5EQ7A

Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with free phosphate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
265
structure length
257
Chain Sequence
QLNHFSDVANKAANAAGDVIRKYFRKNNFLSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Medicago truncatula Histidinol Phosphate Phosphatase from Inositol Monophosphatase Superfamily Reveal Details of Penultimate Step of Histidine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Biosynthetic protein
molecule keywords Inositol monophosphatase
total genus 83
structure length 257
sequence length 265
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eq7A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eq7A02
1JP4A 4HE2A 1FPIA 1RDZA 1FTAA 1LBYA 2WEFA 1KA0A 5I3SA 4GWSA 1NUYA 2OX3A 3LV0A 5IZ3B 5F24A 5EYHA 1K9ZA 4HE0A 1AWBA 1KA1A 2FBPA 3RPLB 1FBEA 2Y5LA 1LBZA 2VT5A 4I3YA 4G61A 1NV3A 2FHYA 1FPKA 2JJKA 3D1RA 1FPGA 1K9YA 4I3EA 3ROJA 2CZIA 1NV2A 5FBPA 1IMDA 1FPLA 4AS4A 1IMEA 4HXVA 1FSAA 2QVVA 3KC1A 4IR8A 1Q9DA 2DDKA 4QXDA 1IMFA 4GWWA 2P3NA 5LDZA 1LBXA 1NUWA 3RPLA 1G0HA 5EQ8A 4H45A 5T3JA 3RYDA 1YZ0A 2BJIA 1D9QA 1FJ9A 1IMBA 1BK4A 2CZHA 3IFAA 1DK4A 1IMAA 1NUXA 4O7IA 1FPDA 1NV5A 1NV0A 3BIHA 2WBDA 5ET6A 4GX4A 4GWZA 5IZ1A 4GBVA 4GWUA 1FBCA 2PCRA 1RDXA 4AS5A 5ET5A 1FBPA 3BIGA 3T0JA 4H46A 2Q74A 2R8TA 5ET8A 2FIXA 1G0IA 1FBFA 1NV1A 1FBDA 1YYZA 2P3VA 2QFLA 2F3BA 4I40A 1FPEA 1FPJA 5EQAA 1LBVA 1SPIA 1CNQA 3FBPA 3KC0A 2FVZA 1FPBA 1FPFA 1NV4A 4PTKA 1YXIA 1DCUA 5EQ7A 5ET7A 4FBPA 3QMFA 5IZ3A 5J16A 2HHMA 1RDYA 5EQ9A 1FBGA 1DBZA 3A29A 1IMCA 1LEVA 3KBZA 4MJOA 1EYKA 5EYGA 2QVRA 2FIEA 2CZKA 2F3DA 1INPA 3B8BA 4GWYA 5DW8A 3IFCA 4GWXA 1FBHA 4GBWA 2QVUA 1FRPA 1VDWA 1NV7A 2GQ1A 1FJ6A 2Y5KA 4GX6A 4HE1A 2OWZA 4GX3A 2WBBA 5ESYA 1XI6A 1LBWA 1NUZA 5A5LA 1QGXA 1EYJA 3LUZA 1KZ8A 4N81A 4KXPA 1NV6A 1EYIA 2Q8MA 1NI9A
chains in the Genus database with same CATH superfamily
4PBHA 4NE4A 2V3UA 1MPDA 1FQEA 2VD3A 1UIVA 4G68C 2VGQA 3H6UA 1B0LA 3MVXA 2ABHA 2Y5LA 4OEVA 2L5VA 1DPEA 4JXIA 1F9BA 5LOMA 4OQOA 4H8JA 3TFLA 4QXDA 2DDKA 2Y7PA 5DVIA 1FQCA 2HPGA 4XF5A 1OQHA 1XC1A 4F1VA 2CZHA 3MWBA 3FJGA 2HXRA 5IZZA 4OA4A 3B7DA 4I9DA 4BDNA 3S9MC 4BDMA 3USDA 1TT1A 3OENA 3OEKA 4U1OA 2H4IA 3FUZA 4P47A 2XA5A 1A99A 2FA7A 4NN3A 4NGUA 4OFLA 1MQGA 1N7WA 2I4BA 3EQ1A 3K4UA 4H1XA 2NOOA 1LFHA 4Z7EA 3FV1A 1GR2A 3FVGA 4N6PA 2ONRA 2Y7WA 5H8FB 4N91A 4KHZE 2F3DA 3RTFB 4JB7A 3B8BA 4GWYA 3SEUA 1MDP1 2O69A 1QKAA 1B2HA 4H67A 4N15A 1IITA 2ZNUA 1FRPA 1VDWA 2QPQA 5ITPA 4HE1A 5FTIA 5IGAA 2WBBA 1NNKA 5AA2B 3C31A 4O3AA 4MBPA 5A5LA 4KD5A 3WAFA 1FCKA 4P8BA 3N6TA 4MMPA 1B3GA 1EZOA 1H43A 4MCOA 1IXHA 1IIWA 1MQJA 1NUYA 5IZ3B 4IY5A 4KCCA 2ZYMA 2OLBA 5JK4A 3HHGA 2H99A 4I3YA 4G61A 4GD5A 2D3IA 4G68A 3D1RA 2D21A 4G8MA 4U1ZA 4NF6A 3TEPA 2DXRA 2Z23A 4RY1A 4IY6A 3R7XA 2O1LA 2XX9A 2P3NA 3EHSA 2F6GA 2XXRA 2QS2A 1OVBA 1D3KA 2H9BA 3CSGA 4P0IA 4F39A 1XHYA 5IZ1A 4AS5A 1PB7A 3T0JA 3LBSA 3IJXB 2QL3A 4GF8A 2FIXA 1O64A 2GH9A 1Y3PA 3MQ9A 5H8SA 4DDDA 2AYSA 3FBPA 3VLUA 3O97A 1I6AA 4NEDA 1NNFA 1P1UA 1IZ1A 3FATA 2DP8A 3MVWA 1FQFA 2PMSA 4LONB 3CSBA 5DEXB 4MJOA 1B40A 1N7XA 2OWSA 3IK6B 4NF6B 1INPA 2Y84A 2PT1A 5DVFA 4FJPA 3MP6A 3PPQA 2DWHA 4ND9A 1KWHA 4LQ2A 3ILTB 1QULA 4EXKA 1R6ZA 3OO8A 5ELVA 2XXHA 1JEUA 3FVOA 1P1OA 4ELRA 2E1SA 3M3FA 4QF9A 2P0SA 5F24A 5DTBA 3OSRA 2QJEA 1B46A 1P1WA 1IUDA 4HE0A 5L9OA 1USYH 2E0SA 3RGYA 2KR0A 4N6KA 1NNTA 4MAGA 3TCGA 1SW1A 3HSTA 1FPLA 4DXBA 4AQ4A 5ICQA 4NMYA 1O7TA 4YICA 2F5XA 3QUJA 2VP1A 1AH5A 1FJ9A 1ZTYA 2XXXA 3IB2A 5CM6A 4GWUA 3KN3A 3VLVA 1MQHA 5ET8A 2I58A 1PB8A 1M5EA 3TTKA 2DOJA 2XHDA 4PF8A 4I1DA 2OJTA 5I56B 3JZJA 1UTBA 1DOTA 2V84A 2UVJA 4DCXA 3QMFA 3TCHA 1MXVA 2XXQA 3KBZA 4IO3A 1A55A 4P3LA 4ZZAA 3EHUA 4XKRA 2DE3A 4R72A 4ECFA 3SDFA 3VVDA 3RY3A 3P7IA 3MC2A 3THIA 3C9HA 2DWJA 4K3FA 1LBWA 1NUZA 1PBQA 2F8DA 4KR5A 4N81A 4NF8B 4G8NA 4U22A 1UIUA 3PPOA 3W15C 4TLMB 1AL3A 1XOCA 1B05A 3E3KA 1MM7A 4PETA 3PD9A 3CFZA 3UA8A 3T9XB 3VE1B 1A8EA 4GLIA 2A5SA 3IJOB 4PP0A 2NUVA 2PFYA 2YLNA 5CRYA 4R6KA 3MVZA 3GBBA 3TAJA 1G0HA 2A5TB 4LP2B 3NOHA 1DK4A 4DI4B 3S9NC 4GWZA 3CR9A 2GHBA 1GVCA 2PX1A 4P9KA 3QAXA 3ISPA 2R6GE 2VPOA 5K2YA 2ONKE 3VDFA 4GL8A 4N07A 1FPFA 1M5FA 3K6XA 2ZZWA 1DCUA 2OBGA 3N94A 1LCTA 2I4CA 4JVDA 3FJMA 5TU0A 4PFIA 1LEVA 1N3XA 2IA4A 4H8IA 2XD2A 4YMBA 4MFIA 4PAIA 3FXRA 4OVRA 1MXZA 1OLAA 1WODA 2V3QA 1FBHA 4GIZA 3PV0E 4NF8A 3SEWA 3IORA 1TFAA 1Y4CA 5CI5A 3MJNA 1DMBA 4DXUA 3TCFA 3MW0A 4ZEFA 1B3LA 1LGBC 1WVJA 1JP4A 4ZE8A 3VFJA 3O6HA 1TFDA 4YU0A 2Q2CA 1BLFA 1XVYA 3KBRA 4IB2A 5L9MA 3Q27A 5FHOA 2REJA 4NHBA 3OOAA 3SERA 4IO2A 3T93B 1B7UA 4LZ5A 3VV5A 2CZLA 2XWOA 3HN0A 3TZAA 3PMXA 2XD3A 4PAKA 5TPAA 1SW4A 4QBAA 4F3PA 3QK6A 3I3VA 1Q9DA 5BWJA 3MYUA 4H45A 1PDAA 2M8CA 4U4XA 5CBRA 1B32A 4JVCA 4GX4A 1Z7ME 4GBVA 1FBCA 1QJMA 2GHAA 1FBFA 4PBQA 4XKQA 1JW1A 4M1VA 1JW4A 2XWKA 4PFTA 1NV4A 4XKPA 1B0HA 4KFQA 3H03A 3T1BA 4LATA 1EZ9A 4PFRA 2O51A 3H6TA 4PDHA 4FEBA 3T22A 4PFBA 5L8DA 3KZGA 4DCYA 4YAHX 1QUKA 3IOUA 4GWXA 5I58B 2GQ1A 1HSJA 4QFNA 5B7DA 2ZNSA 1B58A 3MAMA 5I58A 5AA2D 2Q8MA 2XXVA 2PBWA 4NF4A 4WEPA 4NTLA 4YZZA 4F22A 3MVYA 2NWJA 2QMWA 4OVPA 1NL5A 1T0KA 3G3IA 4H5GA 3IX1A 1H44A 3DM0A 5CC2A 1KA1A 2VT5A 2XXKA 4R9FA 1NV2A 1JW5A 3RPLA 5T3JA 1FQAA 3K0VA 3U94A 4OZ9A 1VSOA 2R9JA 3U72A 1IMAA 4O7IA 1MH3A 3N26A 3QYTA 3KJTA 4OMBA 3F11A 1FBPA 2GRVA 2PT2A 2ZMBA 1G0IA 1UQWA 1LAXA 5EHSA 2P3VA 3E4RA 4BDOA 1QUIA 3JV9A 3CFXA 1FPBA 4XTCQ 2ANJA 4NF5A 2PFZA 4FE8A 2RF1A 3ZKLA 1URDA 1QVSA 1UTBB 1A7LA 3V83A 4ZEBA 1MXWA 2VOZA 3B6TA 3KSJA 1B3HA 4ZEKA 3CIJA 4ISUA 3U93A 2CZKA 4U21A 3OSQA 3TODA 2YJPA 4JSOA 2X7QA 2F7BA 1FJ6A 2I0BA 2I0CA 3LC8A 4WKMA 2CEXA 2O7IA 3O6GA 4HCYA 1EYIA 4H0WA 1O63A 1R9LA 4X04A 3TYHA 3ECRA 3LR1A 4E0XA 2RCAA 4AB5A 2DE4A 3M3LA 4BDRA 2Q2AA 3FJ7A 3RT6B 4JSDA 1I6QA 4ESWA 3CFLA 5CMMA 1LBZA 4G8HA 2HAVA 1LCFA 4DXCA 4C0RA 3PUZE 3PUYE 4OXVA 2XWVA 4FATA 2RKMA 4Z0IA 2FNCA 2BJJX 3TELA 2QVVA 2RC9A 2P2AA 1LBXA 3KEIA 3FZVA 3VLWA 1Y3QA 1IXCA 3TDJA 3BIHA 3FXBA 3DP8A 4PFYA 5KCJA 5AA4A 1MQIA 4H46A 4RK2A 5F7VA 4HS7A 3H3GA 2Y7KA 1VE4A 4LQ5A 2REGA 2FVZA 1MG1A 3D4GA 3PUVE 4LN5A 3Q25A 2P1SA 3TMGA 1DBZA 4HTGA 2HAUA 1MY2A 5EYGA 3N5LA 3K02A 4QFKA 5L9SA 4WXJA 3H4ZA 4F29A 3UGWA 2H5YA 5H8NA 2QVUA 4OHNA 4MNCA 5I5PA 5ESYA 4BDLA 4P1LA 1EYJA 3A3CA 3OMBA 3LSLA 4O94A 4G77A 5I2NB 2KQZA 1FPIA 3K01A 5TPAB 1FTAA 1FTMA 3BFUA 4RYAA 5ITOA 2B4MA 5I3SA 1SI1A 2HZLA 3LV0A 2HQ0A 4F3SA 2XXWA 1MY4A 4P0GA 1NV3A 2HXWA 3Q28A 3TQWA 3ROJA 4GWOA 3KN8A 4GXAA 4OETA 2WYKA 1S7YA 3VVFA 1OLCA 4GFRA 4LZ7A 2UVHA 3H7MA 3KFMA 1EZPA 1BK4A 3IFAA 2I49A 5ET6A 3W9VA 1PB9A 3B50A 2PCRA 3IOVA 4PE5B 2ZXTA 1CE2A 4RPOA 3S9LC 4YB7A 4R6YA 1BIYA 1FPJA 4F19A 3G3KA 2AL5A 4MH5A 2XXTA 3EF7A 1PC3A 3FD3A 1Y3NA 1BKAA 2DVCA 5EQ7A 5CMCA 3LSWA 4YMAA 4OEUA 4UA8A 1AOVA 3W9WA 1TXFA 2DWAA 1H76A 1OMPA 1UTHA 3RLFE 3MZBA 3SEYA 2HZKA 1I69A 4EF1A 1LAFE 2OCUA 1D9VA 3SKPA 3G3FA 4C1TA 4ONYA 3V89B 4DI3D 4QRZA 5H8HA 3OELA 4PGPA 5FHMA 2ONSA 1NKXA 5BUUA 3FVKA 1LB8A 3IB0A 3HFUA 2B3BA 4KYDA 2OWZA 3JYRA 1XI6A 5HBCA 4ZE9A 4PFWA 1LFGA 3PUWE 4KXPA 2VHAA 3QUFA 3O66A 2IEEA 4OESA 4Q5TA 1MDQA 2ESNA 3O6IA 4N17A 3VXCA 4LUBA 2VD2A 4KPTA 3TTLA 5DEXA 2V93A 1K9ZA 1AWBA 3FXUA 4ESXA 4FORA 1YTVA 2CZIA 3RN8A 2Q88A 3CG3A 1J1NA 4GXSB 4AS4A 3K1PA 2OK2A 4IR8A 3C35A 1H3DA 1BTJA 4IGRA 1YZ0A 4GOTA 3T9UA 3S9EA 3K6VA 3OEMA 1FTJA 2Y7IA 3IL1B 5I57B 3EN3A 3EPEA 2XXYA 4MNPA 5TP9A 4BLAA 2RC8A 1YYZA 4OYVA 4RJZA 3FASA 3DP4A 3T96B 2X26A 5CMKA 1HSEA 1SPIA 3KC0A 3I5OA 4TQUQ 3GZGA 3DELB 5EYFA 4QFLA 1R9QA 5I59B 3G3HA 1SVXB 1ZIUA 2DWIA 2AL4A 2QVRA 2QRYA 3T66A 1MY3A 1L5TA 5I2KA 2RINA 1POTA 5JEIA 4KYSA 1NH7A 4P11A 4DZ1A 3E9XA 4THIA 3PPNA 4OTEA 4NWDA 1SYHA 2DVZA 2FYIA 1JQFA 1A8FA 1MM6A 5HPQA 2GFEA 3S4UA 2I6EA 2O68A 3ODBA 3TQLA 1YCJA 5EYHA 3MPKA 2DE2A 1NFTA 3PU5A 4PE3A 3I6VA 3BKIB 3K6WA 2FHYA 4I3EA 1B7HA 4X48A 3E13X 4O3BA 1IMEA 2V4CA 2O7UA 3U1OA 3G7WA 3KC1A 2QMXA 4PAFA 3PMWA 1R1NA 2AIXA 3IB1A 1XS5A 3BIGA 3WAEA 4TOZA 4XXUA 4X9TA 3IOTA 4YKJA 4IO4A 4NF0A 1CNQA 4YB6A 3U8QA 1SW5A 1AIVA 5AA1A 2O84X 5ICTA 1B3FA 1N04A 3FVNA 3HV1A 4R2BA 5TP9B 2HFBA 1JNFA 4XFEA 1URGA 4PGNA 4BDQA 3GLBA 3KOTA 1Z7NE 5IAIA 4PC9A 4U23A 1DPPA 4H65A 1US4A 1NV6A 5A5XB 4C1UA 4ZEIA 4ELQA 4FIMA 5FHNA 2W7YA 5CMBA 1II5A 1ZJLA 4EF2A 2OX3A 3L6GA 4KI0E 5J1DA 1URSA 1Y4TA 4ZS9A 4O7MA 1P1QA 3RTWB 2QS4A 2ZZXA 3VXBA 1FPKA 2JJKA 2WX9A 1P1NA 1FPGA 3TPAA 1IMDA 3QSLA 4OFJA 3HO7A 3OD7A 4HXVA 1HSLA 4NQ8A 5LDZA 4N4UA 1FQDA 3T9HB 2F78A 5I59A 4N8YA 1FW0A 2KLFA 2UVIA 3O2AA 3LSXA 1NV5A 2CEYA 2F35A 3SEVA 4JBZA 1B1HA 3EHTA 1RDXA 3TUSA 4NG7A 1B4ZA 2Q74A 4EUOA 5I2NA 3KGCA 1NV1A 2O6AA 3K6UA 3TTRA 3MP8A 4KCDA 3U92A 1ZLQA 2LAOA 5JTYB 1LBVA 3G3GA 4R6HA 5AA3A 5FTHA 1SW2A 1N76A 4DLDA 1TWYA 1QKBA 5EQ9A 2RC7A 1EU8A 2XX8A 3A29A 1IMCA 2F7CA 5I7IA 2DYXA 4GRKA 5H8FA 1XVXA 3PPRA 3IFCA 4GBWA 4R73A 4XIGQ 4GX6A 4FECA 4ELPA 1GGGA 1QGXA 2ZZVA 3ZKKA 4NX1A 1IQ7A 2ALUA 4U4SA 4HE2A 2RCBA 4RA1A 3PGFA 4OVSA 4MF3A 1OQGA 3OO6A 4WEDA 1B7ZA 2FBPA 3OO9A 4OVTA 1FBEA 5H8HB 5EHMA 1H45A 1M5CA 5DVJA 4JWOA 2DQVA 1LBCA 4IO6A 3CVGA 1IMFA 4POXA 3MSTA 4H6DA 2Q89A 2CMOA 3V8XB 5IM2A 1NUXA 2Z8EA 4PFUA 2OZZA 2G93A 3HHFA 3MBPA 1YPNA 4Q30B 1XT8A 4I62A 3UK4A 4F2QA 4RXLA 4E0WA 1FPEA 5CBSA 1CB6A 2F6PA 1EH3A 2F7AA 1SQYA 2V3TA 3KJ7A 5ET7A 2F97A 3O28A 1MPBA 4FBPA 2HHMA 1OVTA 5DT6A 3GXAA 5KDTB 4JWXA 2FIEA 4LVQA 4JVIA 1NNPA 4YKPA 5DW8A 4MX6A 4R2FA 3ZS6A 2H98A 3MZ1A 4XKNA 1NV7A 4MEVA 3E78A 4EXLA 1B51A 2WKYA 1LBBA 3CG1A 4U2RA 1S50A 2PYYA 1B5IA 1SBPA 2B3FA 1LFIA 2XXIA 2QS1A 1FTOA 5I84A 1JEVA 4RNSA 2XXPA 1KA0A 3C33A 2OPEA 3D4CA 2QS3A 4QSDA 3LUYA 4FAJA 3GYYA 3KSXA 1LB9A 1B5HA 1BP5A 2NVUB 3RNNA 1MQDA 3RPLB 2F34A 4MHFA 4TLLB 4PF6A 2I3VA 5JTYA 5B70A 1Y9UA 2I3WA 1JVXA 1FSAA 1MS7A 4O8MA 1B1XA 2X7PA 3OO7A 2ZNTA 2I48A 3RUMA 4Q0CA 4F2OA 4QHQA 1N0TA 3U65A 1I6BA 1SD3A 1YAEA 1LAGE 2UVGA 1B6HA 3BBRA 1NV0A 3KG2A 4QFOA 3T9VA 1WDNA 5ET5A 1DTZA 3EKIA 1Y1MA 2XX7A 4NF4B 5I2KB 5ISUA 3Q29A 3E79A 3N6UA 2QFLA 4I40A 5EQAA 1SDXA 5H8QB 4QSCA 4EQBA 1ZBMA 1FTKA 1B9JA 4ZDMA 1YXIA 4P56A 1NH8A 4MNIA 2WYPA 3C4MA 2Q8JA 2UYFA 4IGTA 1Q35A 1EYKA 4ELOA 3GBAA 1MPCA 3PD8A 5HM4B 3DLNA 4NWCA 2B4LA 5I57A 2NXOA 1ZU0A 5AE4A 4YKIA 1OIBA 1MY1A 4P1EA 5H8NB 1KZ8A 1MXXA 3DP6A 4UABA 1US5A 1IXGA 1JVYA 3KN7A 3M8UA 2D5WA 4OVQA 2DXYA 1RDZA 4DIGA 1LLSA 1D9YA 1LBYA 1S9TA 1QW0A 5K2XA 1NMUA 3RQTA 1RYOA 2O1MA 4NAPA 3RT8A 1B4HA 5KZTA 3PMVA 3B6WA 3ONMA 3VVEA 2DSFA 4LZ8A 4QFPA 4RPNA 2Y7RA 1ATGA 2XWIA 3K1NA 1SYIA 4N6DA 5AA4B 4O3CA 1NUWA 3LSFB 1LSTA 1IMBA 2A5TA 4N13A 3SESA 4F3BA 4MLVA 5H8QA 1FQBA 1MRPA 3K2DA 4HCWA 3ILUB 3MP1A 1FBDA 4IO7A 1ELJA 2F3BA 2V25A 1RYXA 4HW8A 4R74A 4G2ZA 2Z8DA 4H5FA 5J16A 1RDYA 2B65A 3C34A 2MKZA 3PTYA 3K1MA 5DYHA 4R75A 4OVJA 2ZYNA 4DE8A 2VPNA 3A3UA 4F31B 4KQPA 3BFTA 4M4GA 2Y5KA 3R6UA 2F36A 4F3GA 3S2VA 4KYEA 3SETA 3FIRA 3LUZA 3SZPA 1N84A 4R9GA 3IAZA 1MXUA 3R26A 1Y20A 4OERA 1DTGA 1RKMA 1M5DA 4X1DA 3B6QA 2Q9TA 1AMFA 4EDPA 1VFDA 5KCJB 4GWSA 3TTMA 3Q26A 1Q1KA 3OXNA 4Q8RA 3FXQA 4NF5B 3MUQA 5FBPA 4OENA 3CHGA 1A54A 2HCAA 5KDTA 2Z22A 3UIFA 1ZKBA 5EQ8A 3IR1A 3A09A 3IO6A 2H25A 3RYDA 4PQJA 1SI0A 4PCDA 4GQOA 4MLQA 1D9QA 3PUXE 2UXAA 1FPDA 3K00A 3QXMA 2Z8FA 3CRBA 4YKKA 3KOSA 4I8CA 3UORA 4XEQA 1QUJA 2UYEA 5LTCA 3AXFA 1VR5A 2THIA 1MXYA 3O9PA 3FV2A 4PTKA 4AB6A 3G3JA 3UN6A 1PEBA 4G4PA 4GL0A 4RK9A 2R71A 2PVUA 4F1UA 1D4NA 1LAHE 1B52A 2OWTA 4EQ9A 4N8GA 1P99A 1GV8A 4OFOA 5I56A 1MH4A 3MPLA 4UACA 1ANFA 5M2VA 4ZZEA 2YPNA 4OANA 1UTHB 2WEFA 5AA2A 1PBPA 4POWA 3TKDA 4FEDA 2XXUA 1MY0A 4X1BA 3H6WA 2G29A 3CI8A 4F1YA 3RPWA 3SEXA 5F1QA 3C36A 1K9YA 1A40A 4QSEA 5IKBA 1N3WA 4GWWA 1POY1 4JWYA 3TTNA 3H6VA 3V5AA 2BJIA 3MZ9A 2OPDA 1M5BA 1VFEA 3UP9A 2WBDA 2DS9A 4X8RA 1IEJA 1FTLA 3IO4A 2R8TA 4ZEDA 3H06B 3QIMA 1B3EA 1Y1ZA 2ZYKA 4G68B 2QSXA 1JETA 4L17A 3O29A 1DSNA 3FGSA 4OWDA 5IZ3A 4IO5A 1FBGA 4YB5A 1ZMGA 4ZECA 3IOWA 4F18A 4GVOA 3HCQA 1B5JA 5A5XA 1IXIA 4EQ7A 4JDFA 3HPIA 4LA9A 3M3KA 3ZSFA 4GX3A 3PPPA 2HEUA 2ZYOA 3C32A 4MIJA 1USYE 4PDDA 1GTKA 1NI9A 3L6HA
chains in the Genus database with same CATH topology
4PBHA 4O94A 4MMPA 1JP4A 4X04A 4HE2A 4N6DA 4OVQA 4N17A 4OANA 2Q9TA 2KQZA 1FPIA 1RDZA 4MCOA 1FTAA 4YZZA 1LBYA 2WEFA 1KA0A 2DE4A 4OVSA 2B4MA 5I3SA 4OVPA 2HZLA 4PETA 4GWSA 1NUYA 2OX3A 3GYYA 3LV0A 5IZ3B 5F24A 5EYHA 1K9ZA 5J1DA 2DE2A 4NAPA 4YICA 4NHBA 4HE0A 1AWBA 1KA1A 2FBPA 4OVTA 5JK4A 3RPLB 1FBEA 2Y5LA 1LBZA 2KR0A 2VT5A 4I3YA 2L5VA 4G61A 1NV3A 2XWOA 4MHFA 4N6KA 4O7MA 2ZZXA 5IZZA 2FHYA 1FPKA 2JJKA 2WX9A 3D1RA 4PF6A 2XXKA 4PAKA 1FPGA 1K9YA 4I3EA 3ROJA 2CZIA 4MAGA 1NV2A 5FBPA 1IMDA 1FPLA 2PFYA 2XWVA 4AS4A 3CHGA 5CM6A 1IMEA 2V4CA 4PE3A 4QBAA 4HXVA 2XWIA 1FSAA 2QVVA 3KC1A 4IR8A 1Q9DA 2DDKA 4QXDA 1IMFA 4GWWA 2P3NA 5LDZA 1LBXA 2WYKA 1NUWA 3MSTA 4O8MA 3RPLA 1G0HA 4N4UA 5EQ8A 2F5XA 3MYUA 2HPGA 4H45A 4XF5A 5T3JA 3RYDA 4F1VA 3U65A 1YZ0A 4N8YA 2BJIA 4PCDA 1D9QA 1FJ9A 3NOHA 5IM2A 1IMBA 1BK4A 2CZHA 3IFAA 1DK4A 1IMAA 1NUXA 4O7IA 2HXRA 1FPDA 1NV5A 1NV0A 3BIHA 2WBDA 5ET6A 2CEYA 3FXBA 4JVCA 4OA4A 4GX4A 4GWZA 3W9VA 5IZ1A 4GBVA 4GWUA 3B50A 4X8RA 1FBCA 2PCRA 1RDXA 4AS5A 4P1LA 5ET5A 1FBPA 3BIGA 3T0JA 4H46A 3EKIA 2Q74A 4NG7A 2R8TA 5ET8A 4HCWA 2FIXA 4MNPA 1G0IA 4P9KA 1FBFA 1NV1A 1FBDA 4PBQA 3E79A 1YYZA 3ISPA 4X9TA 2P3VA 2QFLA 2F3BA 4I40A 4M1VA 1FPEA 2VPOA 4PF8A 1FPJA 5EQAA 2XWKA 4NF0A 1LBVA 4XEQA 4F19A 1SPIA 1CNQA 3FBPA 3KC0A 2FVZA 2XA5A 4P47A 5LTCA 1FPBA 1FPFA 1NV4A 4NN3A 4NGUA 4LN5A 4PTKA 2ZZWA 1YXIA 1DCUA 2PFZA 3T1BA 5EQ7A 4P56A 5ET7A 4MNIA 2WYPA 4PFRA 4FBPA 4JVDA 3QMFA 5IZ3A 3W9WA 5J16A 2HHMA 4PDHA 1RDYA 5EQ9A 1FBGA 4PFIA 1DBZA 3A29A 1IMCA 1LEVA 3KBZA 4MJOA 2MKZA 1EYKA 5EYGA 4N91A 4P3LA 3PTYA 2QVRA 2HZKA 4PFBA 5I7IA 2FIEA 2CZKA 2F3DA 1INPA 4F1UA 4JVIA 3B8BA 4F18A 4GWYA 4DI3D 2DE3A 2VPNA 4PAIA 4OVRA 4XFEA 5DW8A 4MX6A 4DI4B 3IFCA 4GWXA 1FBHA 2V3QA 4N8GA 2B4LA 4GBWA 4N15A 4PGPA 2QVUA 1FRPA 1VDWA 1NV7A 2GQ1A 2QPQA 3HFUA 1FJ6A 4MEVA 2Y5KA 4GX6A 4HE1A 4PGNA 2OWZA 4PAFA 4GX3A 4MNCA 3E78A 5I5PA 2WBBA 4NQ8A 5IGAA 5ESYA 1XI6A 1LBWA 1NUZA 2CEXA 4PC9A 5A5LA 1QGXA 4MIJA 1EYJA 2ZZVA 3LUZA 1KZ8A 4N81A 4NX1A 4P1EA 4KXPA 1NV6A 4HCYA 3SZPA 1EYIA 4PDDA 2Q8MA 2DVZA 4UABA 4P8BA 1NI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JP4 A;  4HE2 A;  1FPI A;  1RDZ A;  1FTA A;  1LBY A;  2WEF A;  1KA0 A;  5I3S A;  4GWS A;  1NUY A;  2OX3 A;  3LV0 A;  5IZ3 B;  5F24 A;  5EYH A;  1K9Z A;  4HE0 A;  1AWB A;  1KA1 A;  2FBP A;  3RPL B;  1FBE A;  2Y5L A;  1LBZ A;  2VT5 A;  4I3Y A;  4G61 A;  1NV3 A;  2FHY A;  1FPK A;  2JJK A;  3D1R A;  1FPG A;  1K9Y A;  4I3E A;  3ROJ A;  2CZI A;  1NV2 A;  5FBP A;  1IMD A;  1FPL A;  4AS4 A;  1IME A;  4HXV A;  1FSA A;  2QVV A;  3KC1 A;  4IR8 A;  1Q9D A;  2DDK A;  4QXD A;  1IMF A;  4GWW A;  2P3N A;  5LDZ A;  1LBX A;  1NUW A;  3RPL A;  1G0H A;  5EQ8 A;  4H45 A;  5T3J A;  3RYD A;  1YZ0 A;  2BJI A;  1D9Q A;  1FJ9 A;  1IMB A;  1BK4 A;  2CZH A;  3IFA A;  1DK4 A;  1IMA A;  1NUX A;  4O7I A;  1FPD A;  1NV5 A;  1NV0 A;  3BIH A;  2WBD A;  5ET6 A;  4GX4 A;  4GWZ A;  5IZ1 A;  4GBV A;  4GWU A;  1FBC A;  2PCR A;  1RDX A;  4AS5 A;  5ET5 A;  1FBP A;  3BIG A;  3T0J A;  4H46 A;  2Q74 A;  2R8T A;  5ET8 A;  2FIX A;  1G0I A;  1FBF A;  1NV1 A;  1FBD A;  1YYZ A;  2P3V A;  2QFL A;  2F3B A;  4I40 A;  1FPE A;  1FPJ A;  5EQA A;  1LBV A;  1SPI A;  1CNQ A;  3FBP A;  3KC0 A;  2FVZ A;  1FPB A;  1FPF A;  1NV4 A;  4PTK A;  1YXI A;  1DCU A;  5EQ7 A;  5ET7 A;  4FBP A;  3QMF A;  5IZ3 A;  5J16 A;  2HHM A;  1RDY A;  5EQ9 A;  1FBG A;  1DBZ A;  3A29 A;  1IMC A;  1LEV A;  3KBZ A;  4MJO A;  1EYK A;  5EYG A;  2QVR A;  2FIE A;  2CZK A;  2F3D A;  1INP A;  3B8B A;  4GWY A;  5DW8 A;  3IFC A;  4GWX A;  1FBH A;  4GBW A;  2QVU A;  1FRP A;  1VDW A;  1NV7 A;  2GQ1 A;  1FJ6 A;  2Y5K A;  4GX6 A;  4HE1 A;  2OWZ A;  4GX3 A;  2WBB A;  5ESY A;  1XI6 A;  1LBW A;  1NUZ A;  5A5L A;  1QGX A;  1EYJ A;  3LUZ A;  1KZ8 A;  4N81 A;  4KXP A;  1NV6 A;  1EYI A;  2Q8M A;  1NI9 A; 
#chains in the Genus database with same CATH topology
 4PBH A;  4NE4 A;  2V3U A;  1MPD A;  1FQE A;  2VD3 A;  1UIV A;  4G68 C;  2VGQ A;  3H6U A;  1B0L A;  3MVX A;  2ABH A;  2Y5L A;  4OEV A;  2L5V A;  1DPE A;  4JXI A;  1F9B A;  5LOM A;  4OQO A;  4H8J A;  3TFL A;  4QXD A;  2DDK A;  2Y7P A;  5DVI A;  1FQC A;  2HPG A;  4XF5 A;  1OQH A;  1XC1 A;  4F1V A;  2CZH A;  3MWB A;  3FJG A;  2HXR A;  5IZZ A;  4OA4 A;  3B7D A;  4I9D A;  4BDN A;  3S9M C;  4BDM A;  3USD A;  1TT1 A;  3OEN A;  3OEK A;  4U1O A;  2H4I A;  3FUZ A;  4P47 A;  2XA5 A;  1A99 A;  2FA7 A;  4NN3 A;  4NGU A;  4OFL A;  1MQG A;  1N7W A;  2I4B A;  3EQ1 A;  3K4U A;  4H1X A;  2NOO A;  1LFH A;  4Z7E A;  3FV1 A;  1GR2 A;  3FVG A;  4N6P A;  2ONR A;  2Y7W A;  5H8F B;  4N91 A;  4KHZ E;  2F3D A;  3RTF B;  4JB7 A;  3B8B A;  4GWY A;  3SEU A;  1MDP 1;  2O69 A;  1QKA A;  1B2H A;  4H67 A;  4N15 A;  1IIT A;  2ZNU A;  1FRP A;  1VDW A;  2QPQ A;  5ITP A;  4HE1 A;  5FTI A;  5IGA A;  2WBB A;  1NNK A;  5AA2 B;  3C31 A;  4O3A A;  4MBP A;  5A5L A;  4KD5 A;  3WAF A;  1FCK A;  4P8B A;  3N6T A;  4MMP A;  1B3G A;  1EZO A;  1H43 A;  4MCO A;  1IXH A;  1IIW A;  1MQJ A;  1NUY A;  5IZ3 B;  4IY5 A;  4KCC A;  2ZYM A;  2OLB A;  5JK4 A;  3HHG A;  2H99 A;  4I3Y A;  4G61 A;  4GD5 A;  2D3I A;  4G68 A;  3D1R A;  2D21 A;  4G8M A;  4U1Z A;  4NF6 A;  3TEP A;  2DXR A;  2Z23 A;  4RY1 A;  4IY6 A;  3R7X A;  2O1L A;  2XX9 A;  2P3N A;  3EHS A;  2F6G A;  2XXR A;  2QS2 A;  1OVB A;  1D3K A;  2H9B A;  3CSG A;  4P0I A;  4F39 A;  1XHY A;  5IZ1 A;  4AS5 A;  1PB7 A;  3T0J A;  3LBS A;  3IJX B;  2QL3 A;  4GF8 A;  2FIX A;  1O64 A;  2GH9 A;  1Y3P A;  3MQ9 A;  5H8S A;  4DDD A;  2AYS A;  3FBP A;  3VLU A;  3O97 A;  1I6A A;  4NED A;  1NNF A;  1P1U A;  1IZ1 A;  3FAT A;  2DP8 A;  3MVW A;  1FQF A;  2PMS A;  4LON B;  3CSB A;  5DEX B;  4MJO A;  1B40 A;  1N7X A;  2OWS A;  3IK6 B;  4NF6 B;  1INP A;  2Y84 A;  2PT1 A;  5DVF A;  4FJP A;  3MP6 A;  3PPQ A;  2DWH A;  4ND9 A;  1KWH A;  4LQ2 A;  3ILT B;  1QUL A;  4EXK A;  1R6Z A;  3OO8 A;  5ELV A;  2XXH A;  1JEU A;  3FVO A;  1P1O A;  4ELR A;  2E1S A;  3M3F A;  4QF9 A;  2P0S A;  5F24 A;  5DTB A;  3OSR A;  2QJE A;  1B46 A;  1P1W A;  1IUD A;  4HE0 A;  5L9O A;  1USY H;  2E0S A;  3RGY A;  2KR0 A;  4N6K A;  1NNT A;  4MAG A;  3TCG A;  1SW1 A;  3HST A;  1FPL A;  4DXB A;  4AQ4 A;  5ICQ A;  4NMY A;  1O7T A;  4YIC A;  2F5X A;  3QUJ A;  2VP1 A;  1AH5 A;  1FJ9 A;  1ZTY A;  2XXX A;  3IB2 A;  5CM6 A;  4GWU A;  3KN3 A;  3VLV A;  1MQH A;  5ET8 A;  2I58 A;  1PB8 A;  1M5E A;  3TTK A;  2DOJ A;  2XHD A;  4PF8 A;  4I1D A;  2OJT A;  5I56 B;  3JZJ A;  1UTB A;  1DOT A;  2V84 A;  2UVJ A;  4DCX A;  3QMF A;  3TCH A;  1MXV A;  2XXQ A;  3KBZ A;  4IO3 A;  1A55 A;  4P3L A;  4ZZA A;  3EHU A;  4XKR A;  2DE3 A;  4R72 A;  4ECF A;  3SDF A;  3VVD A;  3RY3 A;  3P7I A;  3MC2 A;  3THI A;  3C9H A;  2DWJ A;  4K3F A;  1LBW A;  1NUZ A;  1PBQ A;  2F8D A;  4KR5 A;  4N81 A;  4NF8 B;  4G8N A;  4U22 A;  1UIU A;  3PPO A;  3W15 C;  4TLM B;  1AL3 A;  1XOC A;  1B05 A;  3E3K A;  1MM7 A;  4PET A;  3PD9 A;  3CFZ A;  3UA8 A;  3T9X B;  3VE1 B;  1A8E A;  4GLI A;  2A5S A;  3IJO B;  4PP0 A;  2NUV A;  2PFY A;  2YLN A;  5CRY A;  4R6K A;  3MVZ A;  3GBB A;  3TAJ A;  1G0H A;  2A5T B;  4LP2 B;  3NOH A;  1DK4 A;  4DI4 B;  3S9N C;  4GWZ A;  3CR9 A;  2GHB A;  1GVC A;  2PX1 A;  4P9K A;  3QAX A;  3ISP A;  2R6G E;  2VPO A;  5K2Y A;  2ONK E;  3VDF A;  4GL8 A;  4N07 A;  1FPF A;  1M5F A;  3K6X A;  2ZZW A;  1DCU A;  2OBG A;  3N94 A;  1LCT A;  2I4C A;  4JVD A;  3FJM A;  5TU0 A;  4PFI A;  1LEV A;  1N3X A;  2IA4 A;  4H8I A;  2XD2 A;  4YMB A;  4MFI A;  4PAI A;  3FXR A;  4OVR A;  1MXZ A;  1OLA A;  1WOD A;  2V3Q A;  1FBH A;  4GIZ A;  3PV0 E;  4NF8 A;  3SEW A;  3IOR A;  1TFA A;  1Y4C A;  5CI5 A;  3MJN A;  1DMB A;  4DXU A;  3TCF A;  3MW0 A;  4ZEF A;  1B3L A;  1LGB C;  1WVJ A;  1JP4 A;  4ZE8 A;  3VFJ A;  3O6H A;  1TFD A;  4YU0 A;  2Q2C A;  1BLF A;  1XVY A;  3KBR A;  4IB2 A;  5L9M A;  3Q27 A;  5FHO A;  2REJ A;  4NHB A;  3OOA A;  3SER A;  4IO2 A;  3T93 B;  1B7U A;  4LZ5 A;  3VV5 A;  2CZL A;  2XWO A;  3HN0 A;  3TZA A;  3PMX A;  2XD3 A;  4PAK A;  5TPA A;  1SW4 A;  4QBA A;  4F3P A;  3QK6 A;  3I3V A;  1Q9D A;  5BWJ A;  3MYU A;  4H45 A;  1PDA A;  2M8C A;  4U4X A;  5CBR A;  1B32 A;  4JVC A;  4GX4 A;  1Z7M E;  4GBV A;  1FBC A;  1QJM A;  2GHA A;  1FBF A;  4PBQ A;  4XKQ A;  1JW1 A;  4M1V A;  1JW4 A;  2XWK A;  4PFT A;  1NV4 A;  4XKP A;  1B0H A;  4KFQ A;  3H03 A;  3T1B A;  4LAT A;  1EZ9 A;  4PFR A;  2O51 A;  3H6T A;  4PDH A;  4FEB A;  3T22 A;  4PFB A;  5L8D A;  3KZG A;  4DCY A;  4YAH X;  1QUK A;  3IOU A;  4GWX A;  5I58 B;  2GQ1 A;  1HSJ A;  4QFN A;  5B7D A;  2ZNS A;  1B58 A;  3MAM A;  5I58 A;  5AA2 D;  2Q8M A;  2XXV A;  2PBW A;  4NF4 A;  4WEP A;  4NTL A;  4YZZ A;  4F22 A;  3MVY A;  2NWJ A;  2QMW A;  4OVP A;  1NL5 A;  1T0K A;  3G3I A;  4H5G A;  3IX1 A;  1H44 A;  3DM0 A;  5CC2 A;  1KA1 A;  2VT5 A;  2XXK A;  4R9F A;  1NV2 A;  1JW5 A;  3RPL A;  5T3J A;  1FQA A;  3K0V A;  3U94 A;  4OZ9 A;  1VSO A;  2R9J A;  3U72 A;  1IMA A;  4O7I A;  1MH3 A;  3N26 A;  3QYT A;  3KJT A;  4OMB A;  3F11 A;  1FBP A;  2GRV A;  2PT2 A;  2ZMB A;  1G0I A;  1UQW A;  1LAX A;  5EHS A;  2P3V A;  3E4R A;  4BDO A;  1QUI A;  3JV9 A;  3CFX A;  1FPB A;  4XTC Q;  2ANJ A;  4NF5 A;  2PFZ A;  4FE8 A;  2RF1 A;  3ZKL A;  1URD A;  1QVS A;  1UTB B;  1A7L A;  3V83 A;  4ZEB A;  1MXW A;  2VOZ A;  3B6T A;  3KSJ A;  1B3H A;  4ZEK A;  3CIJ A;  4ISU A;  3U93 A;  2CZK A;  4U21 A;  3OSQ A;  3TOD A;  2YJP A;  4JSO A;  2X7Q A;  2F7B A;  1FJ6 A;  2I0B A;  2I0C A;  3LC8 A;  4WKM A;  2CEX A;  2O7I A;  3O6G A;  4HCY A;  1EYI A;  4H0W A;  1O63 A;  1R9L A;  4X04 A;  3TYH A;  3ECR A;  3LR1 A;  4E0X A;  2RCA A;  4AB5 A;  2DE4 A;  3M3L A;  4BDR A;  2Q2A A;  3FJ7 A;  3RT6 B;  4JSD A;  1I6Q A;  4ESW A;  3CFL A;  5CMM A;  1LBZ A;  4G8H A;  2HAV A;  1LCF A;  4DXC A;  4C0R A;  3PUZ E;  3PUY E;  4OXV A;  2XWV A;  4FAT A;  2RKM A;  4Z0I A;  2FNC A;  2BJJ X;  3TEL A;  2QVV A;  2RC9 A;  2P2A A;  1LBX A;  3KEI A;  3FZV A;  3VLW A;  1Y3Q A;  1IXC A;  3TDJ A;  3BIH A;  3FXB A;  3DP8 A;  4PFY A;  5KCJ A;  5AA4 A;  1MQI A;  4H46 A;  4RK2 A;  5F7V A;  4HS7 A;  3H3G A;  2Y7K A;  1VE4 A;  4LQ5 A;  2REG A;  2FVZ A;  1MG1 A;  3D4G A;  3PUV E;  4LN5 A;  3Q25 A;  2P1S A;  3TMG A;  1DBZ A;  4HTG A;  2HAU A;  1MY2 A;  5EYG A;  3N5L A;  3K02 A;  4QFK A;  5L9S A;  4WXJ A;  3H4Z A;  4F29 A;  3UGW A;  2H5Y A;  5H8N A;  2QVU A;  4OHN A;  4MNC A;  5I5P A;  5ESY A;  4BDL A;  4P1L A;  1EYJ A;  3A3C A;  3OMB A;  3LSL A;  4O94 A;  4G77 A;  5I2N B;  2KQZ A;  1FPI A;  3K01 A;  5TPA B;  1FTA A;  1FTM A;  3BFU A;  4RYA A;  5ITO A;  2B4M A;  5I3S A;  1SI1 A;  2HZL A;  3LV0 A;  2HQ0 A;  4F3S A;  2XXW A;  1MY4 A;  4P0G A;  1NV3 A;  2HXW A;  3Q28 A;  3TQW A;  3ROJ A;  4GWO A;  3KN8 A;  4GXA A;  4OET A;  2WYK A;  1S7Y A;  3VVF A;  1OLC A;  4GFR A;  4LZ7 A;  2UVH A;  3H7M A;  3KFM A;  1EZP A;  1BK4 A;  3IFA A;  2I49 A;  5ET6 A;  3W9V A;  1PB9 A;  3B50 A;  2PCR A;  3IOV A;  4PE5 B;  2ZXT A;  1CE2 A;  4RPO A;  3S9L C;  4YB7 A;  4R6Y A;  1BIY A;  1FPJ A;  4F19 A;  3G3K A;  2AL5 A;  4MH5 A;  2XXT A;  3EF7 A;  1PC3 A;  3FD3 A;  1Y3N A;  1BKA A;  2DVC A;  5EQ7 A;  5CMC A;  3LSW A;  4YMA A;  4OEU A;  4UA8 A;  1AOV A;  3W9W A;  1TXF A;  2DWA A;  1H76 A;  1OMP A;  1UTH A;  3RLF E;  3MZB A;  3SEY A;  2HZK A;  1I69 A;  4EF1 A;  1LAF E;  2OCU A;  1D9V A;  3SKP A;  3G3F A;  4C1T A;  4ONY A;  3V89 B;  4DI3 D;  4QRZ A;  5H8H A;  3OEL A;  4PGP A;  5FHM A;  2ONS A;  1NKX A;  5BUU A;  3FVK A;  1LB8 A;  3IB0 A;  3HFU A;  2B3B A;  4KYD A;  2OWZ A;  3JYR A;  1XI6 A;  5HBC A;  4ZE9 A;  4PFW A;  1LFG A;  3PUW E;  4KXP A;  2VHA A;  3QUF A;  3O66 A;  2IEE A;  4OES A;  4Q5T A;  1MDQ A;  2ESN A;  3O6I A;  4N17 A;  3VXC A;  4LUB A;  2VD2 A;  4KPT A;  3TTL A;  5DEX A;  2V93 A;  1K9Z A;  1AWB A;  3FXU A;  4ESX A;  4FOR A;  1YTV A;  2CZI A;  3RN8 A;  2Q88 A;  3CG3 A;  1J1N A;  4GXS B;  4AS4 A;  3K1P A;  2OK2 A;  4IR8 A;  3C35 A;  1H3D A;  1BTJ A;  4IGR A;  1YZ0 A;  4GOT A;  3T9U A;  3S9E A;  3K6V A;  3OEM A;  1FTJ A;  2Y7I A;  3IL1 B;  5I57 B;  3EN3 A;  3EPE A;  2XXY A;  4MNP A;  5TP9 A;  4BLA A;  2RC8 A;  1YYZ A;  4OYV A;  4RJZ A;  3FAS A;  3DP4 A;  3T96 B;  2X26 A;  5CMK A;  1HSE A;  1SPI A;  3KC0 A;  3I5O A;  4TQU Q;  3GZG A;  3DEL B;  5EYF A;  4QFL A;  1R9Q A;  5I59 B;  3G3H A;  1SVX B;  1ZIU A;  2DWI A;  2AL4 A;  2QVR A;  2QRY A;  3T66 A;  1MY3 A;  1L5T A;  5I2K A;  2RIN A;  1POT A;  5JEI A;  4KYS A;  1NH7 A;  4P11 A;  4DZ1 A;  3E9X A;  4THI A;  3PPN A;  4OTE A;  4NWD A;  1SYH A;  2DVZ A;  2FYI A;  1JQF A;  1A8F A;  1MM6 A;  5HPQ A;  2GFE A;  3S4U A;  2I6E A;  2O68 A;  3ODB A;  3TQL A;  1YCJ A;  5EYH A;  3MPK A;  2DE2 A;  1NFT A;  3PU5 A;  4PE3 A;  3I6V A;  3BKI B;  3K6W A;  2FHY A;  4I3E A;  1B7H A;  4X48 A;  3E13 X;  4O3B A;  1IME A;  2V4C A;  2O7U A;  3U1O A;  3G7W A;  3KC1 A;  2QMX A;  4PAF A;  3PMW A;  1R1N A;  2AIX A;  3IB1 A;  1XS5 A;  3BIG A;  3WAE A;  4TOZ A;  4XXU A;  4X9T A;  3IOT A;  4YKJ A;  4IO4 A;  4NF0 A;  1CNQ A;  4YB6 A;  3U8Q A;  1SW5 A;  1AIV A;  5AA1 A;  2O84 X;  5ICT A;  1B3F A;  1N04 A;  3FVN A;  3HV1 A;  4R2B A;  5TP9 B;  2HFB A;  1JNF A;  4XFE A;  1URG A;  4PGN A;  4BDQ A;  3GLB A;  3KOT A;  1Z7N E;  5IAI A;  4PC9 A;  4U23 A;  1DPP A;  4H65 A;  1US4 A;  1NV6 A;  5A5X B;  4C1U A;  4ZEI A;  4ELQ A;  4FIM A;  5FHN A;  2W7Y A;  5CMB A;  1II5 A;  1ZJL A;  4EF2 A;  2OX3 A;  3L6G A;  4KI0 E;  5J1D A;  1URS A;  1Y4T A;  4ZS9 A;  4O7M A;  1P1Q A;  3RTW B;  2QS4 A;  2ZZX A;  3VXB A;  1FPK A;  2JJK A;  2WX9 A;  1P1N A;  1FPG A;  3TPA A;  1IMD A;  3QSL A;  4OFJ A;  3HO7 A;  3OD7 A;  4HXV A;  1HSL A;  4NQ8 A;  5LDZ A;  4N4U A;  1FQD A;  3T9H B;  2F78 A;  5I59 A;  4N8Y A;  1FW0 A;  2KLF A;  2UVI A;  3O2A A;  3LSX A;  1NV5 A;  2CEY A;  2F35 A;  3SEV A;  4JBZ A;  1B1H A;  3EHT A;  1RDX A;  3TUS A;  4NG7 A;  1B4Z A;  2Q74 A;  4EUO A;  5I2N A;  3KGC A;  1NV1 A;  2O6A A;  3K6U A;  3TTR A;  3MP8 A;  4KCD A;  3U92 A;  1ZLQ A;  2LAO A;  5JTY B;  1LBV A;  3G3G A;  4R6H A;  5AA3 A;  5FTH A;  1SW2 A;  1N76 A;  4DLD A;  1TWY A;  1QKB A;  5EQ9 A;  2RC7 A;  1EU8 A;  2XX8 A;  3A29 A;  1IMC A;  2F7C A;  5I7I A;  2DYX A;  4GRK A;  5H8F A;  1XVX A;  3PPR A;  3IFC A;  4GBW A;  4R73 A;  4XIG Q;  4GX6 A;  4FEC A;  4ELP A;  1GGG A;  1QGX A;  2ZZV A;  3ZKK A;  4NX1 A;  1IQ7 A;  2ALU A;  4U4S A;  4HE2 A;  2RCB A;  4RA1 A;  3PGF A;  4OVS A;  4MF3 A;  1OQG A;  3OO6 A;  4WED A;  1B7Z A;  2FBP A;  3OO9 A;  4OVT A;  1FBE A;  5H8H B;  5EHM A;  1H45 A;  1M5C A;  5DVJ A;  4JWO A;  2DQV A;  1LBC A;  4IO6 A;  3CVG A;  1IMF A;  4POX A;  3MST A;  4H6D A;  2Q89 A;  2CMO A;  3V8X B;  5IM2 A;  1NUX A;  2Z8E A;  4PFU A;  2OZZ A;  2G93 A;  3HHF A;  3MBP A;  1YPN A;  4Q30 B;  1XT8 A;  4I62 A;  3UK4 A;  4F2Q A;  4RXL A;  4E0W A;  1FPE A;  5CBS A;  1CB6 A;  2F6P A;  1EH3 A;  2F7A A;  1SQY A;  2V3T A;  3KJ7 A;  5ET7 A;  2F97 A;  3O28 A;  1MPB A;  4FBP A;  2HHM A;  1OVT A;  5DT6 A;  3GXA A;  5KDT B;  4JWX A;  2FIE A;  4LVQ A;  4JVI A;  1NNP A;  4YKP A;  5DW8 A;  4MX6 A;  4R2F A;  3ZS6 A;  2H98 A;  3MZ1 A;  4XKN A;  1NV7 A;  4MEV A;  3E78 A;  4EXL A;  1B51 A;  2WKY A;  1LBB A;  3CG1 A;  4U2R A;  1S50 A;  2PYY A;  1B5I A;  1SBP A;  2B3F A;  1LFI A;  2XXI A;  2QS1 A;  1FTO A;  5I84 A;  1JEV A;  4RNS A;  2XXP A;  1KA0 A;  3C33 A;  2OPE A;  3D4C A;  2QS3 A;  4QSD A;  3LUY A;  4FAJ A;  3GYY A;  3KSX A;  1LB9 A;  1B5H A;  1BP5 A;  2NVU B;  3RNN A;  1MQD A;  3RPL B;  2F34 A;  4MHF A;  4TLL B;  4PF6 A;  2I3V A;  5JTY A;  5B70 A;  1Y9U A;  2I3W A;  1JVX A;  1FSA A;  1MS7 A;  4O8M A;  1B1X A;  2X7P A;  3OO7 A;  2ZNT A;  2I48 A;  3RUM A;  4Q0C A;  4F2O A;  4QHQ A;  1N0T A;  3U65 A;  1I6B A;  1SD3 A;  1YAE A;  1LAG E;  2UVG A;  1B6H A;  3BBR A;  1NV0 A;  3KG2 A;  4QFO A;  3T9V A;  1WDN A;  5ET5 A;  1DTZ A;  3EKI A;  1Y1M A;  2XX7 A;  4NF4 B;  5I2K B;  5ISU A;  3Q29 A;  3E79 A;  3N6U A;  2QFL A;  4I40 A;  5EQA A;  1SDX A;  5H8Q B;  4QSC A;  4EQB A;  1ZBM A;  1FTK A;  1B9J A;  4ZDM A;  1YXI A;  4P56 A;  1NH8 A;  4MNI A;  2WYP A;  3C4M A;  2Q8J A;  2UYF A;  4IGT A;  1Q35 A;  1EYK A;  4ELO A;  3GBA A;  1MPC A;  3PD8 A;  5HM4 B;  3DLN A;  4NWC A;  2B4L A;  5I57 A;  2NXO A;  1ZU0 A;  5AE4 A;  4YKI A;  1OIB A;  1MY1 A;  4P1E A;  5H8N B;  1KZ8 A;  1MXX A;  3DP6 A;  4UAB A;  1US5 A;  1IXG A;  1JVY A;  3KN7 A;  3M8U A;  2D5W A;  4OVQ A;  2DXY A;  1RDZ A;  4DIG A;  1LLS A;  1D9Y A;  1LBY A;  1S9T A;  1QW0 A;  5K2X A;  1NMU A;  3RQT A;  1RYO A;  2O1M A;  4NAP A;  3RT8 A;  1B4H A;  5KZT A;  3PMV A;  3B6W A;  3ONM A;  3VVE A;  2DSF A;  4LZ8 A;  4QFP A;  4RPN A;  2Y7R A;  1ATG A;  2XWI A;  3K1N A;  1SYI A;  4N6D A;  5AA4 B;  4O3C A;  1NUW A;  3LSF B;  1LST A;  1IMB A;  2A5T A;  4N13 A;  3SES A;  4F3B A;  4MLV A;  5H8Q A;  1FQB A;  1MRP A;  3K2D A;  4HCW A;  3ILU B;  3MP1 A;  1FBD A;  4IO7 A;  1ELJ A;  2F3B A;  2V25 A;  1RYX A;  4HW8 A;  4R74 A;  4G2Z A;  2Z8D A;  4H5F A;  5J16 A;  1RDY A;  2B65 A;  3C34 A;  2MKZ A;  3PTY A;  3K1M A;  5DYH A;  4R75 A;  4OVJ A;  2ZYN A;  4DE8 A;  2VPN A;  3A3U A;  4F31 B;  4KQP A;  3BFT A;  4M4G A;  2Y5K A;  3R6U A;  2F36 A;  4F3G A;  3S2V A;  4KYE A;  3SET A;  3FIR A;  3LUZ A;  3SZP A;  1N84 A;  4R9G A;  3IAZ A;  1MXU A;  3R26 A;  1Y20 A;  4OER A;  1DTG A;  1RKM A;  1M5D A;  4X1D A;  3B6Q A;  2Q9T A;  1AMF A;  4EDP A;  1VFD A;  5KCJ B;  4GWS A;  3TTM A;  3Q26 A;  1Q1K A;  3OXN A;  4Q8R A;  3FXQ A;  4NF5 B;  3MUQ A;  5FBP A;  4OEN A;  3CHG A;  1A54 A;  2HCA A;  5KDT A;  2Z22 A;  3UIF A;  1ZKB A;  5EQ8 A;  3IR1 A;  3A09 A;  3IO6 A;  2H25 A;  3RYD A;  4PQJ A;  1SI0 A;  4PCD A;  4GQO A;  4MLQ A;  1D9Q A;  3PUX E;  2UXA A;  1FPD A;  3K00 A;  3QXM A;  2Z8F A;  3CRB A;  4YKK A;  3KOS A;  4I8C A;  3UOR A;  4XEQ A;  1QUJ A;  2UYE A;  5LTC A;  3AXF A;  1VR5 A;  2THI A;  1MXY A;  3O9P A;  3FV2 A;  4PTK A;  4AB6 A;  3G3J A;  3UN6 A;  1PEB A;  4G4P A;  4GL0 A;  4RK9 A;  2R71 A;  2PVU A;  4F1U A;  1D4N A;  1LAH E;  1B52 A;  2OWT A;  4EQ9 A;  4N8G A;  1P99 A;  1GV8 A;  4OFO A;  5I56 A;  1MH4 A;  3MPL A;  4UAC A;  1ANF A;  5M2V A;  4ZZE A;  2YPN A;  4OAN A;  1UTH B;  2WEF A;  5AA2 A;  1PBP A;  4POW A;  3TKD A;  4FED A;  2XXU A;  1MY0 A;  4X1B A;  3H6W A;  2G29 A;  3CI8 A;  4F1Y A;  3RPW A;  3SEX A;  5F1Q A;  3C36 A;  1K9Y A;  1A40 A;  4QSE A;  5IKB A;  1N3W A;  4GWW A;  1POY 1;  4JWY A;  3TTN A;  3H6V A;  3V5A A;  2BJI A;  3MZ9 A;  2OPD A;  1M5B A;  1VFE A;  3UP9 A;  2WBD A;  2DS9 A;  4X8R A;  1IEJ A;  1FTL A;  3IO4 A;  2R8T A;  4ZED A;  3H06 B;  3QIM A;  1B3E A;  1Y1Z A;  2ZYK A;  4G68 B;  2QSX A;  1JET A;  4L17 A;  3O29 A;  1DSN A;  3FGS A;  4OWD A;  5IZ3 A;  4IO5 A;  1FBG A;  4YB5 A;  1ZMG A;  4ZEC A;  3IOW A;  4F18 A;  4GVO A;  3HCQ A;  1B5J A;  5A5X A;  1IXI A;  4EQ7 A;  4JDF A;  3HPI A;  4LA9 A;  3M3K A;  3ZSF A;  4GX3 A;  3PPP A;  2HEU A;  2ZYO A;  3C32 A;  4MIJ A;  1USY E;  4PDD A;  1GTK A;  1NI9 A;  3L6H A; 
#chains in the Genus database with same CATH homology
 4PBH A;  4O94 A;  4MMP A;  1JP4 A;  4X04 A;  4HE2 A;  4N6D A;  4OVQ A;  4N17 A;  4OAN A;  2Q9T A;  2KQZ A;  1FPI A;  1RDZ A;  4MCO A;  1FTA A;  4YZZ A;  1LBY A;  2WEF A;  1KA0 A;  2DE4 A;  4OVS A;  2B4M A;  5I3S A;  4OVP A;  2HZL A;  4PET A;  4GWS A;  1NUY A;  2OX3 A;  3GYY A;  3LV0 A;  5IZ3 B;  5F24 A;  5EYH A;  1K9Z A;  5J1D A;  2DE2 A;  4NAP A;  4YIC A;  4NHB A;  4HE0 A;  1AWB A;  1KA1 A;  2FBP A;  4OVT A;  5JK4 A;  3RPL B;  1FBE A;  2Y5L A;  1LBZ A;  2KR0 A;  2VT5 A;  4I3Y A;  2L5V A;  4G61 A;  1NV3 A;  2XWO A;  4MHF A;  4N6K A;  4O7M A;  2ZZX A;  5IZZ A;  2FHY A;  1FPK A;  2JJK A;  2WX9 A;  3D1R A;  4PF6 A;  2XXK A;  4PAK A;  1FPG A;  1K9Y A;  4I3E A;  3ROJ A;  2CZI A;  4MAG A;  1NV2 A;  5FBP A;  1IMD A;  1FPL A;  2PFY A;  2XWV A;  4AS4 A;  3CHG A;  5CM6 A;  1IME A;  2V4C A;  4PE3 A;  4QBA A;  4HXV A;  2XWI A;  1FSA A;  2QVV A;  3KC1 A;  4IR8 A;  1Q9D A;  2DDK A;  4QXD A;  1IMF A;  4GWW A;  2P3N A;  5LDZ A;  1LBX A;  2WYK A;  1NUW A;  3MST A;  4O8M A;  3RPL A;  1G0H A;  4N4U A;  5EQ8 A;  2F5X A;  3MYU A;  2HPG A;  4H45 A;  4XF5 A;  5T3J A;  3RYD A;  4F1V A;  3U65 A;  1YZ0 A;  4N8Y A;  2BJI A;  4PCD A;  1D9Q A;  1FJ9 A;  3NOH A;  5IM2 A;  1IMB A;  1BK4 A;  2CZH A;  3IFA A;  1DK4 A;  1IMA A;  1NUX A;  4O7I A;  2HXR A;  1FPD A;  1NV5 A;  1NV0 A;  3BIH A;  2WBD A;  5ET6 A;  2CEY A;  3FXB A;  4JVC A;  4OA4 A;  4GX4 A;  4GWZ A;  3W9V A;  5IZ1 A;  4GBV A;  4GWU A;  3B50 A;  4X8R A;  1FBC A;  2PCR A;  1RDX A;  4AS5 A;  4P1L A;  5ET5 A;  1FBP A;  3BIG A;  3T0J A;  4H46 A;  3EKI A;  2Q74 A;  4NG7 A;  2R8T A;  5ET8 A;  4HCW A;  2FIX A;  4MNP A;  1G0I A;  4P9K A;  1FBF A;  1NV1 A;  1FBD A;  4PBQ A;  3E79 A;  1YYZ A;  3ISP A;  4X9T A;  2P3V A;  2QFL A;  2F3B A;  4I40 A;  4M1V A;  1FPE A;  2VPO A;  4PF8 A;  1FPJ A;  5EQA A;  2XWK A;  4NF0 A;  1LBV A;  4XEQ A;  4F19 A;  1SPI A;  1CNQ A;  3FBP A;  3KC0 A;  2FVZ A;  2XA5 A;  4P47 A;  5LTC A;  1FPB A;  1FPF A;  1NV4 A;  4NN3 A;  4NGU A;  4LN5 A;  4PTK A;  2ZZW A;  1YXI A;  1DCU A;  2PFZ A;  3T1B A;  5EQ7 A;  4P56 A;  5ET7 A;  4MNI A;  2WYP A;  4PFR A;  4FBP A;  4JVD A;  3QMF A;  5IZ3 A;  3W9W A;  5J16 A;  2HHM A;  4PDH A;  1RDY A;  5EQ9 A;  1FBG A;  4PFI A;  1DBZ A;  3A29 A;  1IMC A;  1LEV A;  3KBZ A;  4MJO A;  2MKZ A;  1EYK A;  5EYG A;  4N91 A;  4P3L A;  3PTY A;  2QVR A;  2HZK A;  4PFB A;  5I7I A;  2FIE A;  2CZK A;  2F3D A;  1INP A;  4F1U A;  4JVI A;  3B8B A;  4F18 A;  4GWY A;  4DI3 D;  2DE3 A;  2VPN A;  4PAI A;  4OVR A;  4XFE A;  5DW8 A;  4MX6 A;  4DI4 B;  3IFC A;  4GWX A;  1FBH A;  2V3Q A;  4N8G A;  2B4L A;  4GBW A;  4N15 A;  4PGP A;  2QVU A;  1FRP A;  1VDW A;  1NV7 A;  2GQ1 A;  2QPQ A;  3HFU A;  1FJ6 A;  4MEV A;  2Y5K A;  4GX6 A;  4HE1 A;  4PGN A;  2OWZ A;  4PAF A;  4GX3 A;  4MNC A;  3E78 A;  5I5P A;  2WBB A;  4NQ8 A;  5IGA A;  5ESY A;  1XI6 A;  1LBW A;  1NUZ A;  2CEX A;  4PC9 A;  5A5L A;  1QGX A;  4MIJ A;  1EYJ A;  2ZZV A;  3LUZ A;  1KZ8 A;  4N81 A;  4NX1 A;  4P1E A;  4KXP A;  1NV6 A;  4HCY A;  3SZP A;  1EYI A;  4PDD A;  2Q8M A;  2DVZ A;  4UAB A;  4P8B A;  1NI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...