5EQ7A

Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with free phosphate
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
265
structure length
257
Chain Sequence
QLNHFSDVANKAANAAGDVIRKYFRKNNFLSPVTIADQSAEEAMVSVILDNFPSHAVYGEEKGWRCKQDSADYVWVLDPIDGTKSFITGPLFGTLIALLQNGTPILGIIDQPVLKERWIGITGKRTTLNGQEVSTRTCADLSQAYLYTTSPHLFSGDAEEAFIRVRDKVKIPLYGCDCYAYALLSSGFVDLVVESGLKPYDFLALIPVIEGSGGVITDWKGHQLRWEASPLSIATSFNVVAAGDKQIHQQALDSLQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Inositol monophosphatase
publication title Structural Studies of Medicago truncatula Histidinol Phosphate Phosphatase from Inositol Monophosphatase Superfamily Reveal Details of Penultimate Step of Histidine Biosynthesis in Plants.
pubmed doi rcsb
source organism Medicago truncatula
total genus 83
structure length 257
sequence length 265
ec nomenclature
pdb deposition date 2015-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5eq7A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5eq7A02
1VDWA 4HE0A 3A29A 4GX3A 1IMBA 1IMFA 3ROJA 4H45A 1FPKA 5IZ1A 2QVVA 4QXDA 2F3DA 5A5LA 1FBGA 3D1RA 2FHYA 2CZIA 3LUZA 2FBPA 1FPIA 4IR8A 5EQ8A 1YZ0A 4O7IA 1FBHA 1EYJA 1NV4A 4GWUA 4AS4A 4I40A 4FBPA 2HHMA 1LBZA 1RDYA 4HE1A 2FIEA 2OWZA 5F24A 1NV6A 2FVZA 2GQ1A 2WBBA 4N81A 4HE2A 4PTKA 2QVRA 1BK4A 1Q9DA 2P3VA 1IMCA 4H46A 1FBPA 2Q8MA 1D9QA 2PCRA 4GX4A 5ESYA 1FBDA 3LV0A 2QVUA 1FBCA 1AWBA 4GWYA 1RDZA 5EQAA 2P3NA 5EQ9A 2CZHA 1LBWA 4GWZA 5FBPA 5DW8A 1FBEA 4GBWA 1NUWA 2WEFA 5I3SA 1NUYA 3T0JA 1FPEA 4KXPA 4G61A 3BIHA 3FBPA 3IFAA 1LBVA 1SPIA 1FPBA 5LDZA 1NUXA 1G0HA 2Y5LA 2CZKA 1K9ZA 1QGXA 1XI6A 5ET6A 3RPLB 2Q74A 4I3EA 5IZ3A 1FPGA 4GWSA 1DCUA 1K9YA 3KBZA 3KC0A 2R8TA 5ET5A 1EYIA 1NV7A 1INPA 1NV3A 1NV0A 2JJKA 1FPFA 1FJ9A 2FIXA 2QFLA 3IFCA 1FRPA 1DBZA 4I3YA 1FPLA 4AS5A 1NV5A 2DDKA 2F3BA 1G0IA 5T3JA 1IMEA 1FTAA 1DK4A 1IMAA 1LEVA 1KA1A 5J16A 1NUZA 2OX3A 1JP4A 1LBXA 1FPDA 1CNQA 5EYGA 4GWXA 1KA0A 2VT5A 3B8BA 4GX6A 3RYDA 1NI9A 1LBYA 1FBFA 1YYZA 1RDXA 1FJ6A 5ET8A 1KZ8A 1FSAA 1NV2A 5ET7A 5IZ3B 2BJIA 1EYKA 1NV1A 4GBVA 1FPJA 3KC1A 3QMFA 4GWWA 1YXIA 1IMDA 2WBDA 2Y5KA 3BIGA 5EQ7A 5EYHA 3RPLA 4HXVA 4MJOA
chains in the Genus database with same CATH superfamily
4HE0A 2OPDA 4H65A 3VLVA 5AA3A 4YKJA 3D1RA 2V25A 3K02A 2CZIA 1PDAA 2D5WA 3OO9A 1LCFA 1MY4A 3HCQA 3SEVA 1FTJA 4N6DA 4I40A 4OERA 1QKAA 3CSBA 1AIVA 3U8QA 3MUQA 4PTKA 1URGA 1ZKBA 4FORA 4MNIA 3B6WA 2F78A 4FIMA 1MY3A 4ZEDA 4F3GA 1FBCA 5I56A 4OVRA 2REJA 3K6UA 1JW5A 1LAXA 2WEFA 5CC2A 3Q26A 3FBPA 4MMPA 1FW0A 3V89B 4Q5TA 1USYE 4GVOA 1LB8A 3IOUA 3L6HA 5LOMA 3P7IA 1NV7A 1MXXA 4H8IA 3MC2A 2E0SA 3PMVA 5CRYA 3BFTA 1Y20A 1NV5A 4PQJA 2B4MA 5I2KB 1M5FA 3IR1A 3U94A 5K2YA 4RPOA 3T93B 1LAFE 4GXSB 3MP1A 2F36A 1LFGA 2Y7PA 5A5XB 4PETA 2DWJA 4RK2A 4Q30B 4F18A 3SERA 4ND9A 1NL5A 4NTLA 3RUMA 1HSEA 4OHNA 3H03A 5DEXB 2QVVA 3V8XB 3IB2A 2FBPA 1XC1A 1YZ0A 4MH5A 4BDNA 1FQDA 1Y3PA 2ZZXA 5KCJA 2CEYA 5FHOA 2FIEA 1NV6A 2A5SA 1MDP1 3TCHA 1IMCA 1NFTA 1P1UA 1P1OA 4X04A 5I2KA 4I62A 4R6KA 2QVUA 3BBRA 2DXYA 5DVFA 1QW0A 1LBWA 2XXVA 4DIGA 1NUWA 4RY1A 2V93A 1WDNA 4PC9A 3BIHA 5FHNA 4XF5A 1F9BA 4TLLB 4OVSA 1Q35A 3ECRA 3AXFA 3CI8A 4XKPA 4OVPA 2ZZWA 4KQPA 4WKMA 4LQ5A 2OWSA 3H6UA 3C35A 1R1NA 1KWHA 4AS5A 3JYRA 1H45A 3BFUA 2ONRA 4F3BA 1MRPA 3O29A 2OZZA 2XWKA 2R9JA 3TTKA 2CEXA 5TP9A 1CNQA 4X8RA 2XX7A 4G2ZA 4GX6A 1QUJA 2GRVA 1ZJLA 4M1VA 4C1UA 3CR9A 5ET8A 4LVQA 3MP8A 1NV2A 5ET7A 5KDTB 3PUXE 3C36A 3KJ7A 4P11A 4IGRA 1EZOA 1IMDA 3SEWA 5EYHA 3C33A 4IO2A 3PUWE 2AIXA 4UABA 4NMYA 4RXLA 4IY6A 2FHYA 5FTIA 3T9XB 3KOTA 3TEPA 1TT1A 4O7IA 4GWUA 2PX1A 4KYSA 5TPAA 3K0VA 1FTKA 2WYPA 3C32A 2B65A 4XKRA 2Y7WA 3GBAA 2DOJA 2QRYA 3ODBA 3SZPA 3KSXA 1NKXA 1RDZA 4R72A 5FBPA 5IGAA 3IJOB 5I3SA 3GLBA 2UYFA 3SEUA 3KGCA 3IOVA 2M8CA 1ZU0A 1URSA 3FJGA 3UA8A 1K9ZA 3RPLB 2H99A 4JBZA 4PFBA 1FPGA 3HSTA 4AB6A 4P3LA 2FIXA 1B9JA 4TLMB 1XT8A 5ITPA 4PP0A 2GH9A 1B5HA 1DK4A 2VPOA 3PUYE 2XA5A 4O3BA 1FPDA 2P2AA 1QULA 4DCXA 1NNPA 4G68B 3A09A 4F1VA 5IZ3B 2BJIA 1NV1A 5CI5A 1ZMGA 3G7WA 4XTCQ 3IO4A 3G3GA 3K00A 1IIWA 4K3FA 4MCOA 4HXVA 4DLDA 1SBPA 1B1HA 4OWDA 4GX3A 2IEEA 4JVDA 3OMBA 2E1SA 3O66A 3S9MC 1JNFA 2Y7IA 3PPRA 2HAVA 1MDQA 4U4SA 4R9GA 1JEUA 4I9DA 2QVRA 5L9SA 3N6TA 5DTBA 5ELVA 1D9QA 3D4GA 1FBDA 3K4UA 5CMMA 3CFXA 3FV1A 4NE4A 3K6WA 5B7DA 2F6PA 2PFZA 3VVEA 4PBHA 4N6PA 1N84A 1JW4A 2BJJX 1D4NA 4KXPA 1B7ZA 1NUXA 3C34A 2WX9A 4I3EA 5CBSA 5IZ3A 4GWSA 1DCUA 3SETA 3KEIA 1B58A 1SD3A 3MWBA 3U72A 1IXGA 1SI1A 4Z0IA 1I6BA 3LUYA 5K2XA 3H06B 2DDKA 3V5AA 4YB7A 2Y7RA 2Q89A 3FASA 4KHZE 1LB9A 3K2DA 5J16A 1UIVA 1ZTYA 4O8MA 2QMWA 1B32A 4JB7A 4MIJA 1KA0A 1UQWA 2RCAA 1DTGA 3THIA 3RTWB 1SW5A 1FSAA 3TTLA 1XVXA 4I1DA 2DWIA 3T9VA 1VFDA 2KQZA 3UIFA 3JZJA 2DP8A 4U1ZA 1FCKA 4NN3A 4OFOA 3PMWA 4OFJA 2F7BA 2Z22A 5EQ8A 4ELPA 4P9KA 1TFDA 4O3CA 4PAIA 4QSCA 2O84X 2DSFA 4X1DA 3CIJA 4YKKA 4N15A 3RNNA 3CG3A 4QFPA 1D3KA 2OCUA 4NF6B 4Q8RA 3TCGA 2P3VA 3RT8A 4PAFA 3UGWA 1MQDA 3LSFB 3O6HA 1B40A 2CZHA 3PD9A 3W15C 4ZEIA 1I6AA 3FD3A 4H67A 1TFAA 5CMKA 2V3TA 2HXWA 1EZ9A 1B7HA 1O7TA 5DT6A 4EXKA 3UK4A 2Q74A 3N94A 2R8TA 5ET5A 1BIYA 4FE8A 1FPFA 2RC7A 1PEBA 5HM4B 5F1QA 4GWOA 1G0IA 1P1WA 4GXAA 2OBGA 2QS3A 4U22A 1LFHA 4C0RA 3FJ7A 3EHUA 3K1MA 1B6HA 4N07A 3CFZA 2KLFA 1DSNA 3IB1A 3KJTA 2YJPA 3LSWA 4NEDA 5H8QB 4P1LA 4PFYA 3OO7A 5ITOA 2H25A 1UTHA 4NF6A 4FAJA 1D9YA 4KYDA 4KD5A 1A55A 2Y7KA 4GIZA 1N0TA 2KR0A 4H5FA 3SESA 2O6AA 3KSJA 5F7VA 3UORA 5L9OA 4IR8A 3RPWA 3L6GA 2XXHA 4F19A 4N8GA 5I59A 2DQVA 1CE2A 2XWVA 2YLNA 2DXRA 3M3KA 1A8EA 3E79A 2GQ1A 1BLFA 4IO7A 4IO4A 4POWA 4WEPA 4PGNA 1FTOA 2Q8MA 3USDA 4GX4A 1B2HA 3C31A 1Y1ZA 3MW0A 3TDJA 4P0GA 4DI3D 2ZYNA 3CVGA 4JXIA 3GZGA 3WAEA 4GRKA 2RINA 1YTVA 1XOCA 1Q1KA 2DVZA 3DP6A 4NF0A 1DTZA 2X7QA 5FHMA 3TQLA 4MF3A 5H8QA 5CMBA 3KBZA 2DYXA 2RKMA 2XXUA 4R6YA 3NOHA 4LONB 2I3WA 1B7UA 2ZMBA 3FJMA 4GL0A 2OWTA 1TWYA 2XXIA 3I6VA 2DE4A 3H6WA 1MM7A 5I57B 5KCJB 4ZZAA 3B7DA 2F35A 3H6TA 3LSXA 4ZEBA 3OO8A 1FJ6A 2O1MA 4DXUA 4ECFA 3D4CA 4QSDA 4P56A 1JEVA 4NQ8A 4N4UA 1MM6A 3K6XA 2QS1A 3VXBA 3IOWA 2XD2A 2F8DA 3IK6B 5ISUA 1DMBA 5H8HB 4G68C 4PE3A 4PFWA 2Z23A 4MLVA 3I5OA 4F3SA 1B05A 5M2VA 1O63A 4G8HA 1NV4A 1B0HA 1Y4TA 2HPGA 1R9QA 1Y3NA 4R73A 1EZPA 4EXLA 5AA1A 5DYHA 5F24A 1ZLQA 3FVOA 2P0SA 4XKNA 4NF5A 5TP9B 2RF1A 2Q8JA 2F97A 3LV0A 5I5PA 1AWBA 3HHFA 4JSOA 5EQAA 2P3NA 4BLAA 1JQFA 2W7YA 5I57A 2R6GE 1MQJA 3OELA 3T0JA 3IORA 1SPIA 5TU0A 4GF8A 1LCTA 1G0HA 1POY1 3RGYA 1QGXA 4OXVA 3VVFA 4G8NA 4F22A 4XXUA 1SYIA 2WYKA 4OYVA 3OOAA 1QUIA 5I84A 1I69A 3G3HA 4I3YA 4XFEA 4E0XA 4F31B 1AL3A 1US4A 2HAUA 5H8HA 2PBWA 3IJXB 2OLBA 5TPAB 1N76A 3SDFA 2D21A 4ELRA 1GGGA 1KZ8A 3C4MA 3FUZA 1S50A 4ZECA 5ICTA 1JVYA 1NNFA 4OA4A 1JVXA 1A99A 2B4LA 3N6UA 2GHBA 4YB6A 4MJOA 3RY3A 2ALUA 4LN5A 3FGSA 3MP6A 4P1EA 4DCYA 2A5TA 4NWDA 1UTBA 1B3HA 3FXRA 3H4ZA 1FPIA 3H7MA 4N17A 5IAIA 2Q9TA 3CHGA 1EYJA 3PUZE 4HTGA 3O6GA 2L5VA 5DVIA 4MHFA 4NF4B 2FVZA 1MPCA 3PMXA 4OQOA 4ZE9A 3PPQA 3QXMA 2Z8EA 2ZNSA 3W9VA 4HCWA 3PD8A 4PF8A 4MNCA 3PV0E 4GWYA 1EH3A 5L8DA 4OVQA 1II5A 1MQIA 4EQ7A 1NUYA 4YAHX 1VFEA 3MBPA 1LBCA 3MZ9A 3DP8A 1XHYA 2Z8FA 3FVNA 1YAEA 3QYTA 4YKPA 3O2AA 3IB0A 4X1BA 3MQ9A 2DVCA 4MNPA 3KC0A 3KN8A 3EKIA 3QAXA 4O3AA 2ZYMA 4U2RA 3QK6A 1FRPA 4R75A 1A8FA 1M5CA 4U1OA 5T3JA 2QPQA 3R26A 1OQGA 3EPEA 4R9FA 4EQBA 1MPDA 1N7WA 2XXQA 4LATA 3TCFA 3S9LC 2QJEA 4TQUQ 1OLAA 1NI9A 1IZ1A 5AA2A 4GD5A 1RDXA 2V3UA 2I4CA 4NAPA 4WXJA 2F34A 1FQEA 4NF4A 1M5EA 1N04A 2HEUA 4PFTA 2ANJA 2XWOA 1VDWA 2O7UA 3F11A 4P0IA 4ESXA 3FVGA 4PGPA 1IITA 1L5TA 1DOTA 2ESNA 1A40A 5H8SA 2QS2A 4KCCA 3HFUA 3ILUB 4MX6A 1R6ZA 4F3PA 3PGFA 1POTA 4ZEKA 3IOTA 2PMSA 2IA4A 4YMBA 2ZXTA 4JVIA 1IQ7A 4R2FA 3R7XA 1MXWA 3IX1A 2AYSA 3EN3A 1FQAA 5CBRA 2PVUA 3FXUA 4C1TA 4U4XA 4PCDA 5BWJA 4GOTA 3VFJA 4PDHA 3KN7A 4L17A 3TQWA 4N91A 1B3LA 4F39A 4YICA 1MXUA 2Q2CA 4X48A 1FJ9A 3GYYA 1S9TA 2F3BA 2XXPA 1B52A 2NOOA 1LAHE 4EQ9A 1Y4CA 2OX3A 4ELOA 5KZTA 3T66A 3JV9A 1QJMA 2ZNUA 2CMOA 1PC3A 2UVJA 1YYZA 4AB5A 4RPNA 3PUVE 4EF2A 2Y84A 1EYKA 5IM2A 3MVYA 4OEUA 3VVDA 1H3DA 1NMUA 5LTCA 5EQ7A 3OENA 4PAKA 4JWOA 1ATGA 3TMGA 2P1SA 3K6VA 4H45A 3OSRA 5ICQA 5IKBA 2ZYKA 3E3KA 2I4BA 4KYEA 1B4ZA 1SQYA 2MKZA 4PF6A 3MZBA 5I58B 4QBAA 4O7MA 4HE1A 3V83A 2DE3A 4IGTA 4JWYA 3MZ1A 1ZBMA 2G93A 3KZGA 1B5IA 1BK4A 1Q9DA 5L9MA 1FQBA 4OMBA 4QFOA 4JVCA 2PCRA 4IB2A 4XEQA 4NF8A 2B3BA 1PB9A 1RYOA 1IXIA 3LBSA 5DVJA 4H0WA 4TOZA 2HXRA 4NX1A 1OMPA 4IO5A 4G61A 4KI0E 1MXZA 2UYEA 4OANA 1UTHB 4QSEA 5ET6A 1XI6A 1MG1A 4ISUA 1IXHA 2VD3A 3K1PA 2NUVA 1EYIA 1FTMA 1VSOA 1NV3A 5AA2D 2FNCA 3IFCA 4OEVA 4OESA 1N3XA 1LGBC 1Y1MA 3TUSA 3KOSA 2I48A 1IMAA 3B50A 3FZVA 1I6QA 3IO6A 4BDRA 4DE8A 1MH3A 2WKYA 3TYHA 5I59B 3W9WA 4NGUA 4QF9A 1N3WA 1B5JA 4R6HA 3T9HB 3O9PA 3FV2A 1FTLA 1VR5A 4PFRA 5I58A 1YPNA 4EUOA 1OLCA 1FPJA 3E4RA 3PPNA 2PFYA 3E9XA 4IY5A 2NWJA 4AQ4A 1YXIA 4YZZA 3UN6A 3U93A 3I3VA 2XWIA 3A29A 3VDFA 3BKIB 3QIMA 3PU5A 4XIGQ 3TTRA 4ZDMA 4YU0A 5IZ1A 3TKDA 2VHAA 2LAOA 1SYHA 3MPKA 4WEDA 1PB8A 4G4PA 2F7AA 1LBZA 4U21A 1RDYA 5H8NB 1R9LA 4OVTA 4U23A 4DZ1A 1MQGA 4RNSA 4OENA 3HHGA 4GQOA 5EYFA 4ELQA 4PE5B 1PB7A 5DW8A 1A54A 1SVXB 2HZKA 1BTJA 3QUFA 4KPTA 2ZNTA 2CZLA 3MSTA 2Y5LA 2CZKA 3KFMA 3Q28A 4HS7A 1IUDA 2V4CA 1B46A 2DE2A 4GL8A 2O1LA 4JWXA 1P99A 5AA4B 3U65A 1SW4A 1LEVA 1KA1A 1M5DA 2GFEA 3MYUA 3IL1B 1LBXA 2O68A 4E0WA 3B8BA 4G8MA 2HCAA 1J1NA 3ILTB 1B3FA 4NF5B 3H6VA 5CM6A 4ZEFA 5H8NA 1H76A 3E78A 2XXRA 3Q29A 3HV1A 2XXTA 1DPPA 2VP1A 4MEVA 4FATA 3M3FA 3TFLA 3RT6B 1FQFA 3SEYA 4ONYA 2R71A 1Z7NE 4H8JA 4HCYA 2I58A 4LA9A 5H8FB 4LZ8A 1SW2A 1MPBA 4O94A 4QRZA 1M5BA 5JEIA 1LSTA 2XXYA 4ZE8A 4LQ2A 4LZ5A 4YMAA 3GBBA 4N8YA 5CMCA 5BUUA 5AA4A 3Q25A 3CG1A 3EHTA 4GWZA 2RCBA 4BDOA 5EHSA 4R2BA 1GV8A 3TTNA 2HFBA 2F5XA 2OJTA 3IFAA 2XX8A 5LDZA 4H5GA 2H98A 4GLIA 2FA7A 4RJZA 1A7LA 3KG2A 3N5LA 1ZIUA 2QS4A 2JJKA 2A5TB 2QFLA 1UTBB 1DPEA 2HZLA 4EDPA 1AH5A 2PT2A 1URDA 2ONSA 2QSXA 2X7PA 1NUZA 2QMXA 4MLQA 2Q88A 3PPOA 1MY2A 4KCDA 2NVUB 1FBFA 5H8FA 4HW8A 3FVKA 1MXVA 2NXOA 4GFRA 1OVTA 3ONMA 4KR5A 1YCJA 2XXKA 4ZS9A 1OIBA 3U1OA 2D3IA 1IMBA 1MQHA 1Y3QA 1B3GA 4P47A 1USYH 1LBBA 3FIRA 4ZZEA 2F7CA 1FBHA 4OETA 4Q0CA 2PT1A 3R6UA 2XXWA 3S2VA 3G3FA 4N81A 5A5XA 2REGA 4EF1A 4ESWA 2Z8DA 1LFIA 4PDDA 5ESYA 4THIA 4YKIA 3DELB 1QUKA 3TAJA 5AA2B 4N13A 3TODA 3A3UA 5I7IA 2X26A 3MJNA 3ZKKA 1P1QA 1N7XA 5DEXA 3QUJA 3E13X 5B70A 1WVJA 2DS9A 3Q27A 1XVYA 3RN8A 3QSLA 3IAZA 2YPNA 1D9VA 2V84A 1AOVA 2O7IA 3FATA 1NNTA 4LZ7A 4PFUA 5IZZA 4DXCA 3LR1A 4F29A 2VT5A 2UVHA 3RYDA 4FEDA 4BDMA 3SEXA 3U92A 3OXNA 4DDDA 4RYAA 1MY1A 1OVBA 4IO3A 4NG7A 3TTMA 3OEKA 2VPNA 1IMFA 3EQ1A 3RLFE 5A5LA 2H5YA 4PBQA 3K01A 4OFLA 4AS4A 1JETA 2HHMA 2I49A 1S7YA 2UVGA 5I2NB 2OPEA 1NNKA 4HE2A 1Z7ME 5KDTA 1FBPA 2H4IA 1XS5A 3ZKLA 1CB6A 2OK2A 1SDXA 1RYXA 1SW1A 4MFIA 2I0BA 3S4UA 2VOZA 1Y9UA 5EQ9A 4GBWA 1IEJA 1IXCA 1LBVA 1FPBA 2H9BA 3TPAA 3KBRA 1QVSA 4DXBA 4JSDA 3OEMA 4F1UA 1K9YA 4X9TA 3RQTA 4MAGA 1NV0A 1DBZA 1FPLA 1H43A 1FTAA 2DWAA 2VGQA 3CFLA 1LAGE 3CRBA 2AL5A 2PYYA 1GR2A 1B51A 4OZ9A 4RA1A 5EHMA 3T9UA 3VXCA 3KC1A 1T0KA 5FTHA 4GWWA 1HSLA 5I2NA 4NF8B 3RPLA 1LLSA 1UIUA 2RC9A 3O28A 4N6KA 3ROJA 1FPKA 4NWCA 3WAFA 1B0LA 2F6GA 4UACA 3LUZA 5HPQA 5HBCA 4UA8A 4BDQA 1PBQA 4FBPA 3FXQA 2ZZVA 4F2QA 2OWZA 4G68A 4DI4B 2FYIA 1MS7A 2WBBA 3HO7A 4F2OA 3CSGA 1HSJA 5JTYB 4H46A 4IO6A 2ZYOA 2GHAA 3GXAA 4H1XA 4PFIA 3UP9A 3MVXA 2AL4A 1GVCA 5JK4A 1EU8A 3DM0A 3N26A 1TXFA 1NH7A 1GTKA 5AE4A 3K1NA 4QFLA 3OO6A 2I3VA 1ELJA 3OD7A 1IMEA 3B6TA 3PTYA 4JDFA 4OVJA 1JP4A 2XD3A 2ONKE 4GWXA 2I0CA 3MVZA 3O6IA 1LBYA 3TZAA 1BP5A 3VV5A 2XHDA 3QMFA 2V3QA 3G3JA 3ISPA 4XKQA 2I6EA 2WBDA 4M4GA 4QHQA 4QFNA 3BIGA 1OQHA 3MPLA 2Q2AA 3LSLA 5JTYA 1SI0A 2UXAA 1QKBA 3VLWA 4KFQA 4FEBA 4OTEA 1PBPA 1FQCA 4I8CA 3EF7A 3HPIA 3TELA 1US5A 4QXDA 2F3DA 1P1NA 1FBGA 2QL3A 4F1YA 3ZS6A 3T22A 1BKAA 4R74A 3LC8A 3A3CA 3B6QA 1MXYA 2ABHA 4LP2B 2RC8A 1ANFA 2XXXA 3O97A 3S9NC 3DP4A 4MBPA 1B4HA 1FBEA 2VD2A 4G77A 4H6DA 1FPEA 3MAMA 2UVIA 2THIA 1B1XA 2O51A 2G29A 3SKPA 4QFKA 1WODA 1O64A 3RTFB 3T96B 3S9EA 3HN0A 1RKMA 1AMFA 3PPPA 1INPA 1MY0A 2DWHA 4YB5A 3G3KA 4RK9A 3EHSA 3MVWA 3OSQA 4Z7EA 3VE1B 4BDLA 1H44A 3VLUA 4NHBA 5I56B 2B3FA 3DLNA 2XX9A 3FXBA 1B3EA 5J1DA 5EYGA 3ZSFA 2O69A 4FJPA 1MH4A 3KN3A 3H3GA 3G3IA 4FECA 4POXA 4P8BA 1VE4A 4LUBA 4GBVA 1JW1A 1NH8A 3M3LA 2HQ0A 3C9HA 3T1BA 3M8UA 2Y5KA
chains in the Genus database with same CATH topology
1VDWA 4HE0A 4PGPA 1IMBA 4P47A 4NN3A 3D1RA 3HFUA 2CZIA 5EQ8A 4MX6A 1FBHA 4P9KA 4PAIA 4N6DA 4I40A 4N15A 4JVIA 4N81A 4PTKA 2P3VA 4MNIA 4PDDA 5ESYA 4PAFA 1FBCA 2CZHA 4OVRA 5I7IA 2WEFA 4PCDA 3FBPA 4MMPA 4PDHA 2Q74A 2KQZA 4N91A 2R8TA 5ET5A 1NV7A 4YICA 1FPFA 1FJ9A 3GYYA 1NV5A 2B4MA 2F3BA 1G0IA 2OX3A 5IZZA 2VT5A 3RYDA 1YYZA 4PETA 1EYKA 5IM2A 4P1LA 5LTCA 5EQ7A 4F18A 4PAKA 4NG7A 2VPNA 1IMFA 4H45A 2KR0A 2QVVA 5A5LA 2FBPA 4IR8A 1YZ0A 4PBQA 2MKZA 4F19A 4PF6A 4N8GA 4AS4A 2ZZXA 2XWVA 2HHMA 4QBAA 2CEYA 4O7MA 4HE1A 2FIEA 2DE3A 3E79A 1NV6A 2GQ1A 4HE2A 1BK4A 1Q9DA 1IMCA 4PGNA 1FBPA 4X04A 2Q8MA 4JVCA 4GX4A 2PCRA 4XEQA 2QVUA 4DI3D 5EQ9A 1LBWA 4GBWA 1NUWA 2HXRA 4PC9A 4NX1A 4G61A 3BIHA 1LBVA 1FPBA 4XF5A 2DVZA 4NF0A 4OVSA 4OANA 5ET6A 1XI6A 4OVPA 2ZZWA 4F1UA 1K9YA 3KBZA 1EYIA 4X9TA 4MAGA 1NV3A 3NOHA 1NV0A 3IFCA 4AS5A 1DBZA 1FPLA 1FTAA 1IMAA 3B50A 2DE4A 2XWKA 2CEXA 1CNQA 3W9WA 4NGUA 4X8RA 4GX6A 4M1VA 1FJ6A 5ET8A 4PFRA 1NV2A 5ET7A 1FPJA 3KC1A 2PFYA 4GWWA 4P56A 4NQ8A 1YXIA 1IMDA 4N4UA 5EYHA 3RPLA 4YZZA 2XWIA 3A29A 4N6KA 3ROJA 4UABA 4PE3A 1FPKA 5IZ1A 2FHYA 3LUZA 4O7IA 1NV4A 4GWUA 2HPGA 4FBPA 2WYPA 1LBZA 1RDYA 2ZZVA 2OWZA 4DI4B 5F24A 4OVTA 2WBBA 3SZPA 4H46A 3LV0A 5I5PA 4PFIA 1AWBA 1RDZA 5EQAA 2P3NA 5FBPA 5DW8A 5IGAA 5JK4A 2HZKA 5I3SA 3T0JA 1SPIA 3MSTA 1G0HA 2Y5LA 2CZKA 1K9ZA 1QGXA 3RPLB 2V4CA 4PFBA 1FPGA 2WYKA 4P3LA 2DE2A 2FIXA 4I3YA 4XFEA 1IMEA 3U65A 1DK4A 3PTYA 1LEVA 2VPOA 1KA1A 2XA5A 3MYUA 1JP4A 1LBXA 1FPDA 4GWXA 3B8BA 1LBYA 1KZ8A 4F1VA 5IZ3B 2BJIA 5CM6A 1NV1A 4OA4A 3QMFA 2B4LA 2V3QA 3ISPA 3E78A 2WBDA 3BIGA 4MCOA 4HXVA 4MJOA 4LN5A 4GX3A 4MEVA 4P1EA 4QXDA 2F3DA 4JVDA 1FBGA 1FPIA 4N17A 2Q9TA 4HCYA 3CHGA 1EYJA 4O94A 2L5VA 4MHFA 2FVZA 2QVRA 4N8YA 3W9VA 4HCWA 1D9QA 4PF8A 1FBDA 4MNCA 4GWYA 2PFZA 4GWZA 4OVQA 1FBEA 4PBHA 1NUYA 1FPEA 4KXPA 2F5XA 3IFAA 5LDZA 1NUXA 2WX9A 4I3EA 5IZ3A 4MNPA 4GWSA 1DCUA 3KC0A 3EKIA 1INPA 2JJKA 2QFLA 1FRPA 2DDKA 2HZLA 5T3JA 2QPQA 4NHBA 5J16A 1NUZA 4O8MA 3FXBA 5J1DA 5EYGA 4MIJA 1KA0A 1NI9A 1FBFA 1RDXA 1FSAA 4P8BA 4NAPA 4GBVA 3T1BA 2Y5KA 2XWOA 2XXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDW A;  4HE0 A;  3A29 A;  4GX3 A;  1IMB A;  1IMF A;  3ROJ A;  4H45 A;  1FPK A;  5IZ1 A;  2QVV A;  4QXD A;  2F3D A;  5A5L A;  1FBG A;  3D1R A;  2FHY A;  2CZI A;  3LUZ A;  2FBP A;  1FPI A;  4IR8 A;  5EQ8 A;  1YZ0 A;  4O7I A;  1FBH A;  1EYJ A;  1NV4 A;  4GWU A;  4AS4 A;  4I40 A;  4FBP A;  2HHM A;  1LBZ A;  1RDY A;  4HE1 A;  2FIE A;  2OWZ A;  5F24 A;  1NV6 A;  2FVZ A;  2GQ1 A;  2WBB A;  4N81 A;  4HE2 A;  4PTK A;  2QVR A;  1BK4 A;  1Q9D A;  2P3V A;  1IMC A;  4H46 A;  1FBP A;  2Q8M A;  1D9Q A;  2PCR A;  4GX4 A;  5ESY A;  1FBD A;  3LV0 A;  2QVU A;  1FBC A;  1AWB A;  4GWY A;  1RDZ A;  5EQA A;  2P3N A;  5EQ9 A;  2CZH A;  1LBW A;  4GWZ A;  5FBP A;  5DW8 A;  1FBE A;  4GBW A;  1NUW A;  2WEF A;  5I3S A;  1NUY A;  3T0J A;  1FPE A;  4KXP A;  4G61 A;  3BIH A;  3FBP A;  3IFA A;  1LBV A;  1SPI A;  1FPB A;  5LDZ A;  1NUX A;  1G0H A;  2Y5L A;  2CZK A;  1K9Z A;  1QGX A;  1XI6 A;  5ET6 A;  3RPL B;  2Q74 A;  4I3E A;  5IZ3 A;  1FPG A;  4GWS A;  1DCU A;  1K9Y A;  3KBZ A;  3KC0 A;  2R8T A;  5ET5 A;  1EYI A;  1NV7 A;  1INP A;  1NV3 A;  1NV0 A;  2JJK A;  1FPF A;  1FJ9 A;  2FIX A;  2QFL A;  3IFC A;  1FRP A;  1DBZ A;  4I3Y A;  1FPL A;  4AS5 A;  1NV5 A;  2DDK A;  2F3B A;  1G0I A;  5T3J A;  1IME A;  1FTA A;  1DK4 A;  1IMA A;  1LEV A;  1KA1 A;  5J16 A;  1NUZ A;  2OX3 A;  1JP4 A;  1LBX A;  1FPD A;  1CNQ A;  5EYG A;  4GWX A;  1KA0 A;  2VT5 A;  3B8B A;  4GX6 A;  3RYD A;  1NI9 A;  1LBY A;  1FBF A;  1YYZ A;  1RDX A;  1FJ6 A;  5ET8 A;  1KZ8 A;  1FSA A;  1NV2 A;  5ET7 A;  5IZ3 B;  2BJI A;  1EYK A;  1NV1 A;  4GBV A;  1FPJ A;  3KC1 A;  3QMF A;  4GWW A;  1YXI A;  1IMD A;  2WBD A;  2Y5K A;  3BIG A;  5EQ7 A;  5EYH A;  3RPL A;  4HXV A;  4MJO A; 
#chains in the Genus database with same CATH topology
 4HE0 A;  2OPD A;  4H65 A;  3VLV A;  5AA3 A;  4YKJ A;  3D1R A;  2V25 A;  3K02 A;  2CZI A;  1PDA A;  2D5W A;  3OO9 A;  1LCF A;  1MY4 A;  3HCQ A;  3SEV A;  1FTJ A;  4N6D A;  4I40 A;  4OER A;  1QKA A;  3CSB A;  1AIV A;  3U8Q A;  3MUQ A;  4PTK A;  1URG A;  1ZKB A;  4FOR A;  4MNI A;  3B6W A;  2F78 A;  4FIM A;  1MY3 A;  4ZED A;  4F3G A;  1FBC A;  5I56 A;  4OVR A;  2REJ A;  3K6U A;  1JW5 A;  1LAX A;  2WEF A;  5CC2 A;  3Q26 A;  3FBP A;  4MMP A;  1FW0 A;  3V89 B;  4Q5T A;  1USY E;  4GVO A;  1LB8 A;  3IOU A;  3L6H A;  5LOM A;  3P7I A;  1NV7 A;  1MXX A;  4H8I A;  3MC2 A;  2E0S A;  3PMV A;  5CRY A;  3BFT A;  1Y20 A;  1NV5 A;  4PQJ A;  2B4M A;  5I2K B;  1M5F A;  3IR1 A;  3U94 A;  5K2Y A;  4RPO A;  3T93 B;  1LAF E;  4GXS B;  3MP1 A;  2F36 A;  1LFG A;  2Y7P A;  5A5X B;  4PET A;  2DWJ A;  4RK2 A;  4Q30 B;  4F18 A;  3SER A;  4ND9 A;  1NL5 A;  4NTL A;  3RUM A;  1HSE A;  4OHN A;  3H03 A;  5DEX B;  2QVV A;  3V8X B;  3IB2 A;  2FBP A;  1XC1 A;  1YZ0 A;  4MH5 A;  4BDN A;  1FQD A;  1Y3P A;  2ZZX A;  5KCJ A;  2CEY A;  5FHO A;  2FIE A;  1NV6 A;  2A5S A;  1MDP 1;  3TCH A;  1IMC A;  1NFT A;  1P1U A;  1P1O A;  4X04 A;  5I2K A;  4I62 A;  4R6K A;  2QVU A;  3BBR A;  2DXY A;  5DVF A;  1QW0 A;  1LBW A;  2XXV A;  4DIG A;  1NUW A;  4RY1 A;  2V93 A;  1WDN A;  4PC9 A;  3BIH A;  5FHN A;  4XF5 A;  1F9B A;  4TLL B;  4OVS A;  1Q35 A;  3ECR A;  3AXF A;  3CI8 A;  4XKP A;  4OVP A;  2ZZW A;  4KQP A;  4WKM A;  4LQ5 A;  2OWS A;  3H6U A;  3C35 A;  1R1N A;  1KWH A;  4AS5 A;  3JYR A;  1H45 A;  3BFU A;  2ONR A;  4F3B A;  1MRP A;  3O29 A;  2OZZ A;  2XWK A;  2R9J A;  3TTK A;  2CEX A;  5TP9 A;  1CNQ A;  4X8R A;  2XX7 A;  4G2Z A;  4GX6 A;  1QUJ A;  2GRV A;  1ZJL A;  4M1V A;  4C1U A;  3CR9 A;  5ET8 A;  4LVQ A;  3MP8 A;  1NV2 A;  5ET7 A;  5KDT B;  3PUX E;  3C36 A;  3KJ7 A;  4P11 A;  4IGR A;  1EZO A;  1IMD A;  3SEW A;  5EYH A;  3C33 A;  4IO2 A;  3PUW E;  2AIX A;  4UAB A;  4NMY A;  4RXL A;  4IY6 A;  2FHY A;  5FTI A;  3T9X B;  3KOT A;  3TEP A;  1TT1 A;  4O7I A;  4GWU A;  2PX1 A;  4KYS A;  5TPA A;  3K0V A;  1FTK A;  2WYP A;  3C32 A;  2B65 A;  4XKR A;  2Y7W A;  3GBA A;  2DOJ A;  2QRY A;  3ODB A;  3SZP A;  3KSX A;  1NKX A;  1RDZ A;  4R72 A;  5FBP A;  5IGA A;  3IJO B;  5I3S A;  3GLB A;  2UYF A;  3SEU A;  3KGC A;  3IOV A;  2M8C A;  1ZU0 A;  1URS A;  3FJG A;  3UA8 A;  1K9Z A;  3RPL B;  2H99 A;  4JBZ A;  4PFB A;  1FPG A;  3HST A;  4AB6 A;  4P3L A;  2FIX A;  1B9J A;  4TLM B;  1XT8 A;  5ITP A;  4PP0 A;  2GH9 A;  1B5H A;  1DK4 A;  2VPO A;  3PUY E;  2XA5 A;  4O3B A;  1FPD A;  2P2A A;  1QUL A;  4DCX A;  1NNP A;  4G68 B;  3A09 A;  4F1V A;  5IZ3 B;  2BJI A;  1NV1 A;  5CI5 A;  1ZMG A;  3G7W A;  4XTC Q;  3IO4 A;  3G3G A;  3K00 A;  1IIW A;  4K3F A;  4MCO A;  4HXV A;  4DLD A;  1SBP A;  1B1H A;  4OWD A;  4GX3 A;  2IEE A;  4JVD A;  3OMB A;  2E1S A;  3O66 A;  3S9M C;  1JNF A;  2Y7I A;  3PPR A;  2HAV A;  1MDQ A;  4U4S A;  4R9G A;  1JEU A;  4I9D A;  2QVR A;  5L9S A;  3N6T A;  5DTB A;  5ELV A;  1D9Q A;  3D4G A;  1FBD A;  3K4U A;  5CMM A;  3CFX A;  3FV1 A;  4NE4 A;  3K6W A;  5B7D A;  2F6P A;  2PFZ A;  3VVE A;  4PBH A;  4N6P A;  1N84 A;  1JW4 A;  2BJJ X;  1D4N A;  4KXP A;  1B7Z A;  1NUX A;  3C34 A;  2WX9 A;  4I3E A;  5CBS A;  5IZ3 A;  4GWS A;  1DCU A;  3SET A;  3KEI A;  1B58 A;  1SD3 A;  3MWB A;  3U72 A;  1IXG A;  1SI1 A;  4Z0I A;  1I6B A;  3LUY A;  5K2X A;  3H06 B;  2DDK A;  3V5A A;  4YB7 A;  2Y7R A;  2Q89 A;  3FAS A;  4KHZ E;  1LB9 A;  3K2D A;  5J16 A;  1UIV A;  1ZTY A;  4O8M A;  2QMW A;  1B32 A;  4JB7 A;  4MIJ A;  1KA0 A;  1UQW A;  2RCA A;  1DTG A;  3THI A;  3RTW B;  1SW5 A;  1FSA A;  3TTL A;  1XVX A;  4I1D A;  2DWI A;  3T9V A;  1VFD A;  2KQZ A;  3UIF A;  3JZJ A;  2DP8 A;  4U1Z A;  1FCK A;  4NN3 A;  4OFO A;  3PMW A;  4OFJ A;  2F7B A;  2Z22 A;  5EQ8 A;  4ELP A;  4P9K A;  1TFD A;  4O3C A;  4PAI A;  4QSC A;  2O84 X;  2DSF A;  4X1D A;  3CIJ A;  4YKK A;  4N15 A;  3RNN A;  3CG3 A;  4QFP A;  1D3K A;  2OCU A;  4NF6 B;  4Q8R A;  3TCG A;  2P3V A;  3RT8 A;  4PAF A;  3UGW A;  1MQD A;  3LSF B;  3O6H A;  1B40 A;  2CZH A;  3PD9 A;  3W15 C;  4ZEI A;  1I6A A;  3FD3 A;  4H67 A;  1TFA A;  5CMK A;  2V3T A;  2HXW A;  1EZ9 A;  1B7H A;  1O7T A;  5DT6 A;  4EXK A;  3UK4 A;  2Q74 A;  3N94 A;  2R8T A;  5ET5 A;  1BIY A;  4FE8 A;  1FPF A;  2RC7 A;  1PEB A;  5HM4 B;  5F1Q A;  4GWO A;  1G0I A;  1P1W A;  4GXA A;  2OBG A;  2QS3 A;  4U22 A;  1LFH A;  4C0R A;  3FJ7 A;  3EHU A;  3K1M A;  1B6H A;  4N07 A;  3CFZ A;  2KLF A;  1DSN A;  3IB1 A;  3KJT A;  2YJP A;  3LSW A;  4NED A;  5H8Q B;  4P1L A;  4PFY A;  3OO7 A;  5ITO A;  2H25 A;  1UTH A;  4NF6 A;  4FAJ A;  1D9Y A;  4KYD A;  4KD5 A;  1A55 A;  2Y7K A;  4GIZ A;  1N0T A;  2KR0 A;  4H5F A;  3SES A;  2O6A A;  3KSJ A;  5F7V A;  3UOR A;  5L9O A;  4IR8 A;  3RPW A;  3L6G A;  2XXH A;  4F19 A;  4N8G A;  5I59 A;  2DQV A;  1CE2 A;  2XWV A;  2YLN A;  2DXR A;  3M3K A;  1A8E A;  3E79 A;  2GQ1 A;  1BLF A;  4IO7 A;  4IO4 A;  4POW A;  4WEP A;  4PGN A;  1FTO A;  2Q8M A;  3USD A;  4GX4 A;  1B2H A;  3C31 A;  1Y1Z A;  3MW0 A;  3TDJ A;  4P0G A;  4DI3 D;  2ZYN A;  3CVG A;  4JXI A;  3GZG A;  3WAE A;  4GRK A;  2RIN A;  1YTV A;  1XOC A;  1Q1K A;  2DVZ A;  3DP6 A;  4NF0 A;  1DTZ A;  2X7Q A;  5FHM A;  3TQL A;  4MF3 A;  5H8Q A;  5CMB A;  3KBZ A;  2DYX A;  2RKM A;  2XXU A;  4R6Y A;  3NOH A;  4LON B;  2I3W A;  1B7U A;  2ZMB A;  3FJM A;  4GL0 A;  2OWT A;  1TWY A;  2XXI A;  3I6V A;  2DE4 A;  3H6W A;  1MM7 A;  5I57 B;  5KCJ B;  4ZZA A;  3B7D A;  2F35 A;  3H6T A;  3LSX A;  4ZEB A;  3OO8 A;  1FJ6 A;  2O1M A;  4DXU A;  4ECF A;  3D4C A;  4QSD A;  4P56 A;  1JEV A;  4NQ8 A;  4N4U A;  1MM6 A;  3K6X A;  2QS1 A;  3VXB A;  3IOW A;  2XD2 A;  2F8D A;  3IK6 B;  5ISU A;  1DMB A;  5H8H B;  4G68 C;  4PE3 A;  4PFW A;  2Z23 A;  4MLV A;  3I5O A;  4F3S A;  1B05 A;  5M2V A;  1O63 A;  4G8H A;  1NV4 A;  1B0H A;  1Y4T A;  2HPG A;  1R9Q A;  1Y3N A;  4R73 A;  1EZP A;  4EXL A;  5AA1 A;  5DYH A;  5F24 A;  1ZLQ A;  3FVO A;  2P0S A;  4XKN A;  4NF5 A;  5TP9 B;  2RF1 A;  2Q8J A;  2F97 A;  3LV0 A;  5I5P A;  1AWB A;  3HHF A;  4JSO A;  5EQA A;  2P3N A;  4BLA A;  1JQF A;  2W7Y A;  5I57 A;  2R6G E;  1MQJ A;  3OEL A;  3T0J A;  3IOR A;  1SPI A;  5TU0 A;  4GF8 A;  1LCT A;  1G0H A;  1POY 1;  3RGY A;  1QGX A;  4OXV A;  3VVF A;  4G8N A;  4F22 A;  4XXU A;  1SYI A;  2WYK A;  4OYV A;  3OOA A;  1QUI A;  5I84 A;  1I69 A;  3G3H A;  4I3Y A;  4XFE A;  4E0X A;  4F31 B;  1AL3 A;  1US4 A;  2HAU A;  5H8H A;  2PBW A;  3IJX B;  2OLB A;  5TPA B;  1N76 A;  3SDF A;  2D21 A;  4ELR A;  1GGG A;  1KZ8 A;  3C4M A;  3FUZ A;  1S50 A;  4ZEC A;  5ICT A;  1JVY A;  1NNF A;  4OA4 A;  1JVX A;  1A99 A;  2B4L A;  3N6U A;  2GHB A;  4YB6 A;  4MJO A;  3RY3 A;  2ALU A;  4LN5 A;  3FGS A;  3MP6 A;  4P1E A;  4DCY A;  2A5T A;  4NWD A;  1UTB A;  1B3H A;  3FXR A;  3H4Z A;  1FPI A;  3H7M A;  4N17 A;  5IAI A;  2Q9T A;  3CHG A;  1EYJ A;  3PUZ E;  4HTG A;  3O6G A;  2L5V A;  5DVI A;  4MHF A;  4NF4 B;  2FVZ A;  1MPC A;  3PMX A;  4OQO A;  4ZE9 A;  3PPQ A;  3QXM A;  2Z8E A;  2ZNS A;  3W9V A;  4HCW A;  3PD8 A;  4PF8 A;  4MNC A;  3PV0 E;  4GWY A;  1EH3 A;  5L8D A;  4OVQ A;  1II5 A;  1MQI A;  4EQ7 A;  1NUY A;  4YAH X;  1VFE A;  3MBP A;  1LBC A;  3MZ9 A;  3DP8 A;  1XHY A;  2Z8F A;  3FVN A;  1YAE A;  3QYT A;  4YKP A;  3O2A A;  3IB0 A;  4X1B A;  3MQ9 A;  2DVC A;  4MNP A;  3KC0 A;  3KN8 A;  3EKI A;  3QAX A;  4O3A A;  2ZYM A;  4U2R A;  3QK6 A;  1FRP A;  4R75 A;  1A8F A;  1M5C A;  4U1O A;  5T3J A;  2QPQ A;  3R26 A;  1OQG A;  3EPE A;  4R9F A;  4EQB A;  1MPD A;  1N7W A;  2XXQ A;  4LAT A;  3TCF A;  3S9L C;  2QJE A;  4TQU Q;  1OLA A;  1NI9 A;  1IZ1 A;  5AA2 A;  4GD5 A;  1RDX A;  2V3U A;  2I4C A;  4NAP A;  4WXJ A;  2F34 A;  1FQE A;  4NF4 A;  1M5E A;  1N04 A;  2HEU A;  4PFT A;  2ANJ A;  2XWO A;  1VDW A;  2O7U A;  3F11 A;  4P0I A;  4ESX A;  3FVG A;  4PGP A;  1IIT A;  1L5T A;  1DOT A;  2ESN A;  1A40 A;  5H8S A;  2QS2 A;  4KCC A;  3HFU A;  3ILU B;  4MX6 A;  1R6Z A;  4F3P A;  3PGF A;  1POT A;  4ZEK A;  3IOT A;  2PMS A;  2IA4 A;  4YMB A;  2ZXT A;  4JVI A;  1IQ7 A;  4R2F A;  3R7X A;  1MXW A;  3IX1 A;  2AYS A;  3EN3 A;  1FQA A;  5CBR A;  2PVU A;  3FXU A;  4C1T A;  4U4X A;  4PCD A;  5BWJ A;  4GOT A;  3VFJ A;  4PDH A;  3KN7 A;  4L17 A;  3TQW A;  4N91 A;  1B3L A;  4F39 A;  4YIC A;  1MXU A;  2Q2C A;  4X48 A;  1FJ9 A;  3GYY A;  1S9T A;  2F3B A;  2XXP A;  1B52 A;  2NOO A;  1LAH E;  4EQ9 A;  1Y4C A;  2OX3 A;  4ELO A;  5KZT A;  3T66 A;  3JV9 A;  1QJM A;  2ZNU A;  2CMO A;  1PC3 A;  2UVJ A;  1YYZ A;  4AB5 A;  4RPN A;  3PUV E;  4EF2 A;  2Y84 A;  1EYK A;  5IM2 A;  3MVY A;  4OEU A;  3VVD A;  1H3D A;  1NMU A;  5LTC A;  5EQ7 A;  3OEN A;  4PAK A;  4JWO A;  1ATG A;  3TMG A;  2P1S A;  3K6V A;  4H45 A;  3OSR A;  5ICQ A;  5IKB A;  2ZYK A;  3E3K A;  2I4B A;  4KYE A;  1B4Z A;  1SQY A;  2MKZ A;  4PF6 A;  3MZB A;  5I58 B;  4QBA A;  4O7M A;  4HE1 A;  3V83 A;  2DE3 A;  4IGT A;  4JWY A;  3MZ1 A;  1ZBM A;  2G93 A;  3KZG A;  1B5I A;  1BK4 A;  1Q9D A;  5L9M A;  1FQB A;  4OMB A;  4QFO A;  4JVC A;  2PCR A;  4IB2 A;  4XEQ A;  4NF8 A;  2B3B A;  1PB9 A;  1RYO A;  1IXI A;  3LBS A;  5DVJ A;  4H0W A;  4TOZ A;  2HXR A;  4NX1 A;  1OMP A;  4IO5 A;  4G61 A;  4KI0 E;  1MXZ A;  2UYE A;  4OAN A;  1UTH B;  4QSE A;  5ET6 A;  1XI6 A;  1MG1 A;  4ISU A;  1IXH A;  2VD3 A;  3K1P A;  2NUV A;  1EYI A;  1FTM A;  1VSO A;  1NV3 A;  5AA2 D;  2FNC A;  3IFC A;  4OEV A;  4OES A;  1N3X A;  1LGB C;  1Y1M A;  3TUS A;  3KOS A;  2I48 A;  1IMA A;  3B50 A;  3FZV A;  1I6Q A;  3IO6 A;  4BDR A;  4DE8 A;  1MH3 A;  2WKY A;  3TYH A;  5I59 B;  3W9W A;  4NGU A;  4QF9 A;  1N3W A;  1B5J A;  4R6H A;  3T9H B;  3O9P A;  3FV2 A;  1FTL A;  1VR5 A;  4PFR A;  5I58 A;  1YPN A;  4EUO A;  1OLC A;  1FPJ A;  3E4R A;  3PPN A;  2PFY A;  3E9X A;  4IY5 A;  2NWJ A;  4AQ4 A;  1YXI A;  4YZZ A;  3UN6 A;  3U93 A;  3I3V A;  2XWI A;  3A29 A;  3VDF A;  3BKI B;  3QIM A;  3PU5 A;  4XIG Q;  3TTR A;  4ZDM A;  4YU0 A;  5IZ1 A;  3TKD A;  2VHA A;  2LAO A;  1SYH A;  3MPK A;  4WED A;  1PB8 A;  4G4P A;  2F7A A;  1LBZ A;  4U21 A;  1RDY A;  5H8N B;  1R9L A;  4OVT A;  4U23 A;  4DZ1 A;  1MQG A;  4RNS A;  4OEN A;  3HHG A;  4GQO A;  5EYF A;  4ELQ A;  4PE5 B;  1PB7 A;  5DW8 A;  1A54 A;  1SVX B;  2HZK A;  1BTJ A;  3QUF A;  4KPT A;  2ZNT A;  2CZL A;  3MST A;  2Y5L A;  2CZK A;  3KFM A;  3Q28 A;  4HS7 A;  1IUD A;  2V4C A;  1B46 A;  2DE2 A;  4GL8 A;  2O1L A;  4JWX A;  1P99 A;  5AA4 B;  3U65 A;  1SW4 A;  1LEV A;  1KA1 A;  1M5D A;  2GFE A;  3MYU A;  3IL1 B;  1LBX A;  2O68 A;  4E0W A;  3B8B A;  4G8M A;  2HCA A;  1J1N A;  3ILT B;  1B3F A;  4NF5 B;  3H6V A;  5CM6 A;  4ZEF A;  5H8N A;  1H76 A;  3E78 A;  2XXR A;  3Q29 A;  3HV1 A;  2XXT A;  1DPP A;  2VP1 A;  4MEV A;  4FAT A;  3M3F A;  3TFL A;  3RT6 B;  1FQF A;  3SEY A;  4ONY A;  2R71 A;  1Z7N E;  4H8J A;  4HCY A;  2I58 A;  4LA9 A;  5H8F B;  4LZ8 A;  1SW2 A;  1MPB A;  4O94 A;  4QRZ A;  1M5B A;  5JEI A;  1LST A;  2XXY A;  4ZE8 A;  4LQ2 A;  4LZ5 A;  4YMA A;  3GBB A;  4N8Y A;  5CMC A;  5BUU A;  5AA4 A;  3Q25 A;  3CG1 A;  3EHT A;  4GWZ A;  2RCB A;  4BDO A;  5EHS A;  4R2B A;  1GV8 A;  3TTN A;  2HFB A;  2F5X A;  2OJT A;  3IFA A;  2XX8 A;  5LDZ A;  4H5G A;  2H98 A;  4GLI A;  2FA7 A;  4RJZ A;  1A7L A;  3KG2 A;  3N5L A;  1ZIU A;  2QS4 A;  2JJK A;  2A5T B;  2QFL A;  1UTB B;  1DPE A;  2HZL A;  4EDP A;  1AH5 A;  2PT2 A;  1URD A;  2ONS A;  2QSX A;  2X7P A;  1NUZ A;  2QMX A;  4MLQ A;  2Q88 A;  3PPO A;  1MY2 A;  4KCD A;  2NVU B;  1FBF A;  5H8F A;  4HW8 A;  3FVK A;  1MXV A;  2NXO A;  4GFR A;  1OVT A;  3ONM A;  4KR5 A;  1YCJ A;  2XXK A;  4ZS9 A;  1OIB A;  3U1O A;  2D3I A;  1IMB A;  1MQH A;  1Y3Q A;  1B3G A;  4P47 A;  1USY H;  1LBB A;  3FIR A;  4ZZE A;  2F7C A;  1FBH A;  4OET A;  4Q0C A;  2PT1 A;  3R6U A;  2XXW A;  3S2V A;  3G3F A;  4N81 A;  5A5X A;  2REG A;  4EF1 A;  4ESW A;  2Z8D A;  1LFI A;  4PDD A;  5ESY A;  4THI A;  4YKI A;  3DEL B;  1QUK A;  3TAJ A;  5AA2 B;  4N13 A;  3TOD A;  3A3U A;  5I7I A;  2X26 A;  3MJN A;  3ZKK A;  1P1Q A;  1N7X A;  5DEX A;  3QUJ A;  3E13 X;  5B70 A;  1WVJ A;  2DS9 A;  3Q27 A;  1XVY A;  3RN8 A;  3QSL A;  3IAZ A;  2YPN A;  1D9V A;  2V84 A;  1AOV A;  2O7I A;  3FAT A;  1NNT A;  4LZ7 A;  4PFU A;  5IZZ A;  4DXC A;  3LR1 A;  4F29 A;  2VT5 A;  2UVH A;  3RYD A;  4FED A;  4BDM A;  3SEX A;  3U92 A;  3OXN A;  4DDD A;  4RYA A;  1MY1 A;  1OVB A;  4IO3 A;  4NG7 A;  3TTM A;  3OEK A;  2VPN A;  1IMF A;  3EQ1 A;  3RLF E;  5A5L A;  2H5Y A;  4PBQ A;  3K01 A;  4OFL A;  4AS4 A;  1JET A;  2HHM A;  2I49 A;  1S7Y A;  2UVG A;  5I2N B;  2OPE A;  1NNK A;  4HE2 A;  1Z7M E;  5KDT A;  1FBP A;  2H4I A;  1XS5 A;  3ZKL A;  1CB6 A;  2OK2 A;  1SDX A;  1RYX A;  1SW1 A;  4MFI A;  2I0B A;  3S4U A;  2VOZ A;  1Y9U A;  5EQ9 A;  4GBW A;  1IEJ A;  1IXC A;  1LBV A;  1FPB A;  2H9B A;  3TPA A;  3KBR A;  1QVS A;  4DXB A;  4JSD A;  3OEM A;  4F1U A;  1K9Y A;  4X9T A;  3RQT A;  4MAG A;  1NV0 A;  1DBZ A;  1FPL A;  1H43 A;  1FTA A;  2DWA A;  2VGQ A;  3CFL A;  1LAG E;  3CRB A;  2AL5 A;  2PYY A;  1GR2 A;  1B51 A;  4OZ9 A;  4RA1 A;  5EHM A;  3T9U A;  3VXC A;  3KC1 A;  1T0K A;  5FTH A;  4GWW A;  1HSL A;  5I2N A;  4NF8 B;  3RPL A;  1LLS A;  1UIU A;  2RC9 A;  3O28 A;  4N6K A;  3ROJ A;  1FPK A;  4NWC A;  3WAF A;  1B0L A;  2F6G A;  4UAC A;  3LUZ A;  5HPQ A;  5HBC A;  4UA8 A;  4BDQ A;  1PBQ A;  4FBP A;  3FXQ A;  2ZZV A;  4F2Q A;  2OWZ A;  4G68 A;  4DI4 B;  2FYI A;  1MS7 A;  2WBB A;  3HO7 A;  4F2O A;  3CSG A;  1HSJ A;  5JTY B;  4H46 A;  4IO6 A;  2ZYO A;  2GHA A;  3GXA A;  4H1X A;  4PFI A;  3UP9 A;  3MVX A;  2AL4 A;  1GVC A;  5JK4 A;  1EU8 A;  3DM0 A;  3N26 A;  1TXF A;  1NH7 A;  1GTK A;  5AE4 A;  3K1N A;  4QFL A;  3OO6 A;  2I3V A;  1ELJ A;  3OD7 A;  1IME A;  3B6T A;  3PTY A;  4JDF A;  4OVJ A;  1JP4 A;  2XD3 A;  2ONK E;  4GWX A;  2I0C A;  3MVZ A;  3O6I A;  1LBY A;  3TZA A;  1BP5 A;  3VV5 A;  2XHD A;  3QMF A;  2V3Q A;  3G3J A;  3ISP A;  4XKQ A;  2I6E A;  2WBD A;  4M4G A;  4QHQ A;  4QFN A;  3BIG A;  1OQH A;  3MPL A;  2Q2A A;  3LSL A;  5JTY A;  1SI0 A;  2UXA A;  1QKB A;  3VLW A;  4KFQ A;  4FEB A;  4OTE A;  1PBP A;  1FQC A;  4I8C A;  3EF7 A;  3HPI A;  3TEL A;  1US5 A;  4QXD A;  2F3D A;  1P1N A;  1FBG A;  2QL3 A;  4F1Y A;  3ZS6 A;  3T22 A;  1BKA A;  4R74 A;  3LC8 A;  3A3C A;  3B6Q A;  1MXY A;  2ABH A;  4LP2 B;  2RC8 A;  1ANF A;  2XXX A;  3O97 A;  3S9N C;  3DP4 A;  4MBP A;  1B4H A;  1FBE A;  2VD2 A;  4G77 A;  4H6D A;  1FPE A;  3MAM A;  2UVI A;  2THI A;  1B1X A;  2O51 A;  2G29 A;  3SKP A;  4QFK A;  1WOD A;  1O64 A;  3RTF B;  3T96 B;  3S9E A;  3HN0 A;  1RKM A;  1AMF A;  3PPP A;  1INP A;  1MY0 A;  2DWH A;  4YB5 A;  3G3K A;  4RK9 A;  3EHS A;  3MVW A;  3OSQ A;  4Z7E A;  3VE1 B;  4BDL A;  1H44 A;  3VLU A;  4NHB A;  5I56 B;  2B3F A;  3DLN A;  2XX9 A;  3FXB A;  1B3E A;  5J1D A;  5EYG A;  3ZSF A;  2O69 A;  4FJP A;  1MH4 A;  3KN3 A;  3H3G A;  3G3I A;  4FEC A;  4POX A;  4P8B A;  1VE4 A;  4LUB A;  4GBV A;  1JW1 A;  1NH8 A;  3M3L A;  2HQ0 A;  3C9H A;  3T1B A;  3M8U A;  2Y5K A; 
#chains in the Genus database with same CATH homology
 1VDW A;  4HE0 A;  4PGP A;  1IMB A;  4P47 A;  4NN3 A;  3D1R A;  3HFU A;  2CZI A;  5EQ8 A;  4MX6 A;  1FBH A;  4P9K A;  4PAI A;  4N6D A;  4I40 A;  4N15 A;  4JVI A;  4N81 A;  4PTK A;  2P3V A;  4MNI A;  4PDD A;  5ESY A;  4PAF A;  1FBC A;  2CZH A;  4OVR A;  5I7I A;  2WEF A;  4PCD A;  3FBP A;  4MMP A;  4PDH A;  2Q74 A;  2KQZ A;  4N91 A;  2R8T A;  5ET5 A;  1NV7 A;  4YIC A;  1FPF A;  1FJ9 A;  3GYY A;  1NV5 A;  2B4M A;  2F3B A;  1G0I A;  2OX3 A;  5IZZ A;  2VT5 A;  3RYD A;  1YYZ A;  4PET A;  1EYK A;  5IM2 A;  4P1L A;  5LTC A;  5EQ7 A;  4F18 A;  4PAK A;  4NG7 A;  2VPN A;  1IMF A;  4H45 A;  2KR0 A;  2QVV A;  5A5L A;  2FBP A;  4IR8 A;  1YZ0 A;  4PBQ A;  2MKZ A;  4F19 A;  4PF6 A;  4N8G A;  4AS4 A;  2ZZX A;  2XWV A;  2HHM A;  4QBA A;  2CEY A;  4O7M A;  4HE1 A;  2FIE A;  2DE3 A;  3E79 A;  1NV6 A;  2GQ1 A;  4HE2 A;  1BK4 A;  1Q9D A;  1IMC A;  4PGN A;  1FBP A;  4X04 A;  2Q8M A;  4JVC A;  4GX4 A;  2PCR A;  4XEQ A;  2QVU A;  4DI3 D;  5EQ9 A;  1LBW A;  4GBW A;  1NUW A;  2HXR A;  4PC9 A;  4NX1 A;  4G61 A;  3BIH A;  1LBV A;  1FPB A;  4XF5 A;  2DVZ A;  4NF0 A;  4OVS A;  4OAN A;  5ET6 A;  1XI6 A;  4OVP A;  2ZZW A;  4F1U A;  1K9Y A;  3KBZ A;  1EYI A;  4X9T A;  4MAG A;  1NV3 A;  3NOH A;  1NV0 A;  3IFC A;  4AS5 A;  1DBZ A;  1FPL A;  1FTA A;  1IMA A;  3B50 A;  2DE4 A;  2XWK A;  2CEX A;  1CNQ A;  3W9W A;  4NGU A;  4X8R A;  4GX6 A;  4M1V A;  1FJ6 A;  5ET8 A;  4PFR A;  1NV2 A;  5ET7 A;  1FPJ A;  3KC1 A;  2PFY A;  4GWW A;  4P56 A;  4NQ8 A;  1YXI A;  1IMD A;  4N4U A;  5EYH A;  3RPL A;  4YZZ A;  2XWI A;  3A29 A;  4N6K A;  3ROJ A;  4UAB A;  4PE3 A;  1FPK A;  5IZ1 A;  2FHY A;  3LUZ A;  4O7I A;  1NV4 A;  4GWU A;  2HPG A;  4FBP A;  2WYP A;  1LBZ A;  1RDY A;  2ZZV A;  2OWZ A;  4DI4 B;  5F24 A;  4OVT A;  2WBB A;  3SZP A;  4H46 A;  3LV0 A;  5I5P A;  4PFI A;  1AWB A;  1RDZ A;  5EQA A;  2P3N A;  5FBP A;  5DW8 A;  5IGA A;  5JK4 A;  2HZK A;  5I3S A;  3T0J A;  1SPI A;  3MST A;  1G0H A;  2Y5L A;  2CZK A;  1K9Z A;  1QGX A;  3RPL B;  2V4C A;  4PFB A;  1FPG A;  2WYK A;  4P3L A;  2DE2 A;  2FIX A;  4I3Y A;  4XFE A;  1IME A;  3U65 A;  1DK4 A;  3PTY A;  1LEV A;  2VPO A;  1KA1 A;  2XA5 A;  3MYU A;  1JP4 A;  1LBX A;  1FPD A;  4GWX A;  3B8B A;  1LBY A;  1KZ8 A;  4F1V A;  5IZ3 B;  2BJI A;  5CM6 A;  1NV1 A;  4OA4 A;  3QMF A;  2B4L A;  2V3Q A;  3ISP A;  3E78 A;  2WBD A;  3BIG A;  4MCO A;  4HXV A;  4MJO A;  4LN5 A;  4GX3 A;  4MEV A;  4P1E A;  4QXD A;  2F3D A;  4JVD A;  1FBG A;  1FPI A;  4N17 A;  2Q9T A;  4HCY A;  3CHG A;  1EYJ A;  4O94 A;  2L5V A;  4MHF A;  2FVZ A;  2QVR A;  4N8Y A;  3W9V A;  4HCW A;  1D9Q A;  4PF8 A;  1FBD A;  4MNC A;  4GWY A;  2PFZ A;  4GWZ A;  4OVQ A;  1FBE A;  4PBH A;  1NUY A;  1FPE A;  4KXP A;  2F5X A;  3IFA A;  5LDZ A;  1NUX A;  2WX9 A;  4I3E A;  5IZ3 A;  4MNP A;  4GWS A;  1DCU A;  3KC0 A;  3EKI A;  1INP A;  2JJK A;  2QFL A;  1FRP A;  2DDK A;  2HZL A;  5T3J A;  2QPQ A;  4NHB A;  5J16 A;  1NUZ A;  4O8M A;  3FXB A;  5J1D A;  5EYG A;  4MIJ A;  1KA0 A;  1NI9 A;  1FBF A;  1RDX A;  1FSA A;  4P8B A;  4NAP A;  4GBV A;  3T1B A;  2Y5K A;  2XWO A;  2XXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...