2CZIA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
268
structure length
259
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEETKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Inositol monophosphatase 2
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 259
sequence length 268
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2cziA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2cziA02
2F3BA 3B8BA 5ESYA 2FVZA 3FBPA 1G0IA 1AWBA 5EQ8A 4PTKA 1FJ9A 2QFLA 2Y5LA 3KC0A 4FBPA 4GWZA 3KC1A 1DCUA 5EQ9A 1EYJA 4QXDA 2WEFA 1NV2A 1DBZA 4G61A 4I3EA 1FPKA 1IMFA 1NUWA 2WBDA 1FPFA 1KZ8A 1G0HA 5F24A 1FTAA 2CZHA 1NV7A 1LBWA 1FBDA 1D9QA 5T3JA 1FPGA 4HE1A 3KBZA 3LV0A 1FBCA 2WBBA 4N81A 5IZ3B 4GWYA 3RPLA 1IMCA 2R8TA 1IMDA 1BK4A 1FBGA 2HHMA 1FRPA 2OX3A 2FBPA 5A5LA 2FHYA 1FSAA 5DW8A 2FIEA 1FBPA 4GX3A 5ET5A 2BJIA 4GBWA 1INPA 3IFAA 1YYZA 3BIGA 4GWSA 1FBFA 1NV6A 1NV5A 1FBEA 1DK4A 1CNQA 1NV0A 4KXPA 5ET8A 2QVUA 3IFCA 3QMFA 4MJOA 3BIHA 2F3DA 4GWXA 1NV1A 2Q74A 2QVRA 1LBYA 1QGXA 1K9YA 5EQAA 1RDYA 1Q9DA 1FJ6A 2GQ1A 1IMEA 1VDWA 1IMAA 5IZ3A 5FBPA 1FPEA 1RDZA 4H46A 1LEVA 2Q8MA 4GX6A 4GBVA 2OWZA 1LBZA 2P3VA 4HE0A 5ET7A 1NUYA 5IZ1A 5J16A 1FPDA 1FPJA 1JP4A 4HXVA 1NUXA 1NV3A 3RYDA 4AS4A 1EYIA 1YZ0A 2P3NA 1K9ZA 3T0JA 4HE2A 5ET6A 3ROJA 1RDXA 2CZIA 2CZKA 1IMBA 1NI9A 4GWWA 2PCRA 5EYGA 1KA0A 4I3YA 4IR8A 1EYKA 1NV4A 4AS5A 1FPBA 1SPIA 1NUZA 2JJKA 1FPIA 4O7IA 3RPLB 1YXIA 3A29A 1FBHA 2VT5A 1FPLA 1XI6A 3D1RA 2DDKA 2Y5KA 3LUZA 4GX4A 4GWUA 5EYHA 5I3SA 5LDZA 2FIXA 1LBVA 2QVVA 1LBXA 4I40A 5EQ7A 1KA1A 4H45A
chains in the Genus database with same CATH superfamily
4ZS9A 3OOAA 3TDJA 1AWBA 3MVYA 5EQ9A 3PUYE 1I6AA 4YZZA 3TYHA 1FQAA 3N26A 2DWAA 1PBPA 3M3KA 3FUZA 1O63A 1LGBC 5I56B 1NL5A 1QUIA 4KYEA 5A5LA 2I6EA 1B9JA 3SKPA 2Z22A 1R9LA 4PGPA 4NWDA 3RT8A 3KZGA 3QXMA 5ITPA 5I59A 4EF1A 2OBGA 1FQFA 3RUMA 2HPGA 1H43A 3K6XA 3CFZA 1B40A 1P1WA 4RXLA 3K00A 1VR5A 4IO2A 4OZ9A 2DP8A 3HPIA 2XHDA 3RTFB 2F6PA 1B4HA 3JYRA 2G93A 3BFUA 1MPCA 1QKBA 4THIA 4ELQA 1N7XA 3RNNA 1LBBA 1IQ7A 3K6UA 3ECRA 5JEIA 4OVPA 1Q35A 4XKRA 2REJA 5LTCA 2R6GE 2I0BA 1ATGA 2WYPA 1NV4A 4DCXA 3SESA 4OERA 4ZEDA 4H6DA 1MXZA 2H4IA 4H8JA 4EQ9A 1Y3PA 3H06B 3SEXA 2QL3A 4ZEIA 2I4CA 3KOTA 4XIGQ 2AL4A 1L5TA 3PUXE 1NV2A 3FIRA 5IM2A 4I3EA 5I2KB 1GV8A 3PU5A 4R6KA 4MEVA 4H1XA 3TTRA 3OEMA 3OXNA 3LV0A 3E4RA 2XXXA 3MBPA 4U1OA 4HTGA 2QSXA 1PC3A 4DXCA 2XWVA 1FRPA 1ZJLA 4X1DA 1IXCA 4XXUA 2UVJA 3BIGA 2B4LA 1UTHA 3MP6A 4DLDA 3OD7A 2O69A 4PGNA 4KQPA 4P9KA 4U2RA 3SEYA 4IO3A 3FJGA 3CRBA 2XWIA 1NFTA 4ZECA 3M3FA 2FA7A 2I49A 2V3UA 1IMEA 3RLFE 5IZ3A 5H8QB 3C31A 4FIMA 4PE3A 5F1QA 2P3VA 2F7BA 2XXIA 3IOWA 1JEVA 4FEBA 3W9VA 3EKIA 4XF5A 3UORA 2ZXTA 2RKMA 4P8BA 2X26A 3THIA 2ZYKA 4F29A 5AA2D 3T9VA 2D21A 4YKPA 1MXUA 3TQWA 2DQVA 3IL1B 3D1RA 3RYDA 2DDKA 1YCJA 5LDZA 4RA1A 2QVVA 1LB9A 1LFGA 3IOVA 2F6GA 2FVZA 4FBPA 1DOTA 4LZ7A 1A8EA 2QS2A 1Y4TA 2O1LA 1USYE 3U94A 3KBZA 1MY2A 1NMUA 4OXVA 4NX1A 4ONYA 3Q25A 1MM7A 1MXVA 1SW5A 4H5GA 2UYFA 1VFEA 1R6ZA 2ZMBA 3KFMA 4EF2A 3BKIB 1JVXA 1FW0A 1ZIUA 4IO5A 4KR5A 3V83A 3D4GA 4JWOA 3OELA 4C0RA 3IORA 4RPNA 1B5JA 1MY1A 2H99A 5AA3A 4M1VA 3MYUA 4UACA 1OLAA 1RDYA 5ELVA 1M5BA 1SVXB 4LA9A 3KSXA 3FATA 3LSFB 4DE8A 3T1BA 3SZPA 5J16A 4F2QA 1HSJA 1KWHA 1JP4A 1JVYA 3GYYA 4KFQA 3TPAA 2B4MA 1YAEA 3K1MA 4Q0CA 4HS7A 1MH4A 4OETA 1N3XA 4PFWA 4MHFA 3VE1B 1B2HA 3DELB 2GFEA 4ELPA 2R9JA 1TXFA 2DE4A 1AMFA 4JBZA 3VVEA 4E0XA 4OEVA 1FJ9A 5JTYB 1BTJA 5I57A 2WEFA 1VSOA 1PB9A 3EQ1A 3H3GA 3IJXB 5F24A 3I3VA 3SDFA 3UIFA 1FTAA 2CZHA 2XX7A 3M8UA 2Q2CA 1AIVA 1FPGA 3T22A 4JVDA 3T96B 3U72A 3OO8A 2NWJA 2CEXA 2ESNA 1I6BA 3OEKA 2OCUA 3SEVA 3A3UA 1MXXA 4NQ8A 1MM6A 3MQ9A 5TU0A 4KXPA 4MLQA 2F78A 4XEQA 5AA2B 2ANJA 4JXIA 2X7PA 3D4CA 4MLVA 1ANFA 4RYAA 3PMXA 4HW8A 1Q9DA 1FQDA 2DWJA 1EZPA 3K4UA 1LAFE 5A5XB 5TP9A 5DT6A 4IO7A 3S9NC 4XFEA 3MPLA 4HXVA 1NUXA 1A55A 3VDFA 3MVZA 3C33A 3CR9A 3IK6B 3O9PA 4C1UA 2VHAA 4GIZA 4YICA 2DVCA 3G3GA 2DS9A 1TT1A 1LAHE 4MIJA 4QF9A 4YAHX 3L6GA 3QSLA 4FE8A 2Y7PA 2JJKA 3UN6A 1GTKA 1POY1 4OTEA 4OMBA 3B6WA 4NF6A 1TFDA 4M4GA 3A3CA 5K2XA 3QIMA 1ZKBA 4P1EA 4LONB 1D4NA 2WX9A 3DLNA 3RQTA 3UK4A 3GLBA 4UA8A 2PVUA 1OVTA 4U21A 4MMPA 3MP8A 3K0VA 4NF5A 4WEPA 3IO4A 5I7IA 3TEPA 1LLSA 4XKQA 1FBDA 4F31B 4HE1A 5AA4B 5I2NA 1Y1ZA 3OO6A 4PF8A 4NF8B 3Q27A 1F9BA 2XX8A 4EQBA 2CMOA 1SI0A 1II5A 2ONRA 1US4A 3QUJA 2ZYMA 5L9MA 5H8HA 3IFAA 2ABHA 4GOTA 1FBFA 2VPNA 3PTYA 4MCOA 4GFRA 4PDDA 3CIJA 3O6HA 3TCFA 5I84A 1XVXA 3MP1A 1P99A 5EQAA 1RYOA 2VP1A 2VD2A 2RCAA 3OO7A 4E0WA 3PPRA 3PMVA 2RC9A 3CHGA 4H0WA 4O94A 4U1ZA 5CM6A 1EU8A 3C34A 5I58B 4GLIA 1AOVA 5I5PA 1SBPA 3E13X 4FECA 2GH9A 4N6PA 2H5YA 4HCWA 1BIYA 2CZKA 2OWTA 1IITA 4KYSA 5AE4A 1NNTA 1FQCA 5EYHA 3HHFA 2XXTA 4Q5TA 2F8DA 4OVQA 3L6HA 5ESYA 1G0IA 1UIUA 4PTKA 1H45A 2OK2A 1QUJA 4BDRA 1FQBA 2Y7KA 3H6WA 5KZTA 1IMFA 2P1SA 4NMYA 2RC8A 4KI0E 2ZZXA 2NOOA 2P0SA 1D9QA 3G3FA 3K6WA 3RPWA 2WBBA 3T66A 1PB7A 1IUDA 4R2BA 1B3EA 4PF6A 2KQZA 2BJIA 3PMWA 3Q29A 1P1UA 2XD2A 2RINA 1IIWA 4F3SA 3LSLA 4YMBA 5EHMA 2Q74A 2QVRA 4TOZA 1QGXA 1US5A 4PAKA 4X9TA 3FV2A 3HHGA 1DTZA 1FPEA 4RK2A 3DM0A 4N13A 1NNPA 2GHAA 3CVGA 4NAPA 1NUYA 1R1NA 2QS4A 3TZAA 2VPOA 4FATA 5AA1A 3TODA 1NV3A 4AS4A 4PCDA 1JEUA 4ZE8A 1ZBMA 3PPPA 3CG3A 5HBCA 3CI8A 1RDXA 4GWWA 1TFAA 3F11A 4OEUA 4PETA 1MXYA 2H9BA 4OWDA 2Y7IA 1OQGA 5CBSA 1OVBA 3P7IA 3H4ZA 2ZZWA 4R2FA 1KA1A 4Z7EA 3RTWB 2Q2AA 2VOZA 1B51A 4IGTA 1NH8A 4PFIA 5DYHA 1SQYA 4G61A 1B4ZA 1MG1A 3ODBA 1MDQA 3ZS6A 1QUKA 1MS7A 2HQ0A 4YB5A 3MC2A 4NHBA 3TUSA 3K2DA 2ZZVA 4Z0IA 2KLFA 5TPAA 2R8TA 3IR1A 2DWHA 4DI4B 1AH5A 2FBPA 4NF4B 5BWJA 3EHTA 4NEDA 2V3TA 3G3HA 1VFDA 1MXWA 2XXQA 1POTA 1GR2A 4ZEKA 3EF7A 3MUQA 1MQJA 1YYZA 4LP2B 4YKJA 4ECFA 3OMBA 4OESA 2HCAA 1UIVA 5I57B 5DVIA 2ZNSA 4KD5A 3MSTA 1URGA 3PPNA 2LAOA 2I3WA 1QKAA 3RN8A 3PV0E 3ZSFA 1CE2A 3I5OA 1BKAA 4FAJA 3S2VA 3BBRA 4F39A 3C36A 5ET7A 4EUOA 5IZ1A 1A8FA 4LN5A 4N6DA 4EQ7A 5KCJA 4P1LA 1B52A 2P3NA 1LSTA 1SDXA 3C32A 5HPQA 1IMBA 4JSOA 3W15C 1P1NA 4X1BA 3E79A 4R72A 4LZ8A 3OSRA 2PMSA 3VV5A 2UVIA 4NWCA 2V25A 2D5WA 4RJZA 2F7CA 4P0IA 1HSEA 4TLLB 4WEDA 4I40A 4XKNA 5M2VA 4G68A 2XXVA 4ZEFA 3FBPA 3OSQA 2QFLA 4QXDA 1NUWA 5IGAA 5DEXA 2VD3A 3O6IA 3KN7A 1NV7A 2A5TB 1P1OA 2XXUA 4O3BA 1MY0A 4GXSB 3C35A 3TCHA 3ISPA 3PD9A 1N7WA 4G8NA 1LCTA 1N84A 3FV1A 3E78A 5H8NB 4JWXA 2DSFA 1MY4A 3V5AA 3QK6A 1S7YA 3R26A 2NVUB 4P56A 3TQLA 1VE4A 1NV0A 4DZ1A 2Z8FA 4MH5A 4LQ2A 3S4UA 4QSCA 2HXRA 2F97A 4BDMA 4NG7A 4NF5B 4QFOA 3CFXA 4RY1A 4MX6A 4DXUA 3KJTA 5I2NB 4YU0A 1NNFA 3USDA 3UA8A 1FPJA 3HSTA 3MZBA 3SEUA 4LVQA 3LC8A 2RCBA 2H98A 3KOSA 3RGYA 4C1TA 4GL0A 2B3FA 1EYKA 3IB1A 5H8FA 3RPLB 3A29A 1GGGA 2VT5A 3RY3A 2HAUA 4GF8A 1SI1A 4BDQA 2Z8EA 4N81A 4X04A 2B3BA 4QFNA 1EH3A 1I69A 1IEJA 2ZYOA 2X7QA 4MNIA 2XWKA 5CRYA 2I0CA 1FPKA 3E9XA 3EN3A 1A7LA 2OPDA 4IO4A 2NXOA 2I58A 1WODA 5T3JA 1H76A 1N0TA 1BK4A 1Z7ME 4MFIA 5EHSA 1URDA 1OQHA 3G7WA 2YLNA 2FYIA 2F7AA 2GRVA 1INPA 1B7UA 3VLWA 1IXHA 5I2KA 4BDNA 3Q28A 2F3DA 4R9GA 2O7UA 4RK9A 2Z8DA 2THIA 2RC7A 3PUWE 4YMAA 1IMAA 4PBHA 3H7MA 1T0KA 1LBZA 2DWIA 2V4CA 4NN3A 3VLVA 4ZDMA 2V84A 4LZ5A 3MVWA 3H6VA 3O29A 3U92A 2QS1A 4ELRA 4G8MA 2OLBA 3HO7A 3ONMA 1SPIA 1FBHA 2Y5KA 4GX4A 5H8QA 3TTKA 4EXLA 2IEEA 2Y5LA 3KC1A 2PT1A 1EYJA 1OMPA 5I59B 1XT8A 2OWSA 4MNCA 1FPFA 3T9HB 2QMWA 4H5FA 3VLUA 1MDP1 4O3AA 1LAGE 2HHMA 5B70A 1M5EA 4POXA 4PFBA 4KCCA 2F35A 4NGUA 1FQEA 3PD8A 4F18A 3MW0A 2E0SA 1Q1KA 4F1VA 3EPEA 1AL3A 1LAXA 4NF0A 4O8MA 4MJOA 1B1HA 1M5CA 3BIHA 1Y4CA 1MPBA 1NV1A 5FTHA 1DPEA 2ZNTA 3GBBA 3ZKKA 1FJ6A 1MH3A 1XS5A 2WKYA 1N3WA 1FTKA 2H25A 2OWZA 5TPAB 2HFBA 5CMBA 1SW1A 4F19A 2F36A 2HXWA 3K1NA 3FVKA 1FPDA 2Z23A 4PBQA 4BDOA 4MNPA 3IX1A 4P3LA 4ZE9A 4I9DA 4DDDA 2QRYA 1EYIA 2I48A 3B7DA 2CZLA 4R75A 3R6UA 4JWYA 3ROJA 1Y3NA 2O1MA 3G3JA 2PCRA 1DTGA 1WDNA 4I3YA 2UVHA 4AS5A 1FPBA 1NUZA 4MAGA 5I3SA 4GWUA 1ZU0A 4AB5A 2NUVA 3B8BA 1S50A 3IO6A 2PX1A 3LR1A 3DP8A 1M5FA 3FVNA 1LFHA 1UTHB 3JZJA 4NTLA 4GXAA 2V93A 4ISUA 2ONKE 2DXRA 4OFJA 4OENA 1B32A 5IZ3B 4IGRA 4K3FA 5BUUA 3FXRA 1I6QA 3ZKLA 2ONSA 5K2YA 3S9EA 1IXGA 5DW8A 4R6YA 4G68C 3AXFA 1H3DA 2Y7RA 4GX3A 5ET5A 4PFRA 1NV5A 3U65A 5ICQA 1CNQA 4PP0A 4U22A 2AIXA 1RYXA 3IFCA 2DYXA 1YTVA 3FZVA 3FVOA 1A54A 2UXAA 5DEXB 2PT2A 1QJMA 4QSDA 1B0HA 4ESXA 3KGCA 1FTMA 5ICTA 2PBWA 1FTJA 3G3KA 1YZ0A 3T93B 1FTOA 3O28A 2PFYA 5AA2A 4U4XA 4N8GA 1XHYA 3H6TA 1JNFA 1ZLQA 1NNKA 1B3HA 1FPIA 1YXIA 5FHNA 2UVGA 3MPKA 5CBRA 1LBVA 5A5XA 2HZKA 1B3FA 4TLMB 1D3KA 1DCUA 1FCKA 3PUVE 4U23A 4PFYA 4DIGA 1WVJA 1B0LA 1OLCA 3CSBA 1DMBA 2XXYA 3IOUA 2O84X 3K02A 1N04A 3KN3A 4HCYA 4EDPA 1IXIA 2A5SA 4OHNA 2YJPA 4F3BA 2ALUA 2DE2A 2AYSA 3DP4A 5H8FB 1B58A 1FBGA 1UQWA 1ZMGA 3O97A 3V89B 5ISUA 1DPPA 2DE3A 1D9VA 3VXBA 4QRZA 1B5IA 1RKMA 4JVCA 1B7HA 4IB2A 2L5VA 3N94A 1DK4A 5CMCA 4OQOA 1URSA 4OVRA 4LATA 3LBSA 3MZ9A 2F5XA 1PEBA 4QFPA 1O7TA 1K9YA 4BDLA 5AA4A 2GQ1A 3B50A 4PE5B 3N6TA 3TCGA 4H46A 4NF8A 1MQDA 1CB6A 5H8SA 4GWOA 2XX9A 4DCYA 2D3IA 2AL5A 4R9FA 5L8DA 1FTLA 3TAJA 4AQ4A 4HE2A 3KBRA 4UABA 3O66A 4G2ZA 2ZYNA 4X48A 4F1YA 2CEYA 1NH7A 5ITOA 5CC2A 1B46A 4MF3A 1BLFA 3S9LC 1XI6A 3LUZA 3LUYA 5IAIA 2MKZA 3ILUB 5KDTA 1B7ZA 2QMXA 2WYKA 1M5DA 5IKBA 2UYEA 4L17A 3PUZE 5I58A 2I3VA 4QFLA 1UTBA 4IY5A 2XXRA 5LOMA 4O3CA 5L9SA 3FD3A 3H03A 4O7MA 1FBCA 2PFZA 3GBAA 4P11A 3KN8A 4N4UA 5DVJA 1IMDA 1XVYA 4EXKA 1EZ9A 4QHQA 3V8XB 5TP9B 3G3IA 1B1XA 4F3GA 4PC9A 1FBPA 2F34A 4KPTA 5JK4A 4GBWA 1USYH 4R74A 4WKMA 4BLAA 1NV6A 4H67A 3PPOA 2XA5A 4GVOA 3S9MC 4N15A 3QMFA 1EZOA 4OANA 3PGFA 5IZZA 2QPQA 1VDWA 4ESWA 4NF6B 2Q8MA 4TQUQ 2W7YA 4HE0A 4N8YA 1JW1A 3BFTA 4JVIA 4OFOA 3FJ7A 4KCDA 3T0JA 4OFLA 3IB2A 1NI9A 4KYDA 3K6VA 2O51A 3TFLA 3K01A 1O64A 5I56A 1MPDA 4P0GA 2YPNA 2XXKA 1OIBA 2FIXA 1ELJA 2QJEA 2VGQA 2F3BA 4PFTA 5H8HB 5EQ8A 1BP5A 4JSDA 4GWZA 4DXBA 4FORA 2PYYA 4OVSA 3KSJA 2WBDA 3T9XB 2HEUA 1P1QA 2KR0A 3NOHA 1B05A 1PBQA 3GXAA 3MJNA 3KJ7A 3KG2A 3LSXA 3HN0A 1IMCA 2Q88A 4YKIA 3OO9A 1FSAA 3FXBA 3FXUA 1SYHA 4JB7A 3B6TA 4I8CA 3N6UA 1Y1MA 4ZZEA 4H8IA 4GWSA 1XOCA 3SEWA 3WAEA 1H44A 1FBEA 1SYIA 5ET8A 4GL8A 4NE4A 5CI5A 3MVXA 3B6QA 3QUFA 4GWXA 2Y7WA 1MQIA 4N6KA 1LBYA 2OJTA 4OYVA 4AB6A 4OVTA 1RDZA 4F3PA 1YPNA 5HM4B 4NF4A 4RPOA 3HCQA 4I1DA 4GQOA 2Q89A 4YB6A 1B3GA 1DSNA 1GVCA 1A40A 4G4PA 3IOTA 1K9ZA 4OVJA 4PAFA 3Q26A 2XXPA 2CZIA 4XTCQ 1Y20A 1QVSA 3O2AA 3RT6B 2E1SA 4G8HA 3TTNA 1SW2A 4PDHA 4U4SA 3W9WA 2DOJA 2Q9TA 1JW4A 1SD3A 1LBXA 4H45A 3HFUA 2V3QA 1R9QA 4LQ5A 3MAMA 4GD5A 4LUBA 2O6AA 4I62A 1DBZA 4MBPA 1G0HA 4Q8RA 4N17A 4R73A 3LSWA 3TKDA 3SERA 3FXQA 2M8CA 4JDFA 1B3LA 4PFUA 4GWYA 4F22A 4G77A 3GZGA 4ND9A 4OA4A 3JV9A 4N07A 2GHBA 2FHYA 1QULA 3E3KA 3CG1A 4POWA 4PQJA 3IJOB 5DVFA 3HV1A 3EHSA 3C4MA 5EYFA 3I6VA 2QS3A 1B5HA 3UGWA 5J1DA 1NKXA 1D9YA 1MQHA 4KHZE 2A5TA 3FASA 3TTMA 3A09A 1MRPA 5FTIA 2XWOA 3U93A 4X8RA 5FBPA 3CSGA 1LEVA 4GX6A 4QSEA 1A99A 1J1NA 4PAIA 1Y9UA 2HZLA 4IY6A 5H8NA 2XXHA 3VVDA 4F1UA 1JW5A 5FHOA 4Q30B 1B6HA 1Z7NE 2OPEA 2REGA 4YKKA 4F2OA 3TMGA 3TELA 5FHMA 1KA0A 2HAVA 5F7VA 3EHUA 2B65A 4IR8A 2IA4A 3O6GA 1LFIA 4QFKA 3QAXA 4O7IA 1Y3QA 3VXCA 4N91A 4RNSA 3CFLA 5EQ7A 2OZZA 4XKPA 3FGSA 3R7XA 2FNCA 3KC0A 1MQGA 1LBCA 5CMKA 1ZTYA 1QW0A 3FJMA 3MZ1A 2Y84A 1KZ8A 3MWBA 1LBWA 3PPQA 1MY3A 4ZEBA 3DP6A 1TWYA 3U1OA 4YB7A 3H6UA 5B7DA 3RPLA 4ZZAA 4DI3D 3TTLA 2R71A 2OX3A 1S9TA 1SW4A 2RF1A 2XD3A 3ILTB 2DVZA 3UP9A 2FIEA 5KDTB 1PDAA 1HSLA 2O7IA 3IB0A 4FEDA 5KCJB 1PB8A 2DXYA 2XXWA 3KEIA 2QVUA 3OENA 1UTBB 3QYTA 5DTBA 2G29A 2P2AA 4P47A 5CMMA 2O68A 4H65A 1LCFA 4FJPA 1JETA 3M3LA 4GBVA 3VVFA 4R6HA 3C9HA 2Q8JA 1XC1A 4G68B 1JQFA 5JTYA 3WAFA 3K1PA 3T9UA 3IAZA 2ZNUA 4IO6A 4GRKA 5L9OA 5ET6A 5EYGA 4ELOA 3FVGA 4WXJA 3N5LA 1N76A 4QBAA 3U8QA 3SETA 1FPLA 3VFJA 1IZ1A 2BJJX 2I4BA 1LB8A
chains in the Genus database with same CATH topology
4P1EA 2WYKA 4X04A 1AWBA 2WX9A 5EQ9A 4MNIA 2XWKA 4YZZA 4MMPA 1FPKA 5I7IA 4O7MA 1FBDA 5T3JA 4HE1A 1FBCA 2PFZA 4N4UA 4PF8A 1IMDA 1BK4A 5A5LA 4PC9A 1FBPA 5JK4A 4GBWA 1INPA 3IFAA 4PGPA 1FBFA 1NV6A 2VPNA 2XA5A 4N15A 3PTYA 3QMFA 4MCOA 4PDDA 2HPGA 2F3DA 4OANA 5EQAA 5IZZA 2QPQA 1VDWA 1IMAA 4PBHA 2Q8MA 1LBZA 4HE0A 2V4CA 4NN3A 4N8YA 3CHGA 5CM6A 4O94A 4JVIA 5I5PA 3T0JA 4HCWA 2CZKA 1NI9A 4OVPA 5LTCA 2WYPA 1NV4A 1SPIA 1FBHA 2XXKA 2Y5KA 4GX4A 5EYHA 2FIXA 4OVQA 2F3BA 5ESYA 1G0IA 5EQ8A 4PTKA 2Y5LA 4GWZA 3KC1A 1EYJA 4OVSA 1NV2A 5IM2A 4I3EA 4MNCA 1IMFA 2WBDA 1FPFA 4MEVA 2KR0A 3NOHA 2ZZXA 1D9QA 3LV0A 2WBBA 1IMCA 2XWVA 2HHMA 1FRPA 1FSAA 3FXBA 4PFBA 4PF6A 2KQZA 2BJIA 4NGUA 3BIGA 2B4LA 4GWSA 4F18A 1FBEA 4PGNA 5ET8A 4F1VA 4NF0A 4O8MA 4P9KA 4MJOA 3BIHA 4GWXA 1NV1A 2Q74A 4N6KA 2QVRA 2XWIA 1LBYA 1QGXA 4X9TA 4PAKA 1FJ6A 1IMEA 5IZ3A 1FPEA 4OVTA 1RDZA 4PE3A 2OWZA 2P3VA 4NAPA 4F19A 1NUYA 2VPOA 1FPDA 4PBQA 3W9VA 4MNPA 3EKIA 4P3LA 4XF5A 1NV3A 4AS4A 4PCDA 1EYIA 4P8BA 1K9ZA 4PAFA 3ROJA 1RDXA 2CZIA 4GWWA 2PCRA 4I3YA 4PETA 4PDHA 4AS5A 1FPBA 1NUZA 3W9WA 4MAGA 3D1RA 3RYDA 5I3SA 2DDKA 2Q9TA 4GWUA 5LDZA 2QVVA 1LBXA 2ZZWA 1KA1A 4H45A 3B8BA 2FVZA 3HFUA 2V3QA 4FBPA 4PFIA 1DBZA 4G61A 1G0HA 4N17A 4NHBA 3KBZA 5IZ3B 2ZZVA 4GWYA 2R8TA 4OA4A 4NX1A 4DI4B 2FBPA 2FHYA 5DW8A 4GX3A 5ET5A 1YYZA 4PFRA 1NV5A 3U65A 1CNQA 5J1DA 3IFCA 3MSTA 4M1VA 3MYUA 2XWOA 1RDYA 4X8RA 5FBPA 1LEVA 4GX6A 3T1BA 5ET7A 4PAIA 3SZPA 2HZLA 5J16A 5IZ1A 4F1UA 1JP4A 4LN5A 4N6DA 4P1LA 3GYYA 1YZ0A 2B4MA 2P3NA 2PFYA 1IMBA 4N8GA 3E79A 1KA0A 4MHFA 4IR8A 1FPIA 4O7IA 1YXIA 4N91A 1LBVA 2DE4A 4I40A 5EQ7A 2HZKA 3FBPA 1FJ9A 2QFLA 3KC0A 1DCUA 4QXDA 2WEFA 1NUWA 5F24A 1KZ8A 5IGAA 4HCYA 1FTAA 2CZHA 1NV7A 1LBWA 1FPGA 4JVDA 3RPLA 3ISPA 2CEXA 2DE2A 1FBGA 4DI3D 2OX3A 2DVZA 2DE3A 3E78A 2FIEA 4JVCA 4NQ8A 2L5VA 4P56A 1DK4A 1NV0A 4KXPA 4XEQA 2QVUA 4OVRA 2HXRA 2F5XA 4NG7A 1K9YA 1Q9DA 2GQ1A 4MX6A 4P47A 3B50A 4H46A 4GBVA 4XFEA 1FPJA 4HXVA 1NUXA 4HE2A 5ET6A 4YICA 4UABA 5EYGA 2CEYA 4MIJA 1EYKA 2JJKA 3RPLB 4QBAA 3A29A 2VT5A 1FPLA 1XI6A 3LUZA 2MKZA 4N81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3B A;  3B8B A;  5ESY A;  2FVZ A;  3FBP A;  1G0I A;  1AWB A;  5EQ8 A;  4PTK A;  1FJ9 A;  2QFL A;  2Y5L A;  3KC0 A;  4FBP A;  4GWZ A;  3KC1 A;  1DCU A;  5EQ9 A;  1EYJ A;  4QXD A;  2WEF A;  1NV2 A;  1DBZ A;  4G61 A;  4I3E A;  1FPK A;  1IMF A;  1NUW A;  2WBD A;  1FPF A;  1KZ8 A;  1G0H A;  5F24 A;  1FTA A;  2CZH A;  1NV7 A;  1LBW A;  1FBD A;  1D9Q A;  5T3J A;  1FPG A;  4HE1 A;  3KBZ A;  3LV0 A;  1FBC A;  2WBB A;  4N81 A;  5IZ3 B;  4GWY A;  3RPL A;  1IMC A;  2R8T A;  1IMD A;  1BK4 A;  1FBG A;  2HHM A;  1FRP A;  2OX3 A;  2FBP A;  5A5L A;  2FHY A;  1FSA A;  5DW8 A;  2FIE A;  1FBP A;  4GX3 A;  5ET5 A;  2BJI A;  4GBW A;  1INP A;  3IFA A;  1YYZ A;  3BIG A;  4GWS A;  1FBF A;  1NV6 A;  1NV5 A;  1FBE A;  1DK4 A;  1CNQ A;  1NV0 A;  4KXP A;  5ET8 A;  2QVU A;  3IFC A;  3QMF A;  4MJO A;  3BIH A;  2F3D A;  4GWX A;  1NV1 A;  2Q74 A;  2QVR A;  1LBY A;  1QGX A;  1K9Y A;  5EQA A;  1RDY A;  1Q9D A;  1FJ6 A;  2GQ1 A;  1IME A;  1VDW A;  1IMA A;  5IZ3 A;  5FBP A;  1FPE A;  1RDZ A;  4H46 A;  1LEV A;  2Q8M A;  4GX6 A;  4GBV A;  2OWZ A;  1LBZ A;  2P3V A;  4HE0 A;  5ET7 A;  1NUY A;  5IZ1 A;  5J16 A;  1FPD A;  1FPJ A;  1JP4 A;  4HXV A;  1NUX A;  1NV3 A;  3RYD A;  4AS4 A;  1EYI A;  1YZ0 A;  2P3N A;  1K9Z A;  3T0J A;  4HE2 A;  5ET6 A;  3ROJ A;  1RDX A;  2CZI A;  2CZK A;  1IMB A;  1NI9 A;  4GWW A;  2PCR A;  5EYG A;  1KA0 A;  4I3Y A;  4IR8 A;  1EYK A;  1NV4 A;  4AS5 A;  1FPB A;  1SPI A;  1NUZ A;  2JJK A;  1FPI A;  4O7I A;  3RPL B;  1YXI A;  3A29 A;  1FBH A;  2VT5 A;  1FPL A;  1XI6 A;  3D1R A;  2DDK A;  2Y5K A;  3LUZ A;  4GX4 A;  4GWU A;  5EYH A;  5I3S A;  5LDZ A;  2FIX A;  1LBV A;  2QVV A;  1LBX A;  4I40 A;  5EQ7 A;  1KA1 A;  4H45 A; 
#chains in the Genus database with same CATH topology
 4ZS9 A;  3OOA A;  3TDJ A;  1AWB A;  3MVY A;  5EQ9 A;  3PUY E;  1I6A A;  4YZZ A;  3TYH A;  1FQA A;  3N26 A;  2DWA A;  1PBP A;  3M3K A;  3FUZ A;  1O63 A;  1LGB C;  5I56 B;  1NL5 A;  1QUI A;  4KYE A;  5A5L A;  2I6E A;  1B9J A;  3SKP A;  2Z22 A;  1R9L A;  4PGP A;  4NWD A;  3RT8 A;  3KZG A;  3QXM A;  5ITP A;  5I59 A;  4EF1 A;  2OBG A;  1FQF A;  3RUM A;  2HPG A;  1H43 A;  3K6X A;  3CFZ A;  1B40 A;  1P1W A;  4RXL A;  3K00 A;  1VR5 A;  4IO2 A;  4OZ9 A;  2DP8 A;  3HPI A;  2XHD A;  3RTF B;  2F6P A;  1B4H A;  3JYR A;  2G93 A;  3BFU A;  1MPC A;  1QKB A;  4THI A;  4ELQ A;  1N7X A;  3RNN A;  1LBB A;  1IQ7 A;  3K6U A;  3ECR A;  5JEI A;  4OVP A;  1Q35 A;  4XKR A;  2REJ A;  5LTC A;  2R6G E;  2I0B A;  1ATG A;  2WYP A;  1NV4 A;  4DCX A;  3SES A;  4OER A;  4ZED A;  4H6D A;  1MXZ A;  2H4I A;  4H8J A;  4EQ9 A;  1Y3P A;  3H06 B;  3SEX A;  2QL3 A;  4ZEI A;  2I4C A;  3KOT A;  4XIG Q;  2AL4 A;  1L5T A;  3PUX E;  1NV2 A;  3FIR A;  5IM2 A;  4I3E A;  5I2K B;  1GV8 A;  3PU5 A;  4R6K A;  4MEV A;  4H1X A;  3TTR A;  3OEM A;  3OXN A;  3LV0 A;  3E4R A;  2XXX A;  3MBP A;  4U1O A;  4HTG A;  2QSX A;  1PC3 A;  4DXC A;  2XWV A;  1FRP A;  1ZJL A;  4X1D A;  1IXC A;  4XXU A;  2UVJ A;  3BIG A;  2B4L A;  1UTH A;  3MP6 A;  4DLD A;  3OD7 A;  2O69 A;  4PGN A;  4KQP A;  4P9K A;  4U2R A;  3SEY A;  4IO3 A;  3FJG A;  3CRB A;  2XWI A;  1NFT A;  4ZEC A;  3M3F A;  2FA7 A;  2I49 A;  2V3U A;  1IME A;  3RLF E;  5IZ3 A;  5H8Q B;  3C31 A;  4FIM A;  4PE3 A;  5F1Q A;  2P3V A;  2F7B A;  2XXI A;  3IOW A;  1JEV A;  4FEB A;  3W9V A;  3EKI A;  4XF5 A;  3UOR A;  2ZXT A;  2RKM A;  4P8B A;  2X26 A;  3THI A;  2ZYK A;  4F29 A;  5AA2 D;  3T9V A;  2D21 A;  4YKP A;  1MXU A;  3TQW A;  2DQV A;  3IL1 B;  3D1R A;  3RYD A;  2DDK A;  1YCJ A;  5LDZ A;  4RA1 A;  2QVV A;  1LB9 A;  1LFG A;  3IOV A;  2F6G A;  2FVZ A;  4FBP A;  1DOT A;  4LZ7 A;  1A8E A;  2QS2 A;  1Y4T A;  2O1L A;  1USY E;  3U94 A;  3KBZ A;  1MY2 A;  1NMU A;  4OXV A;  4NX1 A;  4ONY A;  3Q25 A;  1MM7 A;  1MXV A;  1SW5 A;  4H5G A;  2UYF A;  1VFE A;  1R6Z A;  2ZMB A;  3KFM A;  4EF2 A;  3BKI B;  1JVX A;  1FW0 A;  1ZIU A;  4IO5 A;  4KR5 A;  3V83 A;  3D4G A;  4JWO A;  3OEL A;  4C0R A;  3IOR A;  4RPN A;  1B5J A;  1MY1 A;  2H99 A;  5AA3 A;  4M1V A;  3MYU A;  4UAC A;  1OLA A;  1RDY A;  5ELV A;  1M5B A;  1SVX B;  4LA9 A;  3KSX A;  3FAT A;  3LSF B;  4DE8 A;  3T1B A;  3SZP A;  5J16 A;  4F2Q A;  1HSJ A;  1KWH A;  1JP4 A;  1JVY A;  3GYY A;  4KFQ A;  3TPA A;  2B4M A;  1YAE A;  3K1M A;  4Q0C A;  4HS7 A;  1MH4 A;  4OET A;  1N3X A;  4PFW A;  4MHF A;  3VE1 B;  1B2H A;  3DEL B;  2GFE A;  4ELP A;  2R9J A;  1TXF A;  2DE4 A;  1AMF A;  4JBZ A;  3VVE A;  4E0X A;  4OEV A;  1FJ9 A;  5JTY B;  1BTJ A;  5I57 A;  2WEF A;  1VSO A;  1PB9 A;  3EQ1 A;  3H3G A;  3IJX B;  5F24 A;  3I3V A;  3SDF A;  3UIF A;  1FTA A;  2CZH A;  2XX7 A;  3M8U A;  2Q2C A;  1AIV A;  1FPG A;  3T22 A;  4JVD A;  3T96 B;  3U72 A;  3OO8 A;  2NWJ A;  2CEX A;  2ESN A;  1I6B A;  3OEK A;  2OCU A;  3SEV A;  3A3U A;  1MXX A;  4NQ8 A;  1MM6 A;  3MQ9 A;  5TU0 A;  4KXP A;  4MLQ A;  2F78 A;  4XEQ A;  5AA2 B;  2ANJ A;  4JXI A;  2X7P A;  3D4C A;  4MLV A;  1ANF A;  4RYA A;  3PMX A;  4HW8 A;  1Q9D A;  1FQD A;  2DWJ A;  1EZP A;  3K4U A;  1LAF E;  5A5X B;  5TP9 A;  5DT6 A;  4IO7 A;  3S9N C;  4XFE A;  3MPL A;  4HXV A;  1NUX A;  1A55 A;  3VDF A;  3MVZ A;  3C33 A;  3CR9 A;  3IK6 B;  3O9P A;  4C1U A;  2VHA A;  4GIZ A;  4YIC A;  2DVC A;  3G3G A;  2DS9 A;  1TT1 A;  1LAH E;  4MIJ A;  4QF9 A;  4YAH X;  3L6G A;  3QSL A;  4FE8 A;  2Y7P A;  2JJK A;  3UN6 A;  1GTK A;  1POY 1;  4OTE A;  4OMB A;  3B6W A;  4NF6 A;  1TFD A;  4M4G A;  3A3C A;  5K2X A;  3QIM A;  1ZKB A;  4P1E A;  4LON B;  1D4N A;  2WX9 A;  3DLN A;  3RQT A;  3UK4 A;  3GLB A;  4UA8 A;  2PVU A;  1OVT A;  4U21 A;  4MMP A;  3MP8 A;  3K0V A;  4NF5 A;  4WEP A;  3IO4 A;  5I7I A;  3TEP A;  1LLS A;  4XKQ A;  1FBD A;  4F31 B;  4HE1 A;  5AA4 B;  5I2N A;  1Y1Z A;  3OO6 A;  4PF8 A;  4NF8 B;  3Q27 A;  1F9B A;  2XX8 A;  4EQB A;  2CMO A;  1SI0 A;  1II5 A;  2ONR A;  1US4 A;  3QUJ A;  2ZYM A;  5L9M A;  5H8H A;  3IFA A;  2ABH A;  4GOT A;  1FBF A;  2VPN A;  3PTY A;  4MCO A;  4GFR A;  4PDD A;  3CIJ A;  3O6H A;  3TCF A;  5I84 A;  1XVX A;  3MP1 A;  1P99 A;  5EQA A;  1RYO A;  2VP1 A;  2VD2 A;  2RCA A;  3OO7 A;  4E0W A;  3PPR A;  3PMV A;  2RC9 A;  3CHG A;  4H0W A;  4O94 A;  4U1Z A;  5CM6 A;  1EU8 A;  3C34 A;  5I58 B;  4GLI A;  1AOV A;  5I5P A;  1SBP A;  3E13 X;  4FEC A;  2GH9 A;  4N6P A;  2H5Y A;  4HCW A;  1BIY A;  2CZK A;  2OWT A;  1IIT A;  4KYS A;  5AE4 A;  1NNT A;  1FQC A;  5EYH A;  3HHF A;  2XXT A;  4Q5T A;  2F8D A;  4OVQ A;  3L6H A;  5ESY A;  1G0I A;  1UIU A;  4PTK A;  1H45 A;  2OK2 A;  1QUJ A;  4BDR A;  1FQB A;  2Y7K A;  3H6W A;  5KZT A;  1IMF A;  2P1S A;  4NMY A;  2RC8 A;  4KI0 E;  2ZZX A;  2NOO A;  2P0S A;  1D9Q A;  3G3F A;  3K6W A;  3RPW A;  2WBB A;  3T66 A;  1PB7 A;  1IUD A;  4R2B A;  1B3E A;  4PF6 A;  2KQZ A;  2BJI A;  3PMW A;  3Q29 A;  1P1U A;  2XD2 A;  2RIN A;  1IIW A;  4F3S A;  3LSL A;  4YMB A;  5EHM A;  2Q74 A;  2QVR A;  4TOZ A;  1QGX A;  1US5 A;  4PAK A;  4X9T A;  3FV2 A;  3HHG A;  1DTZ A;  1FPE A;  4RK2 A;  3DM0 A;  4N13 A;  1NNP A;  2GHA A;  3CVG A;  4NAP A;  1NUY A;  1R1N A;  2QS4 A;  3TZA A;  2VPO A;  4FAT A;  5AA1 A;  3TOD A;  1NV3 A;  4AS4 A;  4PCD A;  1JEU A;  4ZE8 A;  1ZBM A;  3PPP A;  3CG3 A;  5HBC A;  3CI8 A;  1RDX A;  4GWW A;  1TFA A;  3F11 A;  4OEU A;  4PET A;  1MXY A;  2H9B A;  4OWD A;  2Y7I A;  1OQG A;  5CBS A;  1OVB A;  3P7I A;  3H4Z A;  2ZZW A;  4R2F A;  1KA1 A;  4Z7E A;  3RTW B;  2Q2A A;  2VOZ A;  1B51 A;  4IGT A;  1NH8 A;  4PFI A;  5DYH A;  1SQY A;  4G61 A;  1B4Z A;  1MG1 A;  3ODB A;  1MDQ A;  3ZS6 A;  1QUK A;  1MS7 A;  2HQ0 A;  4YB5 A;  3MC2 A;  4NHB A;  3TUS A;  3K2D A;  2ZZV A;  4Z0I A;  2KLF A;  5TPA A;  2R8T A;  3IR1 A;  2DWH A;  4DI4 B;  1AH5 A;  2FBP A;  4NF4 B;  5BWJ A;  3EHT A;  4NED A;  2V3T A;  3G3H A;  1VFD A;  1MXW A;  2XXQ A;  1POT A;  1GR2 A;  4ZEK A;  3EF7 A;  3MUQ A;  1MQJ A;  1YYZ A;  4LP2 B;  4YKJ A;  4ECF A;  3OMB A;  4OES A;  2HCA A;  1UIV A;  5I57 B;  5DVI A;  2ZNS A;  4KD5 A;  3MST A;  1URG A;  3PPN A;  2LAO A;  2I3W A;  1QKA A;  3RN8 A;  3PV0 E;  3ZSF A;  1CE2 A;  3I5O A;  1BKA A;  4FAJ A;  3S2V A;  3BBR A;  4F39 A;  3C36 A;  5ET7 A;  4EUO A;  5IZ1 A;  1A8F A;  4LN5 A;  4N6D A;  4EQ7 A;  5KCJ A;  4P1L A;  1B52 A;  2P3N A;  1LST A;  1SDX A;  3C32 A;  5HPQ A;  1IMB A;  4JSO A;  3W15 C;  1P1N A;  4X1B A;  3E79 A;  4R72 A;  4LZ8 A;  3OSR A;  2PMS A;  3VV5 A;  2UVI A;  4NWC A;  2V25 A;  2D5W A;  4RJZ A;  2F7C A;  4P0I A;  1HSE A;  4TLL B;  4WED A;  4I40 A;  4XKN A;  5M2V A;  4G68 A;  2XXV A;  4ZEF A;  3FBP A;  3OSQ A;  2QFL A;  4QXD A;  1NUW A;  5IGA A;  5DEX A;  2VD3 A;  3O6I A;  3KN7 A;  1NV7 A;  2A5T B;  1P1O A;  2XXU A;  4O3B A;  1MY0 A;  4GXS B;  3C35 A;  3TCH A;  3ISP A;  3PD9 A;  1N7W A;  4G8N A;  1LCT A;  1N84 A;  3FV1 A;  3E78 A;  5H8N B;  4JWX A;  2DSF A;  1MY4 A;  3V5A A;  3QK6 A;  1S7Y A;  3R26 A;  2NVU B;  4P56 A;  3TQL A;  1VE4 A;  1NV0 A;  4DZ1 A;  2Z8F A;  4MH5 A;  4LQ2 A;  3S4U A;  4QSC A;  2HXR A;  2F97 A;  4BDM A;  4NG7 A;  4NF5 B;  4QFO A;  3CFX A;  4RY1 A;  4MX6 A;  4DXU A;  3KJT A;  5I2N B;  4YU0 A;  1NNF A;  3USD A;  3UA8 A;  1FPJ A;  3HST A;  3MZB A;  3SEU A;  4LVQ A;  3LC8 A;  2RCB A;  2H98 A;  3KOS A;  3RGY A;  4C1T A;  4GL0 A;  2B3F A;  1EYK A;  3IB1 A;  5H8F A;  3RPL B;  3A29 A;  1GGG A;  2VT5 A;  3RY3 A;  2HAU A;  4GF8 A;  1SI1 A;  4BDQ A;  2Z8E A;  4N81 A;  4X04 A;  2B3B A;  4QFN A;  1EH3 A;  1I69 A;  1IEJ A;  2ZYO A;  2X7Q A;  4MNI A;  2XWK A;  5CRY A;  2I0C A;  1FPK A;  3E9X A;  3EN3 A;  1A7L A;  2OPD A;  4IO4 A;  2NXO A;  2I58 A;  1WOD A;  5T3J A;  1H76 A;  1N0T A;  1BK4 A;  1Z7M E;  4MFI A;  5EHS A;  1URD A;  1OQH A;  3G7W A;  2YLN A;  2FYI A;  2F7A A;  2GRV A;  1INP A;  1B7U A;  3VLW A;  1IXH A;  5I2K A;  4BDN A;  3Q28 A;  2F3D A;  4R9G A;  2O7U A;  4RK9 A;  2Z8D A;  2THI A;  2RC7 A;  3PUW E;  4YMA A;  1IMA A;  4PBH A;  3H7M A;  1T0K A;  1LBZ A;  2DWI A;  2V4C A;  4NN3 A;  3VLV A;  4ZDM A;  2V84 A;  4LZ5 A;  3MVW A;  3H6V A;  3O29 A;  3U92 A;  2QS1 A;  4ELR A;  4G8M A;  2OLB A;  3HO7 A;  3ONM A;  1SPI A;  1FBH A;  2Y5K A;  4GX4 A;  5H8Q A;  3TTK A;  4EXL A;  2IEE A;  2Y5L A;  3KC1 A;  2PT1 A;  1EYJ A;  1OMP A;  5I59 B;  1XT8 A;  2OWS A;  4MNC A;  1FPF A;  3T9H B;  2QMW A;  4H5F A;  3VLU A;  1MDP 1;  4O3A A;  1LAG E;  2HHM A;  5B70 A;  1M5E A;  4POX A;  4PFB A;  4KCC A;  2F35 A;  4NGU A;  1FQE A;  3PD8 A;  4F18 A;  3MW0 A;  2E0S A;  1Q1K A;  4F1V A;  3EPE A;  1AL3 A;  1LAX A;  4NF0 A;  4O8M A;  4MJO A;  1B1H A;  1M5C A;  3BIH A;  1Y4C A;  1MPB A;  1NV1 A;  5FTH A;  1DPE A;  2ZNT A;  3GBB A;  3ZKK A;  1FJ6 A;  1MH3 A;  1XS5 A;  2WKY A;  1N3W A;  1FTK A;  2H25 A;  2OWZ A;  5TPA B;  2HFB A;  5CMB A;  1SW1 A;  4F19 A;  2F36 A;  2HXW A;  3K1N A;  3FVK A;  1FPD A;  2Z23 A;  4PBQ A;  4BDO A;  4MNP A;  3IX1 A;  4P3L A;  4ZE9 A;  4I9D A;  4DDD A;  2QRY A;  1EYI A;  2I48 A;  3B7D A;  2CZL A;  4R75 A;  3R6U A;  4JWY A;  3ROJ A;  1Y3N A;  2O1M A;  3G3J A;  2PCR A;  1DTG A;  1WDN A;  4I3Y A;  2UVH A;  4AS5 A;  1FPB A;  1NUZ A;  4MAG A;  5I3S A;  4GWU A;  1ZU0 A;  4AB5 A;  2NUV A;  3B8B A;  1S50 A;  3IO6 A;  2PX1 A;  3LR1 A;  3DP8 A;  1M5F A;  3FVN A;  1LFH A;  1UTH B;  3JZJ A;  4NTL A;  4GXA A;  2V93 A;  4ISU A;  2ONK E;  2DXR A;  4OFJ A;  4OEN A;  1B32 A;  5IZ3 B;  4IGR A;  4K3F A;  5BUU A;  3FXR A;  1I6Q A;  3ZKL A;  2ONS A;  5K2Y A;  3S9E A;  1IXG A;  5DW8 A;  4R6Y A;  4G68 C;  3AXF A;  1H3D A;  2Y7R A;  4GX3 A;  5ET5 A;  4PFR A;  1NV5 A;  3U65 A;  5ICQ A;  1CNQ A;  4PP0 A;  4U22 A;  2AIX A;  1RYX A;  3IFC A;  2DYX A;  1YTV A;  3FZV A;  3FVO A;  1A54 A;  2UXA A;  5DEX B;  2PT2 A;  1QJM A;  4QSD A;  1B0H A;  4ESX A;  3KGC A;  1FTM A;  5ICT A;  2PBW A;  1FTJ A;  3G3K A;  1YZ0 A;  3T93 B;  1FTO A;  3O28 A;  2PFY A;  5AA2 A;  4U4X A;  4N8G A;  1XHY A;  3H6T A;  1JNF A;  1ZLQ A;  1NNK A;  1B3H A;  1FPI A;  1YXI A;  5FHN A;  2UVG A;  3MPK A;  5CBR A;  1LBV A;  5A5X A;  2HZK A;  1B3F A;  4TLM B;  1D3K A;  1DCU A;  1FCK A;  3PUV E;  4U23 A;  4PFY A;  4DIG A;  1WVJ A;  1B0L A;  1OLC A;  3CSB A;  1DMB A;  2XXY A;  3IOU A;  2O84 X;  3K02 A;  1N04 A;  3KN3 A;  4HCY A;  4EDP A;  1IXI A;  2A5S A;  4OHN A;  2YJP A;  4F3B A;  2ALU A;  2DE2 A;  2AYS A;  3DP4 A;  5H8F B;  1B58 A;  1FBG A;  1UQW A;  1ZMG A;  3O97 A;  3V89 B;  5ISU A;  1DPP A;  2DE3 A;  1D9V A;  3VXB A;  4QRZ A;  1B5I A;  1RKM A;  4JVC A;  1B7H A;  4IB2 A;  2L5V A;  3N94 A;  1DK4 A;  5CMC A;  4OQO A;  1URS A;  4OVR A;  4LAT A;  3LBS A;  3MZ9 A;  2F5X A;  1PEB A;  4QFP A;  1O7T A;  1K9Y A;  4BDL A;  5AA4 A;  2GQ1 A;  3B50 A;  4PE5 B;  3N6T A;  3TCG A;  4H46 A;  4NF8 A;  1MQD A;  1CB6 A;  5H8S A;  4GWO A;  2XX9 A;  4DCY A;  2D3I A;  2AL5 A;  4R9F A;  5L8D A;  1FTL A;  3TAJ A;  4AQ4 A;  4HE2 A;  3KBR A;  4UAB A;  3O66 A;  4G2Z A;  2ZYN A;  4X48 A;  4F1Y A;  2CEY A;  1NH7 A;  5ITO A;  5CC2 A;  1B46 A;  4MF3 A;  1BLF A;  3S9L C;  1XI6 A;  3LUZ A;  3LUY A;  5IAI A;  2MKZ A;  3ILU B;  5KDT A;  1B7Z A;  2QMX A;  2WYK A;  1M5D A;  5IKB A;  2UYE A;  4L17 A;  3PUZ E;  5I58 A;  2I3V A;  4QFL A;  1UTB A;  4IY5 A;  2XXR A;  5LOM A;  4O3C A;  5L9S A;  3FD3 A;  3H03 A;  4O7M A;  1FBC A;  2PFZ A;  3GBA A;  4P11 A;  3KN8 A;  4N4U A;  5DVJ A;  1IMD A;  1XVY A;  4EXK A;  1EZ9 A;  4QHQ A;  3V8X B;  5TP9 B;  3G3I A;  1B1X A;  4F3G A;  4PC9 A;  1FBP A;  2F34 A;  4KPT A;  5JK4 A;  4GBW A;  1USY H;  4R74 A;  4WKM A;  4BLA A;  1NV6 A;  4H67 A;  3PPO A;  2XA5 A;  4GVO A;  3S9M C;  4N15 A;  3QMF A;  1EZO A;  4OAN A;  3PGF A;  5IZZ A;  2QPQ A;  1VDW A;  4ESW A;  4NF6 B;  2Q8M A;  4TQU Q;  2W7Y A;  4HE0 A;  4N8Y A;  1JW1 A;  3BFT A;  4JVI A;  4OFO A;  3FJ7 A;  4KCD A;  3T0J A;  4OFL A;  3IB2 A;  1NI9 A;  4KYD A;  3K6V A;  2O51 A;  3TFL A;  3K01 A;  1O64 A;  5I56 A;  1MPD A;  4P0G A;  2YPN A;  2XXK A;  1OIB A;  2FIX A;  1ELJ A;  2QJE A;  2VGQ A;  2F3B A;  4PFT A;  5H8H B;  5EQ8 A;  1BP5 A;  4JSD A;  4GWZ A;  4DXB A;  4FOR A;  2PYY A;  4OVS A;  3KSJ A;  2WBD A;  3T9X B;  2HEU A;  1P1Q A;  2KR0 A;  3NOH A;  1B05 A;  1PBQ A;  3GXA A;  3MJN A;  3KJ7 A;  3KG2 A;  3LSX A;  3HN0 A;  1IMC A;  2Q88 A;  4YKI A;  3OO9 A;  1FSA A;  3FXB A;  3FXU A;  1SYH A;  4JB7 A;  3B6T A;  4I8C A;  3N6U A;  1Y1M A;  4ZZE A;  4H8I A;  4GWS A;  1XOC A;  3SEW A;  3WAE A;  1H44 A;  1FBE A;  1SYI A;  5ET8 A;  4GL8 A;  4NE4 A;  5CI5 A;  3MVX A;  3B6Q A;  3QUF A;  4GWX A;  2Y7W A;  1MQI A;  4N6K A;  1LBY A;  2OJT A;  4OYV A;  4AB6 A;  4OVT A;  1RDZ A;  4F3P A;  1YPN A;  5HM4 B;  4NF4 A;  4RPO A;  3HCQ A;  4I1D A;  4GQO A;  2Q89 A;  4YB6 A;  1B3G A;  1DSN A;  1GVC A;  1A40 A;  4G4P A;  3IOT A;  1K9Z A;  4OVJ A;  4PAF A;  3Q26 A;  2XXP A;  2CZI A;  4XTC Q;  1Y20 A;  1QVS A;  3O2A A;  3RT6 B;  2E1S A;  4G8H A;  3TTN A;  1SW2 A;  4PDH A;  4U4S A;  3W9W A;  2DOJ A;  2Q9T A;  1JW4 A;  1SD3 A;  1LBX A;  4H45 A;  3HFU A;  2V3Q A;  1R9Q A;  4LQ5 A;  3MAM A;  4GD5 A;  4LUB A;  2O6A A;  4I62 A;  1DBZ A;  4MBP A;  1G0H A;  4Q8R A;  4N17 A;  4R73 A;  3LSW A;  3TKD A;  3SER A;  3FXQ A;  2M8C A;  4JDF A;  1B3L A;  4PFU A;  4GWY A;  4F22 A;  4G77 A;  3GZG A;  4ND9 A;  4OA4 A;  3JV9 A;  4N07 A;  2GHB A;  2FHY A;  1QUL A;  3E3K A;  3CG1 A;  4POW A;  4PQJ A;  3IJO B;  5DVF A;  3HV1 A;  3EHS A;  3C4M A;  5EYF A;  3I6V A;  2QS3 A;  1B5H A;  3UGW A;  5J1D A;  1NKX A;  1D9Y A;  1MQH A;  4KHZ E;  2A5T A;  3FAS A;  3TTM A;  3A09 A;  1MRP A;  5FTI A;  2XWO A;  3U93 A;  4X8R A;  5FBP A;  3CSG A;  1LEV A;  4GX6 A;  4QSE A;  1A99 A;  1J1N A;  4PAI A;  1Y9U A;  2HZL A;  4IY6 A;  5H8N A;  2XXH A;  3VVD A;  4F1U A;  1JW5 A;  5FHO A;  4Q30 B;  1B6H A;  1Z7N E;  2OPE A;  2REG A;  4YKK A;  4F2O A;  3TMG A;  3TEL A;  5FHM A;  1KA0 A;  2HAV A;  5F7V A;  3EHU A;  2B65 A;  4IR8 A;  2IA4 A;  3O6G A;  1LFI A;  4QFK A;  3QAX A;  4O7I A;  1Y3Q A;  3VXC A;  4N91 A;  4RNS A;  3CFL A;  5EQ7 A;  2OZZ A;  4XKP A;  3FGS A;  3R7X A;  2FNC A;  3KC0 A;  1MQG A;  1LBC A;  5CMK A;  1ZTY A;  1QW0 A;  3FJM A;  3MZ1 A;  2Y84 A;  1KZ8 A;  3MWB A;  1LBW A;  3PPQ A;  1MY3 A;  4ZEB A;  3DP6 A;  1TWY A;  3U1O A;  4YB7 A;  3H6U A;  5B7D A;  3RPL A;  4ZZA A;  4DI3 D;  3TTL A;  2R71 A;  2OX3 A;  1S9T A;  1SW4 A;  2RF1 A;  2XD3 A;  3ILT B;  2DVZ A;  3UP9 A;  2FIE A;  5KDT B;  1PDA A;  1HSL A;  2O7I A;  3IB0 A;  4FED A;  5KCJ B;  1PB8 A;  2DXY A;  2XXW A;  3KEI A;  2QVU A;  3OEN A;  1UTB B;  3QYT A;  5DTB A;  2G29 A;  2P2A A;  4P47 A;  5CMM A;  2O68 A;  4H65 A;  1LCF A;  4FJP A;  1JET A;  3M3L A;  4GBV A;  3VVF A;  4R6H A;  3C9H A;  2Q8J A;  1XC1 A;  4G68 B;  1JQF A;  5JTY A;  3WAF A;  3K1P A;  3T9U A;  3IAZ A;  2ZNU A;  4IO6 A;  4GRK A;  5L9O A;  5ET6 A;  5EYG A;  4ELO A;  3FVG A;  4WXJ A;  3N5L A;  1N76 A;  4QBA A;  3U8Q A;  3SET A;  1FPL A;  3VFJ A;  1IZ1 A;  2BJJ X;  2I4B A;  1LB8 A; 
#chains in the Genus database with same CATH homology
 4P1E A;  2WYK A;  4X04 A;  1AWB A;  2WX9 A;  5EQ9 A;  4MNI A;  2XWK A;  4YZZ A;  4MMP A;  1FPK A;  5I7I A;  4O7M A;  1FBD A;  5T3J A;  4HE1 A;  1FBC A;  2PFZ A;  4N4U A;  4PF8 A;  1IMD A;  1BK4 A;  5A5L A;  4PC9 A;  1FBP A;  5JK4 A;  4GBW A;  1INP A;  3IFA A;  4PGP A;  1FBF A;  1NV6 A;  2VPN A;  2XA5 A;  4N15 A;  3PTY A;  3QMF A;  4MCO A;  4PDD A;  2HPG A;  2F3D A;  4OAN A;  5EQA A;  5IZZ A;  2QPQ A;  1VDW A;  1IMA A;  4PBH A;  2Q8M A;  1LBZ A;  4HE0 A;  2V4C A;  4NN3 A;  4N8Y A;  3CHG A;  5CM6 A;  4O94 A;  4JVI A;  5I5P A;  3T0J A;  4HCW A;  2CZK A;  1NI9 A;  4OVP A;  5LTC A;  2WYP A;  1NV4 A;  1SPI A;  1FBH A;  2XXK A;  2Y5K A;  4GX4 A;  5EYH A;  2FIX A;  4OVQ A;  2F3B A;  5ESY A;  1G0I A;  5EQ8 A;  4PTK A;  2Y5L A;  4GWZ A;  3KC1 A;  1EYJ A;  4OVS A;  1NV2 A;  5IM2 A;  4I3E A;  4MNC A;  1IMF A;  2WBD A;  1FPF A;  4MEV A;  2KR0 A;  3NOH A;  2ZZX A;  1D9Q A;  3LV0 A;  2WBB A;  1IMC A;  2XWV A;  2HHM A;  1FRP A;  1FSA A;  3FXB A;  4PFB A;  4PF6 A;  2KQZ A;  2BJI A;  4NGU A;  3BIG A;  2B4L A;  4GWS A;  4F18 A;  1FBE A;  4PGN A;  5ET8 A;  4F1V A;  4NF0 A;  4O8M A;  4P9K A;  4MJO A;  3BIH A;  4GWX A;  1NV1 A;  2Q74 A;  4N6K A;  2QVR A;  2XWI A;  1LBY A;  1QGX A;  4X9T A;  4PAK A;  1FJ6 A;  1IME A;  5IZ3 A;  1FPE A;  4OVT A;  1RDZ A;  4PE3 A;  2OWZ A;  2P3V A;  4NAP A;  4F19 A;  1NUY A;  2VPO A;  1FPD A;  4PBQ A;  3W9V A;  4MNP A;  3EKI A;  4P3L A;  4XF5 A;  1NV3 A;  4AS4 A;  4PCD A;  1EYI A;  4P8B A;  1K9Z A;  4PAF A;  3ROJ A;  1RDX A;  2CZI A;  4GWW A;  2PCR A;  4I3Y A;  4PET A;  4PDH A;  4AS5 A;  1FPB A;  1NUZ A;  3W9W A;  4MAG A;  3D1R A;  3RYD A;  5I3S A;  2DDK A;  2Q9T A;  4GWU A;  5LDZ A;  2QVV A;  1LBX A;  2ZZW A;  1KA1 A;  4H45 A;  3B8B A;  2FVZ A;  3HFU A;  2V3Q A;  4FBP A;  4PFI A;  1DBZ A;  4G61 A;  1G0H A;  4N17 A;  4NHB A;  3KBZ A;  5IZ3 B;  2ZZV A;  4GWY A;  2R8T A;  4OA4 A;  4NX1 A;  4DI4 B;  2FBP A;  2FHY A;  5DW8 A;  4GX3 A;  5ET5 A;  1YYZ A;  4PFR A;  1NV5 A;  3U65 A;  1CNQ A;  5J1D A;  3IFC A;  3MST A;  4M1V A;  3MYU A;  2XWO A;  1RDY A;  4X8R A;  5FBP A;  1LEV A;  4GX6 A;  3T1B A;  5ET7 A;  4PAI A;  3SZP A;  2HZL A;  5J16 A;  5IZ1 A;  4F1U A;  1JP4 A;  4LN5 A;  4N6D A;  4P1L A;  3GYY A;  1YZ0 A;  2B4M A;  2P3N A;  2PFY A;  1IMB A;  4N8G A;  3E79 A;  1KA0 A;  4MHF A;  4IR8 A;  1FPI A;  4O7I A;  1YXI A;  4N91 A;  1LBV A;  2DE4 A;  4I40 A;  5EQ7 A;  2HZK A;  3FBP A;  1FJ9 A;  2QFL A;  3KC0 A;  1DCU A;  4QXD A;  2WEF A;  1NUW A;  5F24 A;  1KZ8 A;  5IGA A;  4HCY A;  1FTA A;  2CZH A;  1NV7 A;  1LBW A;  1FPG A;  4JVD A;  3RPL A;  3ISP A;  2CEX A;  2DE2 A;  1FBG A;  4DI3 D;  2OX3 A;  2DVZ A;  2DE3 A;  3E78 A;  2FIE A;  4JVC A;  4NQ8 A;  2L5V A;  4P56 A;  1DK4 A;  1NV0 A;  4KXP A;  4XEQ A;  2QVU A;  4OVR A;  2HXR A;  2F5X A;  4NG7 A;  1K9Y A;  1Q9D A;  2GQ1 A;  4MX6 A;  4P47 A;  3B50 A;  4H46 A;  4GBV A;  4XFE A;  1FPJ A;  4HXV A;  1NUX A;  4HE2 A;  5ET6 A;  4YIC A;  4UAB A;  5EYG A;  2CEY A;  4MIJ A;  1EYK A;  2JJK A;  3RPL B;  4QBA A;  3A29 A;  2VT5 A;  1FPL A;  1XI6 A;  3LUZ A;  2MKZ A;  4N81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...