QMF A;  4AS4 A;  4GBV A;  2FIE A;  1NV0 A;  4MJO A;  4GWU A;  3NOH A;  4JVC A;  3W9W A;  4H46 A;  4N8G A;  4MHF A;  3MYU A;  4OAN A;  2HZK A;  4GBW A;  4JVI A;  4PET A;  2CEY A;  1NV2 A;  5J16 A;  2CZK A;  4PAF A;  2F3B A;  1LBY A;  2PFY A;  4PDD A;  3RYD A;  3D1R A;  5A5L A;  1LBV A;  2XWI A;  1FBD A;  5FBP A;  1FPI A;  2PFZ A;  2CEX A;  2FVZ A;  1EYJ A;  4HXV A;  3KC1 A;  4X9T A;  2P3N A;  4NG7 A;  5JK4 A;  4G61 A;  3IFC A;  2BJI A;  1G0I A;  1YXI A;  1KA1 A;  4QXD A;  2F5X A;  2ZZW A;  2XWO A;  5ET8 A;  4MNP A;  1NV6 A;  1DK4 A;  5EYG A;  1FPE A;  3E79 A;  4GWX A;  5IZZ A;  2DVZ A;  2HHM A;  4N4U A;  5DW8 A;  4XFE A;  1LBZ A;  4P3L A;  5EQ7 A;  5EQA A;  1NV7 A;  4N6D A;  2WYP A;  2ZZV A;  4DI3 D;  1NV5 A;  1Q9D A;  2QVV A;  4N6K A;  3IFA A;  1KZ8 A;  2HZL A;  4OVR A;  5ESY A;  1DBZ A;  3B8B A;  2Y5K A;  1FSA A;  3LV0 A;  1FJ6 A;  2WEF A;  2XXK A;  4IR8 A;  1RDZ A;  4HE1 A;  4PE3 A;  2QFL A;  4LN5 A;  1NV1 A;  1XI6 A;  4MNC A;  2GQ1 A;  4PCD A;  1FPK A;  4PFI A;  2V4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...