2CZIA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
268
structure length
259
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEETKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Inositol monophosphatase 2
total genus 73
structure length 259
sequence length 268
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2cziA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2cziA02
4GWYA 4O7IA 1NV7A 4GWZA 2WBDA 5J16A 2FIXA 1FTAA 3IFCA 4HE0A 5A5LA 1YYZA 1NV3A 1G0HA 1BK4A 4PTKA 1EYKA 5IZ3A 1LBYA 4GBWA 1FSAA 1EYIA 3LUZA 3ROJA 4N81A 1NUXA 1CNQA 3RYDA 4KXPA 3IFAA 2Y5KA 4GX3A 1YXIA 1FPEA 1FPFA 1SPIA 3FBPA 4H45A 5IZ3B 1KA1A 1LBVA 2P3VA 2PCRA 5EQAA 3A29A 1NV4A 1NI9A 1Q9DA 1NUYA 1VDWA 4HE2A 1RDYA 1IMAA 2CZHA 1FPIA 2QVRA 1FPKA 3KC1A 3LV0A 2GQ1A 2P3NA 3QMFA 1NV1A 1IMFA 3KC0A 5F24A 4GX6A 1FPDA 2JJKA 4HXVA 1FBEA 1KZ8A 1QGXA 1RDZA 2QVVA 4I40A 5IZ1A 2Y5LA 1FRPA 5EYHA 1DCUA 1FBDA 1FPJA 1NV6A 1K9ZA 1FJ6A 5T3JA 1IMBA 5I3SA 1NV2A 1INPA 1NV0A 2R8TA 2F3DA 2WEFA 2OWZA 4GBVA 3D1RA 5ESYA 3B8BA 4HE1A 4GWWA 4AS5A 4GWSA 1DK4A 2FHYA 1FBHA 1NV5A 3KBZA 2FBPA 2HHMA 4GX4A 1FPLA 5EQ7A 1FPBA 4I3EA 1IMCA 5ET8A 1FBFA 3BIHA 1LEVA 1FPGA 1FBCA 1K9YA 2FVZA 4IR8A 2DDKA 1IMEA 2CZKA 5ET6A 1FJ9A 4AS4A 1LBZA 1LBXA 1IMDA 1FBPA 3BIGA 2OX3A 2F3BA 4FBPA 1XI6A 1D9QA 1NUZA 4G61A 4I3YA 4QXDA 5ET7A 1KA0A 5ET5A 3RPLA 1DBZA 2BJIA 5EYGA 1LBWA 4GWXA 5EQ8A 2CZIA 5FBPA 5EQ9A 2Q8MA 4MJOA 3T0JA 5LDZA 4H46A 2Q74A 2VT5A 1AWBA 3RPLB 1RDXA 5DW8A 1G0IA 1YZ0A 2FIEA 2QVUA 1EYJA 1JP4A 1NUWA 2QFLA 1FBGA 4GWUA 2WBBA
chains in the Genus database with same CATH superfamily
5TPAB 3FZVA 5K2YA 5J16A 4HE0A 4RXLA 1TXFA 1VSOA 5FTIA 4O3AA 3A3UA 1P1UA 4N6DA 4PFIA 4ZEKA 3RY3A 4H45A 1SPIA 4FORA 3A29A 2V84A 1D3KA 3E9XA 1VDWA 5H8QA 2H5YA 3MQ9A 3HPIA 1Q1KA 5F24A 5KCJB 4Q0CA 2JJKA 4PDDA 2B4MA 4KQPA 5T3JA 3PPQA 2R8TA 2B4LA 4GWWA 3C9HA 4GVOA 2DE3A 3G3JA 1II5A 1MH4A 2DOJA 3PGFA 4C0RA 3SKPA 4G8MA 2DE4A 2RCBA 1FPGA 1LAHE 2ZNUA 1QUIA 1SYHA 2G29A 1EH3A 2F3BA 2YLNA 1B5IA 3E4RA 2VP1A 2WYPA 3V83A 2ONKE 3PTYA 3T0JA 2PFZA 4H46A 2PBWA 1LGBC 1B7UA 2XXTA 3CSGA 3IJOB 4PE3A 4RPNA 2ZZWA 3LSXA 4P11A 4RK2A 1MXYA 4EQ9A 4N8GA 3K0VA 4GOTA 4U21A 3CFZA 1US4A 4NQ8A 1EYKA 3O9PA 1FSAA 3TKDA 3ROJA 2I49A 1ZMGA 4OQOA 3R26A 2QPQA 2XXXA 4H8IA 3CRBA 1JW4A 1DMBA 4MIJA 4OXVA 1B1HA 2RINA 2UYEA 2AIXA 2XXQA 2D3IA 3RUMA 1XC1A 5TPAA 1LAXA 4GX6A 5CM6A 3PV0E 4XKRA 2RCAA 2NXOA 4C1TA 3TEPA 1NV6A 1LAFE 2P0SA 1A55A 3FXBA 1JVYA 3B6WA 4YKKA 4NF6A 2DWHA 4F3BA 1B3FA 1MY0A 2VOZA 3EKIA 2ZYNA 2XA5A 5H8QB 4ONYA 3TTRA 1AH5A 1PC3A 4I3EA 3BIHA 4OESA 2XWIA 2NWJA 4GFRA 3D4GA 5H8NA 5F7VA 4TOZA 3PMXA 1M5CA 1LBZA 4P47A 1FQFA 4H8JA 1FBPA 4G4PA 4XF5A 2Y7PA 1SDXA 4G61A 4OVQA 2B3BA 3VLVA 2PFYA 3GZGA 5EYGA 3O97A 2Q9TA 3H7MA 4U22A 2PMSA 4I9DA 5I57B 3RPLB 3SETA 4HCWA 1VR5A 1YZ0A 3KOTA 1Y20A 3RTWB 2WBBA 4ELPA 4G68A 3QUJA 2W7YA 1URGA 2FIXA 5A5LA 2I4CA 1UQWA 3BKIB 1G0HA 2ONSA 1MM6A 3MVWA 4MX6A 1LBYA 3U92A 1B32A 3SDFA 2CEYA 5DEXB 4C1UA 3OO6A 4DLDA 5AA4A 3FBPA 1NL5A 1KA1A 3F11A 1JEUA 5K2XA 2KLFA 2X7PA 2Z23A 4BDQA 3T93B 4OFLA 1OLCA 5JTYA 4PBHA 3VXBA 4OERA 1Q9DA 1ZTYA 1ZJLA 3W15C 3BFTA 4R2BA 5IM2A 3LV0A 2ABHA 1QKAA 2Y5LA 4Q30B 3DP8A 4O94A 5AA1A 1JETA 4O7MA 3OOAA 4F19A 4I62A 5CMKA 3TDJA 3D1RA 1NFTA 2P1SA 1F9BA 3U94A 1DTGA 2DWJA 4PFRA 3KJTA 5FHMA 3IB2A 4NEDA 3FIRA 5CI5A 1P1NA 4L17A 1MXWA 2HXRA 1H3DA 3DLNA 3M8UA 4QFPA 4EUOA 1BIYA 3B50A 1WVJA 4LZ5A 4N8YA 4N91A 1LBXA 5FTHA 5EHMA 2QS4A 2ZMBA 2DVZA 4NX1A 4KYEA 3KJ7A 3LC8A 1D9VA 4U4XA 4P3LA 4ZE8A 3T1BA 2DWIA 1OVTA 3K1MA 3EHSA 1Y4CA 4M1VA 3HHFA 3RT8A 2Q88A 5IKBA 4AB6A 2KR0A 4MH5A 2QVUA 2FIEA 2O84X 4GD5A 2O68A 4N13A 4O7IA 1OVBA 1S9TA 3K6XA 4R73A 4JVCA 3SZPA 1BK4A 1MXZA 4NMYA 3VVDA 3OO9A 3OO8A 2CEXA 3FATA 4JBZA 2CZLA 5DVIA 4NAPA 5I57A 2P3VA 2Y84A 4WEDA 3KN3A 3O28A 3CVGA 3IO6A 3N6TA 4EQBA 2V25A 4QHQA 1OQHA 3HHGA 3C34A 2MKZA 2I3VA 3S9NC 4G2ZA 4RPOA 1K9ZA 5I3SA 4QRZA 3QK6A 1B7ZA 4LVQA 2DE2A 4GBVA 1P1WA 1HSJA 4GWSA 3RQTA 4O8MA 5JTYB 3G3KA 2ZZVA 4ELRA 3PD9A 3IOTA 3MJNA 1YAEA 4IO7A 2DDKA 1CB6A 3EPEA 1B5HA 4LP2B 3FXQA 4N6PA 3SEXA 4NGUA 4GL8A 4JVIA 3DP6A 1RYOA 4OVTA 3S2VA 5HPQA 3GBAA 1LB9A 2V3QA 4HTGA 2HEUA 1EZOA 1MQHA 1DBZA 3MWBA 1RYXA 1B40A 4MJOA 5FHNA 1B0HA 2Q74A 4EQ7A 4YKIA 1AOVA 2QFLA 4R6YA 3MPKA 5AA3A 3MW0A 2HCAA 4PCDA 3VXCA 1ANFA 4F29A 5ICTA 1EYIA 3LUZA 3C32A 3V89B 3UK4A 1MY4A 1SVXB 1NV4A 5I2NB 4R9GA 4DE8A 1FCKA 1D4NA 1IMAA 3TQLA 4X04A 1B46A 2THIA 3KEIA 1MDP1 4ND9A 3Q29A 4OFOA 1MDQA 4F3PA 5IZ1A 5L9MA 5EYHA 1NH7A 2OK2A 4MNCA 3Q26A 4G8HA 1QUKA 3TPAA 2HHMA 3T96B 3TYHA 1LFIA 1D9YA 1LBBA 3MSTA 1XVXA 4Z0IA 1PB7A 1GR2A 5KDTA 4U1ZA 5H8FB 5AA2D 3LSFB 1Z7NE 3O66A 5I59B 3MYUA 1D9QA 2REGA 2QS1A 3KSXA 1ZIUA 3PPPA 3IK6B 1URDA 3FD3A 4AB5A 3PPNA 2XXRA 1H76A 3E78A 5A5XA 3O6IA 1IXCA 4YAHX 1JW5A 4F2OA 5LTCA 2DQVA 3UA8A 3RTFB 4LN5A 4LUBA 2O6AA 2F36A 2Y7WA 3UORA 4GBWA 2PT1A 3IB1A 2R71A 2HXWA 4EXKA 3MP1A 4NF0A 1YXIA 3TCGA 3O6GA 4JSOA 1ZU0A 2P2AA 1B5JA 1MQGA 1TT1A 1O7TA 4F1VA 4GXAA 4UABA 1LFGA 3FUZA 4JSDA 3O2AA 1B0LA 1Y9UA 3EQ1A 3TTKA 1NV1A 3CSBA 1LLSA 1FPDA 3TTMA 4IO3A 3T9VA 2QVVA 3QIMA 4O3CA 2HPGA 2F6PA 1I6AA 4OENA 3C4MA 1XT8A 1JW1A 3FJGA 4N07A 3QUFA 4RNSA 2G93A 1NNPA 1NNTA 2HQ0A 2VPOA 1QVSA 2PVUA 4BDMA 4IY6A 2KQZA 1LEVA 2QS2A 3FXUA 2ZYOA 2H98A 1N7XA 3FJMA 4ZECA 2X26A 3OMBA 1OLAA 3VE1B 5CMMA 4ECFA 5FBPA 4YU0A 3OEMA 4F39A 3S9EA 2O7UA 4IO5A 1EYJA 2O1LA 5KDTB 3E3KA 3KZGA 1SW4A 1NV7A 1NNKA 2WBDA 3R6UA 3IFCA 2B3FA 2OBGA 2AYSA 3IL1B 2VD3A 1I6BA 1YTVA 1MY1A 3TTNA 3K4UA 3MP8A 1DPEA 4F31B 4QF9A 3B6TA 3RYDA 5CBRA 1EZ9A 4YKJA 4F22A 1FPEA 1FPFA 1N84A 4U1OA 2PCRA 2OLBA 1SYIA 4WKMA 4JWXA 4FECA 5J1DA 1FPIA 2OPEA 4JDFA 2XX8A 1LCTA 4HW8A 3VVFA 3TQWA 1MRPA 4BDRA 1MY2A 1T0KA 4NF6B 1IUDA 5I58A 3EF7A 3SESA 1B4ZA 1FQBA 2XX9A 2FA7A 4F3GA 4NN3A 3MVZA 3T66A 1MQDA 1A7LA 4KHZE 5H8NB 1H44A 2Y7IA 3OSQA 4R6KA 4X1DA 1QUJA 1FBCA 2F5XA 5IZZA 3N94A 2Q8JA 3FVOA 1MXXA 4U23A 3FGSA 5B7DA 1FTOA 4EF2A 1KA0A 1B3LA 3RPLA 5CBSA 4PAKA 4GWXA 3CIJA 2Q8MA 5I2KA 4G77A 1IZ1A 3I3VA 1B1XA 5H8SA 1B3HA 1RDXA 4PGPA 3S9LC 3LBSA 1MXVA 3IJXB 1A40A 4R2FA 4GWZA 1MQIA 2OWSA 4OVJA 3PUWE 3L6GA 4LZ8A 2XXWA 4N4UA 5DEXA 4KR5A 2PYYA 1SW2A 4GXSB 3ISPA 1HSEA 1CE2A 4XIGQ 4PGNA 1NUXA 3HV1A 2XHDA 2QSXA 5ITPA 1R9LA 4GF8A 2RC9A 5IZ3B 1P99A 3MZ9A 3VLUA 2Z8DA 3I6VA 1NI9A 4LATA 2PT2A 4PFYA 3PUYE 3HO7A 5L9OA 4TQUQ 2OCUA 2UVHA 2UXAA 3W9WA 4I1DA 4XKNA 3CI8A 4ZEDA 2ZXTA 1INPA 4GL0A 4XKQA 1NV0A 3H3GA 4JXIA 3HN0A 2H9BA 2OWZA 3AXFA 4OVRA 1S7YA 4NF4B 1JEVA 2R6GE 4ZZEA 3PPRA 5EQ7A 4KCCA 4TLMB 4BDNA 1UIVA 2M8CA 1XVYA 3E13X 1EZPA 3SERA 1H45A 4H0WA 2FNCA 4QFLA 4PP0A 4R6HA 2D21A 1NUZA 4OWDA 3PUVE 4X1BA 3MAMA 3ONMA 4E0XA 4OETA 1EU8A 2BJIA 4Z7EA 2ZNTA 1TWYA 3IO4A 3VDFA 1H43A 3MC2A 3H4ZA 2ONRA 3S4UA 3UGWA 1YCJA 1MM7A 2O51A 4I8CA 3OD7A 4GWUA 5AE4A 5TU0A 2UVJA 3K6UA 5B70A 1PBQA 5I56B 2I4BA 3PUXE 3JV9A 3B7DA 3ILTB 4MHFA 5L9SA 4RA1A 3GYYA 3LSWA 1GTKA 3IFAA 4GX3A 4PFBA 1ELJA 3VVEA 3CG1A 4H67A 1KWHA 4KD5A 4HE2A 4GIZA 3IB0A 1US5A 2A5TA 3VV5A 1XHYA 3TCHA 2GFEA 4IGRA 4JVDA 1QGXA 1M5DA 5ELVA 4N17A 4YB6A 1FBDA 4FIMA 2HAUA 3MZBA 4R75A 4FJPA 3THIA 3C36A 1ZKBA 4QFKA 2XXKA 2I0BA 3EHTA 2ALUA 4LQ5A 4DZ1A 1ZLQA 3N5LA 4KPTA 1QKBA 2YJPA 3N26A 2YPNA 3FASA 1QJMA 2AL5A 4DI4B 1HSLA 4IR8A 3T9XB 1XOCA 3DELB 1OMPA 1IMDA 2WX9A 3ILUB 3SEVA 1UIUA 1MS7A 4PFTA 4FBPA 3TCFA 1IXHA 5ET7A 2D5WA 3EHUA 4YMAA 4MCOA 5ET5A 3N6UA 1PDAA 2DXRA 3MP6A 3DP4A 3H6UA 4F3SA 3EN3A 3R7XA 4BDLA 2H99A 1G0IA 1A54A 4QSCA 1FBGA 2O7IA 3OEKA 5EHSA 2I3WA 1Y1ZA 1MQJA 4NE4A 2B65A 4KFQA 1NV3A 3H06B 4ZE9A 2QMWA 1AL3A 3KN8A 2XWVA 1VFEA 2I6EA 2NOOA 4ZDMA 2Q2CA 5DTBA 1LBVA 1NH8A 5ICQA 1O64A 4PFWA 3HSTA 3TELA 1ATGA 1RDYA 3ZS6A 3TAJA 2DYXA 1N3XA 1NNFA 3QSLA 5CMBA 1TFDA 2GQ1A 2P3NA 4K3FA 3K6VA 5CMCA 3FV2A 4HXVA 3K1NA 2QL3A 1DCUA 1FPJA 2CMOA 3QAXA 1NV2A 3IOVA 4WEPA 1R9QA 1Y3QA 4NWCA 1NKXA 2I48A 4PC9A 2FBPA 1IITA 1LSTA 3KG2A 4H1XA 2A5TB 4Q5TA 2LAOA 1FPBA 5H8FA 4JB7A 5IGAA 4XKPA 4RJZA 3UP9A 2OX3A 3RPWA 5HBCA 4G8NA 1MPCA 3TUSA 4I3YA 4FATA 5EQ8A 3OO7A 1DPPA 4RYAA 1SW1A 5EQ9A 4PETA 4IO2A 3PMWA 5H8HA 1PB9A 3A3CA 3RN8A 2GH9A 2R9JA 2OJTA 4YKPA 1B2HA 2O69A 1B05A 2UVIA 2Y5KA 3HCQA 4OEVA 3G3HA 2XX7A 3MUQA 2V93A 3MPLA 1POTA 1NUYA 1FQAA 2QVRA 3QMFA 1SW5A 3JZJA 1R1NA 4TLLB 4I40A 4X8RA 1N0TA 4DXUA 3CFXA 4R72A 5I56A 4P0IA 3U93A 4FAJA 3U1OA 4IGTA 1A99A 3IOUA 1PEBA 2WEFA 4ELQA 2ZNSA 3CG3A 1RKMA 4F18A 3WAFA 3KBZA 5TP9B 3K01A 1OIBA 1O63A 1SBPA 2Z8EA 1AIVA 3USDA 2F7CA 2F8DA 5ET8A 3PMVA 3G7WA 1K9YA 4ZEBA 2RC8A 2PX1A 2IEEA 5AA4B 3FV1A 4XTCQ 3BIGA 4OVSA 4X48A 3TFLA 4H6DA 1AMFA 1I69A 4FE8A 1Y4TA 4LA9A 4O3BA 3ODBA 2Y7KA 3LR1A 1IIWA 4PFUA 4ESWA 1MXUA 4OYVA 2XD2A 4ESXA 2OPDA 5AA2B 4PTKA 4G68C 4OFJA 3PPOA 4DXBA 2DXYA 5JEIA 2GRVA 3V5AA 3IORA 1CNQA 3PUZE 1A8EA 4PBQA 4KXPA 3RGYA 1VE4A 3ZKLA 3ZKKA 3H03A 4DXCA 1JNFA 5L8DA 2L5VA 3U8QA 1B7HA 4P1EA 2H4IA 2QJEA 4M4GA 2CZHA 3VLWA 1DTZA 3BFUA 3KC0A 4KCDA 5I58B 1DOTA 4U4SA 4IO4A 1N04A 1QW0A 3GLBA 1FRPA 3T22A 4BLAA 3M3LA 5KCJA 1P1QA 4QFNA 1FTLA 4GWOA 2V4CA 5BUUA 1URSA 4MFIA 5DYHA 3K2DA 2XD3A 4OEUA 4QBAA 4NG7A 4MAGA 4UACA 5M2VA 1FPLA 4POWA 1IQ7A 2VPNA 1LB8A 1B58A 5IAIA 5DVJA 3MZ1A 1LCFA 4F1UA 1FTMA 1B3EA 2ZYKA 3IR1A 2HFBA 5I2KB 2A5SA 1FQCA 2GHAA 2NUVA 3S9MC 5LDZA 1P1OA 2HAVA 2I58A 4FEBA 3IX1A 3RNNA 1JP4A 4PF8A 3KGCA 4R9FA 2UYFA 1FTAA 3SEUA 1YYZA 4MEVA 4LQ2A 2AL4A 2F78A 5IZ3A 1IEJA 1R6ZA 4N81A 4THIA 1IXGA 2XWKA 3WAEA 4IB2A 5I84A 4PAFA 3T9UA 2I0CA 5I59A 4NTLA 1MY3A 3DM0A 3PD8A 1UTHA 3K00A 3KC1A 1LBCA 2XXYA 5H8HB 3L6HA 4PQJA 1M5EA 4MLVA 4DDDA 4HCYA 3D4CA 1M5BA 4YB5A 4MF3A 5A5XB 3SEYA 1IMBA 3FJ7A 2DP8A 3G3FA 4GLIA 3K02A 3B8BA 4HE1A 2DS9A 5HM4B 4LZ7A 1B4HA 4NF8B 3FXRA 3KN7A 1FBHA 1A8FA 1FQDA 4P56A 3JYRA 1BLFA 4H65A 3K6WA 1MG1A 3C31A 4H5FA 2GHBA 1FBFA 1B6HA 1UTBB 5CC2A 2FVZA 4ZEFA 2XWOA 2V3UA 3Q25A 4GRKA 1Y3NA 4JWYA 5EYFA 2DWAA 1L5TA 5I7IA 2ESNA 3Q28A 5FHOA 4DCXA 4GQOA 2FYIA 3Q27A 3T9HB 3OENA 5DW8A 4F1YA 1NUWA 3U65A 4GWYA 3H6VA 2OWTA 2XXUA 4DCYA 4G68B 4N6KA 3LUYA 3RT6B 4RK9A 1TFAA 3G3GA 4EDPA 4QSDA 2OZZA 4XXUA 5DT6A 4BDOA 2Y7RA 2F97A 3I5OA 1FPKA 4AQ4A 1DSNA 2QRYA 1N76A 4MNIA 4NF5B 1OQGA 4PE5B 1RDZA 3TODA 4QFOA 1I6QA 4YMBA 5JK4A 2WKYA 2XXIA 4OTEA 5LOMA 3GXAA 4ZS9A 4OHNA 3BBRA 4PF6A 5I5PA 2E0SA 4YB7A 1DK4A 4N15A 2HZKA 5DVFA 4LONB 1NV5A 1UTHB 4H5GA 1SQYA 4MLQA 4POXA 1POY1 4F2QA 4ISUA 3E79A 3ECRA 4R74A 3G3IA 1GV8A 2WYKA 3RLFE 2CZKA 1FW0A 4ZZAA 1S50A 1BP5A 3TTLA 4KYSA 2F7AA 4AS4A 1GGGA 3HFUA 3M3KA 1M5FA 2H25A 1GVCA 4NF8A 4PAIA 2ANJA 4QSEA 4EXLA 2F6GA 3ZSFA 1LBWA 1Q35A 5KZTA 2O1MA 2F34A 3H6TA 3O29A 4WXJA 4JWOA 2DVCA 1AWBA 1IXIA 1USYH 3B6QA 3OELA 3TZAA 2RKMA 3KFMA 4U2RA 4MBPA 1N3WA 3KSJA 4HS7A 3KOSA 2HZLA 2Z8FA 1Y1MA 1B9JA 4KYDA 3K1PA 3W9VA 1FTJA 3CFLA 2XXVA 3MBPA 3O6HA 5BWJA 4YZZA 2V3TA 2Z22A 2ZZXA 3QXMA 1B3GA 1BKAA 4P8BA 2QS3A 1SD3A 1XS5A 1B51A 1MPBA 4ZEIA 3V8XB 3FVGA 4FEDA 2QMXA 2F35A 1WODA 1FBEA 4RY1A 1J1NA 1FJ6A 4XEQA 3MVYA 2ZYMA 4E0WA 3KBRA 3U72A 5ESYA 4AS5A 1MPDA 1Y3PA 2REJA 4UA8A 2VD2A 4OZ9A 3C35A 4ELOA 1IMCA 4P1LA 3QYTA 1LFHA 3UN6A 1VFDA 3SEWA 4OMBA 2E1SA 4DI3D 2Q89A 3M3FA 3NOHA 2RF1A 3LSLA 3A09A 4QXDA 5ISUA 2CZIA 1JQFA 2Q2AA 4NWDA 4OANA 3P7IA 3OSRA 3TMGA 3FVNA 4NF4A 2DSFA 1UTBA 2BJJX 4MNPA 1YPNA 3C33A 3OXNA 1USYE 5ITOA 4EF1A 4Q8RA 2X7QA 4YICA 5EQAA 4P0GA 1NMUA 2IA4A 2XXHA 4IO6A 1WDNA 3CR9A 2F7BA 2UVGA 1IMFA 1SI0A 5I2NA 1FQEA 1JVXA 1KZ8A 4KI0E 3UIFA 3CHGA 4NHBA 2XXPA 4XFEA 3FVKA 1QULA 2RC7A 5CRYA 5TP9A 2F3DA 2VGQA 1SI1A 2FHYA 4DIGA 1LAGE 3MVXA 2NVUB 3PU5A 4GX4A 1MH3A 4P9KA 1IMEA 4NF5A 5ET6A 1FJ9A 1B52A 4MMPA 3H6WA 4X9TA 4IY5A 3IAZA 1XI6A 1ZBMA 1FTKA 1PBPA 3VFJA 1N7WA 3GBBA 5F1QA 2VHAA 4PDHA 4OA4A 4OVPA 3IOWA 2VT5A 1PB8A 1BTJA 1Z7ME 5AA2A
chains in the Genus database with same CATH topology
4GWYA 4O7IA 5LTCA 4MNPA 4N8GA 1NV7A 4GWZA 2WBDA 5J16A 2FIXA 2HZLA 4PCDA 1FTAA 3IFCA 4HE0A 5A5LA 4N4UA 1YYZA 4JVCA 4LN5A 4MEVA 3SZPA 1NV3A 4NQ8A 1G0HA 1BK4A 4PTKA 1EYKA 4MX6A 5IZ3A 1LBYA 4GBWA 1FSAA 1EYIA 3LUZA 3ISPA 2CEXA 4MHFA 4N6KA 3W9VA 2XWVA 4PGNA 3ROJA 4N81A 1NUXA 2CEYA 3GYYA 1CNQA 2QPQA 3RYDA 2XWKA 4PBQA 4KXPA 4NAPA 3IFAA 2Y5KA 4GX3A 4N6DA 1YXIA 4NF0A 1FPEA 1FPFA 1SPIA 3FBPA 4H45A 5IZ3B 1KA1A 4YZZA 1LBVA 4PAFA 2P3VA 2ZZXA 4PFBA 4YICA 2PCRA 5EQAA 4MIJA 3A29A 2L5VA 1NV4A 1NI9A 4P1EA 4PBHA 1Q9DA 4F1VA 1NUYA 1VDWA 4HE2A 1RDYA 4P8BA 4UABA 1IMAA 2CZHA 1FPIA 2QVRA 1FPKA 3KC1A 4X04A 5J1DA 5IM2A 3LV0A 2GQ1A 2P3NA 3QMFA 4HCYA 1NV1A 1IMFA 3KC0A 4MNIA 3U65A 5F24A 4GX6A 1FPDA 5CM6A 2JJKA 4JVDA 4HXVA 4PDDA 1FBEA 1KZ8A 1QGXA 1RDZA 2QVVA 4I40A 5IZ1A 4X8RA 4N17A 2B4MA 2Y5LA 1FRPA 5EYHA 2MKZA 1DCUA 1FBDA 3CHGA 1FPJA 4NHBA 2HPGA 3W9WA 1NV6A 1K9ZA 4O94A 1FJ6A 5T3JA 5JK4A 1IMBA 5I3SA 4XEQA 1NV2A 1INPA 4XFEA 4O7MA 1NV0A 4F19A 3FXBA 2V4CA 2R8TA 2F3DA 4PF6A 2DE2A 2B4LA 2WEFA 2OWZA 4GBVA 3D1RA 5ESYA 3B8BA 4OVRA 4HE1A 4GWWA 4AS5A 5I5PA 2DE3A 4GWSA 2XXKA 1DK4A 4NN3A 4N15A 4MNCA 2HZKA 4O8MA 2FHYA 3EKIA 1FBHA 1NV5A 2XA5A 4F18A 3KBZA 4QBAA 4PC9A 4NG7A 4MAGA 4P56A 2FBPA 2ZZVA 2HHMA 4GX4A 1FPLA 4PFRA 4DI4B 5EQ7A 4P9KA 2VPOA 1FPBA 4I3EA 3E79A 1IMCA 4P1LA 5ET8A 2DE4A 1FBFA 3BIHA 2KQZA 1LEVA 1FPGA 2VPNA 2WYKA 1FBCA 1K9YA 2FVZA 2XWIA 2F5XA 3MSTA 4IR8A 2DDKA 2HXRA 5IGAA 1IMEA 5IZZA 2CZKA 5ET6A 2XWOA 1FJ9A 4MMPA 3B50A 4DI3D 4AS4A 4N8YA 4N91A 1LBZA 1LBXA 1IMDA 2WX9A 4P47A 1FBPA 3BIGA 3HFUA 4NGUA 4X9TA 2OX3A 2F3BA 4F1UA 3NOHA 4OVSA 4XF5A 3MYUA 4JVIA 4FBPA 1XI6A 4OVTA 1D9QA 2DVZA 4NX1A 1NUZA 4G61A 4I3YA 4QXDA 4OVQA 5ET7A 4PAIA 2V3QA 1KA0A 2WYPA 4MCOA 5ET5A 3RPLA 2PFYA 1DBZA 2BJIA 5I7IA 5EYGA 4P3LA 4PAKA 2Q9TA 1LBWA 4GWXA 5EQ8A 3T1BA 2CZIA 3PTYA 4OANA 5FBPA 5EQ9A 2Q8MA 4MJOA 3T0JA 4PFIA 4PDHA 3E78A 2PFZA 4PETA 5LDZA 4H46A 2Q74A 4OA4A 4M1VA 4OVPA 4PE3A 2VT5A 1AWBA 3RPLB 2KR0A 4HCWA 1RDXA 5DW8A 2ZZWA 1G0IA 1YZ0A 2FIEA 2QVUA 1EYJA 4PGPA 1JP4A 1NUWA 2QFLA 1FBGA 4GWUA 2WBBA 4PF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GWY A;  4O7I A;  1NV7 A;  4GWZ A;  2WBD A;  5J16 A;  2FIX A;  1FTA A;  3IFC A;  4HE0 A;  5A5L A;  1YYZ A;  1NV3 A;  1G0H A;  1BK4 A;  4PTK A;  1EYK A;  5IZ3 A;  1LBY A;  4GBW A;  1FSA A;  1EYI A;  3LUZ A;  3ROJ A;  4N81 A;  1NUX A;  1CNQ A;  3RYD A;  4KXP A;  3IFA A;  2Y5K A;  4GX3 A;  1YXI A;  1FPE A;  1FPF A;  1SPI A;  3FBP A;  4H45 A;  5IZ3 B;  1KA1 A;  1LBV A;  2P3V A;  2PCR A;  5EQA A;  3A29 A;  1NV4 A;  1NI9 A;  1Q9D A;  1NUY A;  1VDW A;  4HE2 A;  1RDY A;  1IMA A;  2CZH A;  1FPI A;  2QVR A;  1FPK A;  3KC1 A;  3LV0 A;  2GQ1 A;  2P3N A;  3QMF A;  1NV1 A;  1IMF A;  3KC0 A;  5F24 A;  4GX6 A;  1FPD A;  2JJK A;  4HXV A;  1FBE A;  1KZ8 A;  1QGX A;  1RDZ A;  2QVV A;  4I40 A;  5IZ1 A;  2Y5L A;  1FRP A;  5EYH A;  1DCU A;  1FBD A;  1FPJ A;  1NV6 A;  1K9Z A;  1FJ6 A;  5T3J A;  1IMB A;  5I3S A;  1NV2 A;  1INP A;  1NV0 A;  2R8T A;  2F3D A;  2WEF A;  2OWZ A;  4GBV A;  3D1R A;  5ESY A;  3B8B A;  4HE1 A;  4GWW A;  4AS5 A;  4GWS A;  1DK4 A;  2FHY A;  1FBH A;  1NV5 A;  3KBZ A;  2FBP A;  2HHM A;  4GX4 A;  1FPL A;  5EQ7 A;  1FPB A;  4I3E A;  1IMC A;  5ET8 A;  1FBF A;  3BIH A;  1LEV A;  1FPG A;  1FBC A;  1K9Y A;  2FVZ A;  4IR8 A;  2DDK A;  1IME A;  2CZK A;  5ET6 A;  1FJ9 A;  4AS4 A;  1LBZ A;  1LBX A;  1IMD A;  1FBP A;  3BIG A;  2OX3 A;  2F3B A;  4FBP A;  1XI6 A;  1D9Q A;  1NUZ A;  4G61 A;  4I3Y A;  4QXD A;  5ET7 A;  1KA0 A;  5ET5 A;  3RPL A;  1DBZ A;  2BJI A;  5EYG A;  1LBW A;  4GWX A;  5EQ8 A;  2CZI A;  5FBP A;  5EQ9 A;  2Q8M A;  4MJO A;  3T0J A;  5LDZ A;  4H46 A;  2Q74 A;  2VT5 A;  1AWB A;  3RPL B;  1RDX A;  5DW8 A;  1G0I A;  1YZ0 A;  2FIE A;  2QVU A;  1EYJ A;  1JP4 A;  1NUW A;  2QFL A;  1FBG A;  4GWU A;  2WBB A; 
#chains in the Genus database with same CATH topology
 5TPA B;  3FZV A;  5K2Y A;  5J16 A;  4HE0 A;  4RXL A;  1TXF A;  1VSO A;  5FTI A;  4O3A A;  3A3U A;  1P1U A;  4N6D A;  4PFI A;  4ZEK A;  3RY3 A;  4H45 A;  1SPI A;  4FOR A;  3A29 A;  2V84 A;  1D3K A;  3E9X A;  1VDW A;  5H8Q A;  2H5Y A;  3MQ9 A;  3HPI A;  1Q1K A;  5F24 A;  5KCJ B;  4Q0C A;  2JJK A;  4PDD A;  2B4M A;  4KQP A;  5T3J A;  3PPQ A;  2R8T A;  2B4L A;  4GWW A;  3C9H A;  4GVO A;  2DE3 A;  3G3J A;  1II5 A;  1MH4 A;  2DOJ A;  3PGF A;  4C0R A;  3SKP A;  4G8M A;  2DE4 A;  2RCB A;  1FPG A;  1LAH E;  2ZNU A;  1QUI A;  1SYH A;  2G29 A;  1EH3 A;  2F3B A;  2YLN A;  1B5I A;  3E4R A;  2VP1 A;  2WYP A;  3V83 A;  2ONK E;  3PTY A;  3T0J A;  2PFZ A;  4H46 A;  2PBW A;  1LGB C;  1B7U A;  2XXT A;  3CSG A;  3IJO B;  4PE3 A;  4RPN A;  2ZZW A;  3LSX A;  4P11 A;  4RK2 A;  1MXY A;  4EQ9 A;  4N8G A;  3K0V A;  4GOT A;  4U21 A;  3CFZ A;  1US4 A;  4NQ8 A;  1EYK A;  3O9P A;  1FSA A;  3TKD A;  3ROJ A;  2I49 A;  1ZMG A;  4OQO A;  3R26 A;  2QPQ A;  2XXX A;  4H8I A;  3CRB A;  1JW4 A;  1DMB A;  4MIJ A;  4OXV A;  1B1H A;  2RIN A;  2UYE A;  2AIX A;  2XXQ A;  2D3I A;  3RUM A;  1XC1 A;  5TPA A;  1LAX A;  4GX6 A;  5CM6 A;  3PV0 E;  4XKR A;  2RCA A;  2NXO A;  4C1T A;  3TEP A;  1NV6 A;  1LAF E;  2P0S A;  1A55 A;  3FXB A;  1JVY A;  3B6W A;  4YKK A;  4NF6 A;  2DWH A;  4F3B A;  1B3F A;  1MY0 A;  2VOZ A;  3EKI A;  2ZYN A;  2XA5 A;  5H8Q B;  4ONY A;  3TTR A;  1AH5 A;  1PC3 A;  4I3E A;  3BIH A;  4OES A;  2XWI A;  2NWJ A;  4GFR A;  3D4G A;  5H8N A;  5F7V A;  4TOZ A;  3PMX A;  1M5C A;  1LBZ A;  4P47 A;  1FQF A;  4H8J A;  1FBP A;  4G4P A;  4XF5 A;  2Y7P A;  1SDX A;  4G61 A;  4OVQ A;  2B3B A;  3VLV A;  2PFY A;  3GZG A;  5EYG A;  3O97 A;  2Q9T A;  3H7M A;  4U22 A;  2PMS A;  4I9D A;  5I57 B;  3RPL B;  3SET A;  4HCW A;  1VR5 A;  1YZ0 A;  3KOT A;  1Y20 A;  3RTW B;  2WBB A;  4ELP A;  4G68 A;  3QUJ A;  2W7Y A;  1URG A;  2FIX A;  5A5L A;  2I4C A;  1UQW A;  3BKI B;  1G0H A;  2ONS A;  1MM6 A;  3MVW A;  4MX6 A;  1LBY A;  3U92 A;  1B32 A;  3SDF A;  2CEY A;  5DEX B;  4C1U A;  3OO6 A;  4DLD A;  5AA4 A;  3FBP A;  1NL5 A;  1KA1 A;  3F11 A;  1JEU A;  5K2X A;  2KLF A;  2X7P A;  2Z23 A;  4BDQ A;  3T93 B;  4OFL A;  1OLC A;  5JTY A;  4PBH A;  3VXB A;  4OER A;  1Q9D A;  1ZTY A;  1ZJL A;  3W15 C;  3BFT A;  4R2B A;  5IM2 A;  3LV0 A;  2ABH A;  1QKA A;  2Y5L A;  4Q30 B;  3DP8 A;  4O94 A;  5AA1 A;  1JET A;  4O7M A;  3OOA A;  4F19 A;  4I62 A;  5CMK A;  3TDJ A;  3D1R A;  1NFT A;  2P1S A;  1F9B A;  3U94 A;  1DTG A;  2DWJ A;  4PFR A;  3KJT A;  5FHM A;  3IB2 A;  4NED A;  3FIR A;  5CI5 A;  1P1N A;  4L17 A;  1MXW A;  2HXR A;  1H3D A;  3DLN A;  3M8U A;  4QFP A;  4EUO A;  1BIY A;  3B50 A;  1WVJ A;  4LZ5 A;  4N8Y A;  4N91 A;  1LBX A;  5FTH A;  5EHM A;  2QS4 A;  2ZMB A;  2DVZ A;  4NX1 A;  4KYE A;  3KJ7 A;  3LC8 A;  1D9V A;  4U4X A;  4P3L A;  4ZE8 A;  3T1B A;  2DWI A;  1OVT A;  3K1M A;  3EHS A;  1Y4C A;  4M1V A;  3HHF A;  3RT8 A;  2Q88 A;  5IKB A;  4AB6 A;  2KR0 A;  4MH5 A;  2QVU A;  2FIE A;  2O84 X;  4GD5 A;  2O68 A;  4N13 A;  4O7I A;  1OVB A;  1S9T A;  3K6X A;  4R73 A;  4JVC A;  3SZP A;  1BK4 A;  1MXZ A;  4NMY A;  3VVD A;  3OO9 A;  3OO8 A;  2CEX A;  3FAT A;  4JBZ A;  2CZL A;  5DVI A;  4NAP A;  5I57 A;  2P3V A;  2Y84 A;  4WED A;  3KN3 A;  3O28 A;  3CVG A;  3IO6 A;  3N6T A;  4EQB A;  2V25 A;  4QHQ A;  1OQH A;  3HHG A;  3C34 A;  2MKZ A;  2I3V A;  3S9N C;  4G2Z A;  4RPO A;  1K9Z A;  5I3S A;  4QRZ A;  3QK6 A;  1B7Z A;  4LVQ A;  2DE2 A;  4GBV A;  1P1W A;  1HSJ A;  4GWS A;  3RQT A;  4O8M A;  5JTY B;  3G3K A;  2ZZV A;  4ELR A;  3PD9 A;  3IOT A;  3MJN A;  1YAE A;  4IO7 A;  2DDK A;  1CB6 A;  3EPE A;  1B5H A;  4LP2 B;  3FXQ A;  4N6P A;  3SEX A;  4NGU A;  4GL8 A;  4JVI A;  3DP6 A;  1RYO A;  4OVT A;  3S2V A;  5HPQ A;  3GBA A;  1LB9 A;  2V3Q A;  4HTG A;  2HEU A;  1EZO A;  1MQH A;  1DBZ A;  3MWB A;  1RYX A;  1B40 A;  4MJO A;  5FHN A;  1B0H A;  2Q74 A;  4EQ7 A;  4YKI A;  1AOV A;  2QFL A;  4R6Y A;  3MPK A;  5AA3 A;  3MW0 A;  2HCA A;  4PCD A;  3VXC A;  1ANF A;  4F29 A;  5ICT A;  1EYI A;  3LUZ A;  3C32 A;  3V89 B;  3UK4 A;  1MY4 A;  1SVX B;  1NV4 A;  5I2N B;  4R9G A;  4DE8 A;  1FCK A;  1D4N A;  1IMA A;  3TQL A;  4X04 A;  1B46 A;  2THI A;  3KEI A;  1MDP 1;  4ND9 A;  3Q29 A;  4OFO A;  1MDQ A;  4F3P A;  5IZ1 A;  5L9M A;  5EYH A;  1NH7 A;  2OK2 A;  4MNC A;  3Q26 A;  4G8H A;  1QUK A;  3TPA A;  2HHM A;  3T96 B;  3TYH A;  1LFI A;  1D9Y A;  1LBB A;  3MST A;  1XVX A;  4Z0I A;  1PB7 A;  1GR2 A;  5KDT A;  4U1Z A;  5H8F B;  5AA2 D;  3LSF B;  1Z7N E;  3O66 A;  5I59 B;  3MYU A;  1D9Q A;  2REG A;  2QS1 A;  3KSX A;  1ZIU A;  3PPP A;  3IK6 B;  1URD A;  3FD3 A;  4AB5 A;  3PPN A;  2XXR A;  1H76 A;  3E78 A;  5A5X A;  3O6I A;  1IXC A;  4YAH X;  1JW5 A;  4F2O A;  5LTC A;  2DQV A;  3UA8 A;  3RTF B;  4LN5 A;  4LUB A;  2O6A A;  2F36 A;  2Y7W A;  3UOR A;  4GBW A;  2PT1 A;  3IB1 A;  2R71 A;  2HXW A;  4EXK A;  3MP1 A;  4NF0 A;  1YXI A;  3TCG A;  3O6G A;  4JSO A;  1ZU0 A;  2P2A A;  1B5J A;  1MQG A;  1TT1 A;  1O7T A;  4F1V A;  4GXA A;  4UAB A;  1LFG A;  3FUZ A;  4JSD A;  3O2A A;  1B0L A;  1Y9U A;  3EQ1 A;  3TTK A;  1NV1 A;  3CSB A;  1LLS A;  1FPD A;  3TTM A;  4IO3 A;  3T9V A;  2QVV A;  3QIM A;  4O3C A;  2HPG A;  2F6P A;  1I6A A;  4OEN A;  3C4M A;  1XT8 A;  1JW1 A;  3FJG A;  4N07 A;  3QUF A;  4RNS A;  2G93 A;  1NNP A;  1NNT A;  2HQ0 A;  2VPO A;  1QVS A;  2PVU A;  4BDM A;  4IY6 A;  2KQZ A;  1LEV A;  2QS2 A;  3FXU A;  2ZYO A;  2H98 A;  1N7X A;  3FJM A;  4ZEC A;  2X26 A;  3OMB A;  1OLA A;  3VE1 B;  5CMM A;  4ECF A;  5FBP A;  4YU0 A;  3OEM A;  4F39 A;  3S9E A;  2O7U A;  4IO5 A;  1EYJ A;  2O1L A;  5KDT B;  3E3K A;  3KZG A;  1SW4 A;  1NV7 A;  1NNK A;  2WBD A;  3R6U A;  3IFC A;  2B3F A;  2OBG A;  2AYS A;  3IL1 B;  2VD3 A;  1I6B A;  1YTV A;  1MY1 A;  3TTN A;  3K4U A;  3MP8 A;  1DPE A;  4F31 B;  4QF9 A;  3B6T A;  3RYD A;  5CBR A;  1EZ9 A;  4YKJ A;  4F22 A;  1FPE A;  1FPF A;  1N84 A;  4U1O A;  2PCR A;  2OLB A;  1SYI A;  4WKM A;  4JWX A;  4FEC A;  5J1D A;  1FPI A;  2OPE A;  4JDF A;  2XX8 A;  1LCT A;  4HW8 A;  3VVF A;  3TQW A;  1MRP A;  4BDR A;  1MY2 A;  1T0K A;  4NF6 B;  1IUD A;  5I58 A;  3EF7 A;  3SES A;  1B4Z A;  1FQB A;  2XX9 A;  2FA7 A;  4F3G A;  4NN3 A;  3MVZ A;  3T66 A;  1MQD A;  1A7L A;  4KHZ E;  5H8N B;  1H44 A;  2Y7I A;  3OSQ A;  4R6K A;  4X1D A;  1QUJ A;  1FBC A;  2F5X A;  5IZZ A;  3N94 A;  2Q8J A;  3FVO A;  1MXX A;  4U23 A;  3FGS A;  5B7D A;  1FTO A;  4EF2 A;  1KA0 A;  1B3L A;  3RPL A;  5CBS A;  4PAK A;  4GWX A;  3CIJ A;  2Q8M A;  5I2K A;  4G77 A;  1IZ1 A;  3I3V A;  1B1X A;  5H8S A;  1B3H A;  1RDX A;  4PGP A;  3S9L C;  3LBS A;  1MXV A;  3IJX B;  1A40 A;  4R2F A;  4GWZ A;  1MQI A;  2OWS A;  4OVJ A;  3PUW E;  3L6G A;  4LZ8 A;  2XXW A;  4N4U A;  5DEX A;  4KR5 A;  2PYY A;  1SW2 A;  4GXS B;  3ISP A;  1HSE A;  1CE2 A;  4XIG Q;  4PGN A;  1NUX A;  3HV1 A;  2XHD A;  2QSX A;  5ITP A;  1R9L A;  4GF8 A;  2RC9 A;  5IZ3 B;  1P99 A;  3MZ9 A;  3VLU A;  2Z8D A;  3I6V A;  1NI9 A;  4LAT A;  2PT2 A;  4PFY A;  3PUY E;  3HO7 A;  5L9O A;  4TQU Q;  2OCU A;  2UVH A;  2UXA A;  3W9W A;  4I1D A;  4XKN A;  3CI8 A;  4ZED A;  2ZXT A;  1INP A;  4GL0 A;  4XKQ A;  1NV0 A;  3H3G A;  4JXI A;  3HN0 A;  2H9B A;  2OWZ A;  3AXF A;  4OVR A;  1S7Y A;  4NF4 B;  1JEV A;  2R6G E;  4ZZE A;  3PPR A;  5EQ7 A;  4KCC A;  4TLM B;  4BDN A;  1UIV A;  2M8C A;  1XVY A;  3E13 X;  1EZP A;  3SER A;  1H45 A;  4H0W A;  2FNC A;  4QFL A;  4PP0 A;  4R6H A;  2D21 A;  1NUZ A;  4OWD A;  3PUV E;  4X1B A;  3MAM A;  3ONM A;  4E0X A;  4OET A;  1EU8 A;  2BJI A;  4Z7E A;  2ZNT A;  1TWY A;  3IO4 A;  3VDF A;  1H43 A;  3MC2 A;  3H4Z A;  2ONR A;  3S4U A;  3UGW A;  1YCJ A;  1MM7 A;  2O51 A;  4I8C A;  3OD7 A;  4GWU A;  5AE4 A;  5TU0 A;  2UVJ A;  3K6U A;  5B70 A;  1PBQ A;  5I56 B;  2I4B A;  3PUX E;  3JV9 A;  3B7D A;  3ILT B;  4MHF A;  5L9S A;  4RA1 A;  3GYY A;  3LSW A;  1GTK A;  3IFA A;  4GX3 A;  4PFB A;  1ELJ A;  3VVE A;  3CG1 A;  4H67 A;  1KWH A;  4KD5 A;  4HE2 A;  4GIZ A;  3IB0 A;  1US5 A;  2A5T A;  3VV5 A;  1XHY A;  3TCH A;  2GFE A;  4IGR A;  4JVD A;  1QGX A;  1M5D A;  5ELV A;  4N17 A;  4YB6 A;  1FBD A;  4FIM A;  2HAU A;  3MZB A;  4R75 A;  4FJP A;  3THI A;  3C36 A;  1ZKB A;  4QFK A;  2XXK A;  2I0B A;  3EHT A;  2ALU A;  4LQ5 A;  4DZ1 A;  1ZLQ A;  3N5L A;  4KPT A;  1QKB A;  2YJP A;  3N26 A;  2YPN A;  3FAS A;  1QJM A;  2AL5 A;  4DI4 B;  1HSL A;  4IR8 A;  3T9X B;  1XOC A;  3DEL B;  1OMP A;  1IMD A;  2WX9 A;  3ILU B;  3SEV A;  1UIU A;  1MS7 A;  4PFT A;  4FBP A;  3TCF A;  1IXH A;  5ET7 A;  2D5W A;  3EHU A;  4YMA A;  4MCO A;  5ET5 A;  3N6U A;  1PDA A;  2DXR A;  3MP6 A;  3DP4 A;  3H6U A;  4F3S A;  3EN3 A;  3R7X A;  4BDL A;  2H99 A;  1G0I A;  1A54 A;  4QSC A;  1FBG A;  2O7I A;  3OEK A;  5EHS A;  2I3W A;  1Y1Z A;  1MQJ A;  4NE4 A;  2B65 A;  4KFQ A;  1NV3 A;  3H06 B;  4ZE9 A;  2QMW A;  1AL3 A;  3KN8 A;  2XWV A;  1VFE A;  2I6E A;  2NOO A;  4ZDM A;  2Q2C A;  5DTB A;  1LBV A;  1NH8 A;  5ICQ A;  1O64 A;  4PFW A;  3HST A;  3TEL A;  1ATG A;  1RDY A;  3ZS6 A;  3TAJ A;  2DYX A;  1N3X A;  1NNF A;  3QSL A;  5CMB A;  1TFD A;  2GQ1 A;  2P3N A;  4K3F A;  3K6V A;  5CMC A;  3FV2 A;  4HXV A;  3K1N A;  2QL3 A;  1DCU A;  1FPJ A;  2CMO A;  3QAX A;  1NV2 A;  3IOV A;  4WEP A;  1R9Q A;  1Y3Q A;  4NWC A;  1NKX A;  2I48 A;  4PC9 A;  2FBP A;  1IIT A;  1LST A;  3KG2 A;  4H1X A;  2A5T B;  4Q5T A;  2LAO A;  1FPB A;  5H8F A;  4JB7 A;  5IGA A;  4XKP A;  4RJZ A;  3UP9 A;  2OX3 A;  3RPW A;  5HBC A;  4G8N A;  1MPC A;  3TUS A;  4I3Y A;  4FAT A;  5EQ8 A;  3OO7 A;  1DPP A;  4RYA A;  1SW1 A;  5EQ9 A;  4PET A;  4IO2 A;  3PMW A;  5H8H A;  1PB9 A;  3A3C A;  3RN8 A;  2GH9 A;  2R9J A;  2OJT A;  4YKP A;  1B2H A;  2O69 A;  1B05 A;  2UVI A;  2Y5K A;  3HCQ A;  4OEV A;  3G3H A;  2XX7 A;  3MUQ A;  2V93 A;  3MPL A;  1POT A;  1NUY A;  1FQA A;  2QVR A;  3QMF A;  1SW5 A;  3JZJ A;  1R1N A;  4TLL B;  4I40 A;  4X8R A;  1N0T A;  4DXU A;  3CFX A;  4R72 A;  5I56 A;  4P0I A;  3U93 A;  4FAJ A;  3U1O A;  4IGT A;  1A99 A;  3IOU A;  1PEB A;  2WEF A;  4ELQ A;  2ZNS A;  3CG3 A;  1RKM A;  4F18 A;  3WAF A;  3KBZ A;  5TP9 B;  3K01 A;  1OIB A;  1O63 A;  1SBP A;  2Z8E A;  1AIV A;  3USD A;  2F7C A;  2F8D A;  5ET8 A;  3PMV A;  3G7W A;  1K9Y A;  4ZEB A;  2RC8 A;  2PX1 A;  2IEE A;  5AA4 B;  3FV1 A;  4XTC Q;  3BIG A;  4OVS A;  4X48 A;  3TFL A;  4H6D A;  1AMF A;  1I69 A;  4FE8 A;  1Y4T A;  4LA9 A;  4O3B A;  3ODB A;  2Y7K A;  3LR1 A;  1IIW A;  4PFU A;  4ESW A;  1MXU A;  4OYV A;  2XD2 A;  4ESX A;  2OPD A;  5AA2 B;  4PTK A;  4G68 C;  4OFJ A;  3PPO A;  4DXB A;  2DXY A;  5JEI A;  2GRV A;  3V5A A;  3IOR A;  1CNQ A;  3PUZ E;  1A8E A;  4PBQ A;  4KXP A;  3RGY A;  1VE4 A;  3ZKL A;  3ZKK A;  3H03 A;  4DXC A;  1JNF A;  5L8D A;  2L5V A;  3U8Q A;  1B7H A;  4P1E A;  2H4I A;  2QJE A;  4M4G A;  2CZH A;  3VLW A;  1DTZ A;  3BFU A;  3KC0 A;  4KCD A;  5I58 B;  1DOT A;  4U4S A;  4IO4 A;  1N04 A;  1QW0 A;  3GLB A;  1FRP A;  3T22 A;  4BLA A;  3M3L A;  5KCJ A;  1P1Q A;  4QFN A;  1FTL A;  4GWO A;  2V4C A;  5BUU A;  1URS A;  4MFI A;  5DYH A;  3K2D A;  2XD3 A;  4OEU A;  4QBA A;  4NG7 A;  4MAG A;  4UAC A;  5M2V A;  1FPL A;  4POW A;  1IQ7 A;  2VPN A;  1LB8 A;  1B58 A;  5IAI A;  5DVJ A;  3MZ1 A;  1LCF A;  4F1U A;  1FTM A;  1B3E A;  2ZYK A;  3IR1 A;  2HFB A;  5I2K B;  2A5S A;  1FQC A;  2GHA A;  2NUV A;  3S9M C;  5LDZ A;  1P1O A;  2HAV A;  2I58 A;  4FEB A;  3IX1 A;  3RNN A;  1JP4 A;  4PF8 A;  3KGC A;  4R9F A;  2UYF A;  1FTA A;  3SEU A;  1YYZ A;  4MEV A;  4LQ2 A;  2AL4 A;  2F78 A;  5IZ3 A;  1IEJ A;  1R6Z A;  4N81 A;  4THI A;  1IXG A;  2XWK A;  3WAE A;  4IB2 A;  5I84 A;  4PAF A;  3T9U A;  2I0C A;  5I59 A;  4NTL A;  1MY3 A;  3DM0 A;  3PD8 A;  1UTH A;  3K00 A;  3KC1 A;  1LBC A;  2XXY A;  5H8H B;  3L6H A;  4PQJ A;  1M5E A;  4MLV A;  4DDD A;  4HCY A;  3D4C A;  1M5B A;  4YB5 A;  4MF3 A;  5A5X B;  3SEY A;  1IMB A;  3FJ7 A;  2DP8 A;  3G3F A;  4GLI A;  3K02 A;  3B8B A;  4HE1 A;  2DS9 A;  5HM4 B;  4LZ7 A;  1B4H A;  4NF8 B;  3FXR A;  3KN7 A;  1FBH A;  1A8F A;  1FQD A;  4P56 A;  3JYR A;  1BLF A;  4H65 A;  3K6W A;  1MG1 A;  3C31 A;  4H5F A;  2GHB A;  1FBF A;  1B6H A;  1UTB B;  5CC2 A;  2FVZ A;  4ZEF A;  2XWO A;  2V3U A;  3Q25 A;  4GRK A;  1Y3N A;  4JWY A;  5EYF A;  2DWA A;  1L5T A;  5I7I A;  2ESN A;  3Q28 A;  5FHO A;  4DCX A;  4GQO A;  2FYI A;  3Q27 A;  3T9H B;  3OEN A;  5DW8 A;  4F1Y A;  1NUW A;  3U65 A;  4GWY A;  3H6V A;  2OWT A;  2XXU A;  4DCY A;  4G68 B;  4N6K A;  3LUY A;  3RT6 B;  4RK9 A;  1TFA A;  3G3G A;  4EDP A;  4QSD A;  2OZZ A;  4XXU A;  5DT6 A;  4BDO A;  2Y7R A;  2F97 A;  3I5O A;  1FPK A;  4AQ4 A;  1DSN A;  2QRY A;  1N76 A;  4MNI A;  4NF5 B;  1OQG A;  4PE5 B;  1RDZ A;  3TOD A;  4QFO A;  1I6Q A;  4YMB A;  5JK4 A;  2WKY A;  2XXI A;  4OTE A;  5LOM A;  3GXA A;  4ZS9 A;  4OHN A;  3BBR A;  4PF6 A;  5I5P A;  2E0S A;  4YB7 A;  1DK4 A;  4N15 A;  2HZK A;  5DVF A;  4LON B;  1NV5 A;  1UTH B;  4H5G A;  1SQY A;  4MLQ A;  4POX A;  1POY 1;  4F2Q A;  4ISU A;  3E79 A;  3ECR A;  4R74 A;  3G3I A;  1GV8 A;  2WYK A;  3RLF E;  2CZK A;  1FW0 A;  4ZZA A;  1S50 A;  1BP5 A;  3TTL A;  4KYS A;  2F7A A;  4AS4 A;  1GGG A;  3HFU A;  3M3K A;  1M5F A;  2H25 A;  1GVC A;  4NF8 A;  4PAI A;  2ANJ A;  4QSE A;  4EXL A;  2F6G A;  3ZSF A;  1LBW A;  1Q35 A;  5KZT A;  2O1M A;  2F34 A;  3H6T A;  3O29 A;  4WXJ A;  4JWO A;  2DVC A;  1AWB A;  1IXI A;  1USY H;  3B6Q A;  3OEL A;  3TZA A;  2RKM A;  3KFM A;  4U2R A;  4MBP A;  1N3W A;  3KSJ A;  4HS7 A;  3KOS A;  2HZL A;  2Z8F A;  1Y1M A;  1B9J A;  4KYD A;  3K1P A;  3W9V A;  1FTJ A;  3CFL A;  2XXV A;  3MBP A;  3O6H A;  5BWJ A;  4YZZ A;  2V3T A;  2Z22 A;  2ZZX A;  3QXM A;  1B3G A;  1BKA A;  4P8B A;  2QS3 A;  1SD3 A;  1XS5 A;  1B51 A;  1MPB A;  4ZEI A;  3V8X B;  3FVG A;  4FED A;  2QMX A;  2F35 A;  1WOD A;  1FBE A;  4RY1 A;  1J1N A;  1FJ6 A;  4XEQ A;  3MVY A;  2ZYM A;  4E0W A;  3KBR A;  3U72 A;  5ESY A;  4AS5 A;  1MPD A;  1Y3P A;  2REJ A;  4UA8 A;  2VD2 A;  4OZ9 A;  3C35 A;  4ELO A;  1IMC A;  4P1L A;  3QYT A;  1LFH A;  3UN6 A;  1VFD A;  3SEW A;  4OMB A;  2E1S A;  4DI3 D;  2Q89 A;  3M3F A;  3NOH A;  2RF1 A;  3LSL A;  3A09 A;  4QXD A;  5ISU A;  2CZI A;  1JQF A;  2Q2A A;  4NWD A;  4OAN A;  3P7I A;  3OSR A;  3TMG A;  3FVN A;  4NF4 A;  2DSF A;  1UTB A;  2BJJ X;  4MNP A;  1YPN A;  3C33 A;  3OXN A;  1USY E;  5ITO A;  4EF1 A;  4Q8R A;  2X7Q A;  4YIC A;  5EQA A;  4P0G A;  1NMU A;  2IA4 A;  2XXH A;  4IO6 A;  1WDN A;  3CR9 A;  2F7B A;  2UVG A;  1IMF A;  1SI0 A;  5I2N A;  1FQE A;  1JVX A;  1KZ8 A;  4KI0 E;  3UIF A;  3CHG A;  4NHB A;  2XXP A;  4XFE A;  3FVK A;  1QUL A;  2RC7 A;  5CRY A;  5TP9 A;  2F3D A;  2VGQ A;  1SI1 A;  2FHY A;  4DIG A;  1LAG E;  3MVX A;  2NVU B;  3PU5 A;  4GX4 A;  1MH3 A;  4P9K A;  1IME A;  4NF5 A;  5ET6 A;  1FJ9 A;  1B52 A;  4MMP A;  3H6W A;  4X9T A;  4IY5 A;  3IAZ A;  1XI6 A;  1ZBM A;  1FTK A;  1PBP A;  3VFJ A;  1N7W A;  3GBB A;  5F1Q A;  2VHA A;  4PDH A;  4OA4 A;  4OVP A;  3IOW A;  2VT5 A;  1PB8 A;  1BTJ A;  1Z7M E;  5AA2 A; 
#chains in the Genus database with same CATH homology
 4GWY A;  4O7I A;  5LTC A;  4MNP A;  4N8G A;  1NV7 A;  4GWZ A;  2WBD A;  5J16 A;  2FIX A;  2HZL A;  4PCD A;  1FTA A;  3IFC A;  4HE0 A;  5A5L A;  4N4U A;  1YYZ A;  4JVC A;  4LN5 A;  4MEV A;  3SZP A;  1NV3 A;  4NQ8 A;  1G0H A;  1BK4 A;  4PTK A;  1EYK A;  4MX6 A;  5IZ3 A;  1LBY A;  4GBW A;  1FSA A;  1EYI A;  3LUZ A;  3ISP A;  2CEX A;  4MHF A;  4N6K A;  3W9V A;  2XWV A;  4PGN A;  3ROJ A;  4N81 A;  1NUX A;  2CEY A;  3GYY A;  1CNQ A;  2QPQ A;  3RYD A;  2XWK A;  4PBQ A;  4KXP A;  4NAP A;  3IFA A;  2Y5K A;  4GX3 A;  4N6D A;  1YXI A;  4NF0 A;  1FPE A;  1FPF A;  1SPI A;  3FBP A;  4H45 A;  5IZ3 B;  1KA1 A;  4YZZ A;  1LBV A;  4PAF A;  2P3V A;  2ZZX A;  4PFB A;  4YIC A;  2PCR A;  5EQA A;  4MIJ A;  3A29 A;  2L5V A;  1NV4 A;  1NI9 A;  4P1E A;  4PBH A;  1Q9D A;  4F1V A;  1NUY A;  1VDW A;  4HE2 A;  1RDY A;  4P8B A;  4UAB A;  1IMA A;  2CZH A;  1FPI A;  2QVR A;  1FPK A;  3KC1 A;  4X04 A;  5J1D A;  5IM2 A;  3LV0 A;  2GQ1 A;  2P3N A;  3QMF A;  4HCY A;  1NV1 A;  1IMF A;  3KC0 A;  4MNI A;  3U65 A;  5F24 A;  4GX6 A;  1FPD A;  5CM6 A;  2JJK A;  4JVD A;  4HXV A;  4PDD A;  1FBE A;  1KZ8 A;  1QGX A;  1RDZ A;  2QVV A;  4I40 A;  5IZ1 A;  4X8R A;  4N17 A;  2B4M A;  2Y5L A;  1FRP A;  5EYH A;  2MKZ A;  1DCU A;  1FBD A;  3CHG A;  1FPJ A;  4NHB A;  2HPG A;  3W9W A;  1NV6 A;  1K9Z A;  4O94 A;  1FJ6 A;  5T3J A;  5JK4 A;  1IMB A;  5I3S A;  4XEQ A;  1NV2 A;  1INP A;  4XFE A;  4O7M A;  1NV0 A;  4F19 A;  3FXB A;  2V4C A;  2R8T A;  2F3D A;  4PF6 A;  2DE2 A;  2B4L A;  2WEF A;  2OWZ A;  4GBV A;  3D1R A;  5ESY A;  3B8B A;  4OVR A;  4HE1 A;  4GWW A;  4AS5 A;  5I5P A;  2DE3 A;  4GWS A;  2XXK A;  1DK4 A;  4NN3 A;  4N15 A;  4MNC A;  2HZK A;  4O8M A;  2FHY A;  3EKI A;  1FBH A;  1NV5 A;  2XA5 A;  4F18 A;  3KBZ A;  4QBA A;  4PC9 A;  4NG7 A;  4MAG A;  4P56 A;  2FBP A;  2ZZV A;  2HHM A;  4GX4 A;  1FPL A;  4PFR A;  4DI4 B;  5EQ7 A;  4P9K A;  2VPO A;  1FPB A;  4I3E A;  3E79 A;  1IMC A;  4P1L A;  5ET8 A;  2DE4 A;  1FBF A;  3BIH A;  2KQZ A;  1LEV A;  1FPG A;  2VPN A;  2WYK A;  1FBC A;  1K9Y A;  2FVZ A;  2XWI A;  2F5X A;  3MST A;  4IR8 A;  2DDK A;  2HXR A;  5IGA A;  1IME A;  5IZZ A;  2CZK A;  5ET6 A;  2XWO A;  1FJ9 A;  4MMP A;  3B50 A;  4DI3 D;  4AS4 A;  4N8Y A;  4N91 A;  1LBZ A;  1LBX A;  1IMD A;  2WX9 A;  4P47 A;  1FBP A;  3BIG A;  3HFU A;  4NGU A;  4X9T A;  2OX3 A;  2F3B A;  4F1U A;  3NOH A;  4OVS A;  4XF5 A;  3MYU A;  4JVI A;  4FBP A;  1XI6 A;  4OVT A;  1D9Q A;  2DVZ A;  4NX1 A;  1NUZ A;  4G61 A;  4I3Y A;  4QXD A;  4OVQ A;  5ET7 A;  4PAI A;  2V3Q A;  1KA0 A;  2WYP A;  4MCO A;  5ET5 A;  3RPL A;  2PFY A;  1DBZ A;  2BJI A;  5I7I A;  5EYG A;  4P3L A;  4PAK A;  2Q9T A;  1LBW A;  4GWX A;  5EQ8 A;  3T1B A;  2CZI A;  3PTY A;  4OAN A;  5FBP A;  5EQ9 A;  2Q8M A;  4MJO A;  3T0J A;  4PFI A;  4PDH A;  3E78 A;  2PFZ A;  4PET A;  5LDZ A;  4H46 A;  2Q74 A;  4OA4 A;  4M1V A;  4OVP A;  4PE3 A;  2VT5 A;  1AWB A;  3RPL B;  2KR0 A;  4HCW A;  1RDX A;  5DW8 A;  2ZZW A;  1G0I A;  1YZ0 A;  2FIE A;  2QVU A;  1EYJ A;  4PGP A;  1JP4 A;  1NUW A;  2QFL A;  1FBG A;  4GWU A;  2WBB A;  4PF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...