2CZIA

Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
268
structure length
259
Chain Sequence
PWEECFQAAVQLALRAGQIIRKALTEETKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol monophosphatase 2
publication title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 73
structure length 259
sequence length 268
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2cziA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2cziA02
1KZ8A 4GX6A 1FTAA 3RYDA 2QVVA 1FBGA 1FSAA 3QMFA 3KBZA 1IMAA 1NV3A 2FIEA 1DCUA 1FBEA 1FRPA 1FPKA 1NI9A 4I40A 5F24A 2JJKA 4G61A 1YYZA 1FPEA 1NUZA 4GWSA 3BIGA 1FPFA 1K9ZA 1EYIA 1DBZA 2FHYA 3B8BA 1G0HA 1SPIA 1LBXA 1BK4A 1AWBA 2BJIA 2HHMA 5ET7A 4HE0A 4HE2A 2WBDA 1IMDA 2WBBA 4AS4A 2Q74A 1NV2A 2GQ1A 4GWWA 1FJ9A 5IZ3A 5T3JA 5I3SA 1KA1A 1LBYA 2OWZA 4N81A 4HXVA 5A5LA 3BIHA 2CZKA 5IZ1A 1FPLA 4MJOA 1JP4A 3IFCA 1NV4A 4PTKA 2OX3A 2WEFA 4GBVA 2QFLA 3A29A 3D1RA 1RDYA 1NV1A 3IFAA 1QGXA 5FBPA 2PCRA 1NUWA 4GWYA 4FBPA 1EYJA 1IMCA 4H45A 5ET5A 5ET8A 1FBHA 4GX3A 2F3DA 4IR8A 4GWXA 5IZ3B 4QXDA 3RPLB 4KXPA 2VT5A 1FPDA 2Y5KA 1FBDA 2DDKA 1KA0A 2FIXA 2FBPA 3KC0A 1IMFA 1IMEA 1D9QA 1FBCA 4I3EA 1LBWA 1YXIA 1NV7A 1FPGA 1LEVA 1K9YA 5EQAA 3LV0A 2Q8MA 1RDZA 4I3YA 1LBZA 2CZHA 3ROJA 4GWZA 5ESYA 2QVUA 1YZ0A 1EYKA 1FBPA 4GWUA 5J16A 2P3NA 1XI6A 4HE1A 4GBWA 5EQ9A 3FBPA 1IMBA 3KC1A 1FPBA 2R8TA 4AS5A 5ET6A 1NV6A 1NV5A 2Y5LA 4GX4A 5DW8A 1FJ6A 5EQ8A 1FPIA 5LDZA 2CZIA 1Q9DA 2QVRA 1LBVA 4O7IA 1DK4A 1NUYA 5EYGA 2FVZA 1G0IA 3LUZA 1FPJA 1INPA 3RPLA 1CNQA 1RDXA 4H46A 5EYHA 3T0JA 1FBFA 1VDWA 5EQ7A 2P3VA 1NV0A 2F3BA 1NUXA
chains in the Genus database with same CATH superfamily
2D5WA 3MVXA 4EQBA 3FATA 2A5TA 3G3IA 5H8QB 3RPWA 5I57B 3MZ9A 2L5VA 3FUZA 2XXWA 3ILTB 1A40A 4OZ9A 2XX7A 5CMKA 1JQFA 3V5AA 4N8GA 4XIGQ 2QS2A 1Y3NA 3MP6A 3KFMA 4Q5TA 2ESNA 4I62A 3K02A 5L9OA 3S9MC 2DXYA 2XWIA 3TZAA 2QFLA 3Q26A 4R72A 3O66A 2Z8FA 4ESWA 5K2YA 4H45A 4PAFA 2H99A 3RPLB 4OERA 4PFRA 1B0HA 3FASA 3OSRA 4UACA 1PEBA 3L6HA 3MWBA 4GQOA 1IITA 1ELJA 3SEYA 1VE4A 4GWUA 3MAMA 3P7IA 3U93A 2F6PA 1IMBA 2Q2AA 4LUBA 3HHFA 2Y5LA 1FJ6A 2QL3A 5EHSA 2QVRA 3TCHA 4O7IA 4P11A 2HEUA 2HXWA 3PD9A 3QAXA 1DOTA 1SI1A 2XA5A 3A3CA 4KCCA 1SBPA 4RY1A 4MNCA 4MLVA 1H45A 4G61A 2I3WA 3OOAA 1MM7A 1EYIA 5CC2A 2HQ0A 1DBZA 3TYHA 3E4RA 3B8BA 1OLAA 3OO8A 1FTOA 1Q35A 4G8HA 5DT6A 1RYOA 2DYXA 2M8CA 4F18A 4I1DA 3PTYA 2UVHA 4IO3A 1L5TA 5IZ3A 4JWXA 4YB6A 1URDA 2QS3A 4MEVA 4X1BA 1TWYA 4FATA 3UGWA 4PTKA 2OX3A 1LB8A 1ZMGA 1NH8A 3EQ1A 3LUYA 2VGQA 4BDOA 3T9HB 4EQ9A 5H8HB 1D4NA 2B65A 2V3UA 3A3UA 5F7VA 4YKKA 4G68A 2R6GE 3G3JA 3TFLA 4KQPA 2XXHA 1B5HA 1D9VA 5I2KB 2QSXA 4MLQA 4RA1A 1D9QA 3VXCA 1S50A 2UVIA 4DDDA 3Q28A 4G8MA 3KOSA 1LAGE 4ZZAA 5AA2D 2B4LA 1YZ0A 1US5A 1JETA 3FZVA 3U8QA 3EHUA 4Z7EA 4RK9A 3MBPA 3TQWA 3F11A 1ZBMA 5AA3A 5HPQA 2I0CA 2XXTA 2F7AA 1MXVA 2X7QA 5ICQA 3QIMA 1VDWA 1P1NA 1BKAA 4QBAA 3Q25A 2XXXA 2DWJA 2VPOA 3K4UA 3CHGA 5F24A 4WEDA 1YYZA 4R2BA 4WEPA 4RJZA 4ELOA 1PB7A 4OA4A 3ZKKA 1EZPA 1B3LA 1LBXA 4AB5A 1PBPA 4R2FA 1D3KA 3G3KA 4YB5A 4N91A 1IXIA 3O28A 3DP4A 5BWJA 1SW5A 3FJ7A 3IO6A 3VLUA 1FTJA 2CMOA 2OWZA 4F2OA 4LZ7A 3CG3A 2CZKA 5CRYA 1P1OA 1MG1A 3GZGA 1JW4A 5LTCA 3U94A 3H06B 4UA8A 1RDYA 2ANJA 2AYSA 4P1EA 4RXLA 4ELPA 4P47A 4R6KA 1Y3PA 4XF5A 3IOTA 2WKYA 3BFTA 1B3HA 1FTMA 4F29A 1FBHA 1QUKA 4X9TA 1YCJA 2FIXA 2ZZWA 1IMEA 1MQIA 4XKQA 5H8FA 3C31A 4ECFA 3FGSA 1N84A 3PMVA 5H8SA 4NMYA 3ZS6A 5DYHA 2P3NA 3TTMA 2OK2A 1MQDA 4GBWA 2Y7RA 1H44A 1BIYA 1LCFA 4IO5A 3IORA 3OEKA 4G8NA 2HZLA 1INPA 1CNQA 2XX8A 4R75A 1XT8A 4DI3D 4DLDA 3VLWA 1MQJA 5TP9A 4FIMA 4PFYA 3U1OA 4OMBA 3HN0A 3T9XB 1ANFA 3UIFA 4ONYA 1MXUA 3FV2A 1FQBA 4K3FA 4BDMA 4THIA 3GBBA 1DTZA 4N17A 4OYVA 3PUYE 3IL1B 2WBDA 3ZKLA 2WBBA 2ZYKA 3EHSA 2DWAA 1YTVA 3E78A 4N6KA 2HPGA 3KZGA 1JP4A 3IB1A 5IKBA 2UYFA 3T96B 2H4IA 3MVYA 3TTKA 5JEIA 1DTGA 1MPCA 1US4A 1IIWA 3MUQA 4GOTA 2OBGA 1NH7A 3RGYA 3UORA 5H8NA 5I59A 4KYSA 3OEMA 5EYFA 5KCJB 2Q89A 2G29A 1XVYA 4QF9A 1VFEA 3LV0A 2PMSA 2GHBA 1N3WA 1EYKA 4R9FA 1F9BA 1I6AA 3IOUA 3KC1A 1QULA 1BLFA 1A8FA 1LBVA 2DVZA 1FPJA 2E0SA 3FXBA 4LN5A 1PB8A 3R7XA 2Q88A 3E79A 4LP2B 4PP0A 1NUXA 1POY1 4OFLA 4YICA 4FEBA 3B6TA 1FBGA 1OVTA 2I0BA 3K01A 5TPAA 2KLFA 4ZEIA 3K1NA 3N6TA 4GXSB 4OHNA 1SDXA 3MZ1A 1GR2A 3C32A 3B6QA 2Z22A 3M8UA 2ZNTA 1OLCA 3CFLA 2XXKA 3ILUB 4QSCA 2RC9A 2DSFA 3Q29A 1SQYA 3G3HA 2XXUA 3KG2A 1M5FA 4DE8A 3FXQA 3QK6A 4RPOA 3D1RA 4NGUA 1TT1A 1ZLQA 3MVZA 2VP1A 3S9EA 2R71A 3MZBA 3O9PA 1EYJA 2OWSA 4LZ8A 2F3DA 1I6BA 4GWXA 1MXWA 4QXDA 4OENA 5HBCA 1FBDA 1POTA 2I58A 1N04A 4NF0A 3KJTA 3E9XA 2ONRA 4P0IA 1LLSA 5CMMA 4GWZA 4JWYA 2QPQA 1IUDA 1B1HA 4PAIA 2I4CA 2VD3A 4OVQA 4U4SA 1M5BA 4HCWA 4X04A 1CE2A 1FQCA 1QJMA 3TMGA 4WKMA 3NOHA 4EQ7A 4PAKA 1B1XA 1Z7NE 1DPPA 4JSOA 2I6EA 5ET5A 5IZ3B 3TELA 2PT2A 1MXXA 3K6VA 2DWHA 4RNSA 1YAEA 4QFNA 3PV0E 1FPKA 1NL5A 4IB2A 1FCKA 4LONB 3H6VA 2NWJA 2AL4A 2V84A 1A7LA 4DXBA 4NX1A 3IOVA 2RC8A 4NF5A 1R6ZA 3TKDA 4AS4A 4G68B 4TLMB 3U65A 3EKIA 5T3JA 5I3SA 1SD3A 3RT8A 5A5LA 3DM0A 4GLIA 5KDTA 3PUWE 3C35A 1D9YA 4HTGA 1R9LA 3DELB 3GXAA 4OFJA 4G4PA 4U21A 4YU0A 1KWHA 4F2QA 3C34A 4BDNA 4ISUA 1NV1A 3IJXB 3OO7A 2O1MA 1URGA 2VT5A 5L9SA 3PMWA 1Y3QA 3LBSA 2VD2A 2VOZA 5EQAA 1EZ9A 3TTLA 1ZKBA 1IXHA 1LFIA 5FTHA 2OZZA 4I8CA 5JTYA 1FQDA 1MS7A 2FA7A 3K1PA 3O6GA 4LA9A 2UVJA 3H03A 3MSTA 2RCAA 3FIRA 4AS5A 3S4UA 5ET6A 2Y84A 4ZZEA 3MW0A 2XWOA 5ITPA 2XXYA 4IO7A 5DEXB 1I6QA 1ZIUA 5AA4A 1OQHA 1Y1MA 1G0HA 5DVIA 4F3SA 1S9TA 4ZS9A 1A54A 2QS1A 3QXMA 3FVOA 3KJ7A 1IMAA 2FIEA 1DCUA 2NOOA 1FRPA 2F6GA 3BIGA 1TXFA 3SZPA 1IXGA 2OLBA 2XD3A 2X26A 1BK4A 5I5PA 3H6UA 3TTRA 1N76A 1Q1KA 4NF8A 5CMBA 3S9LC 1ATGA 5AA2A 3IX1A 3MC2A 4X48A 4H5FA 3MQ9A 5CBSA 5H8FB 1UTBA 3LSWA 2RCBA 3RQTA 3QUJA 4HCYA 3PD8A 1N7WA 3H6WA 3RN8A 4YB7A 3U92A 2PCRA 3FVKA 4KHZE 1VFDA 1FW0A 1B58A 4GVOA 4NEDA 1B5JA 4XFEA 4ELQA 1MY0A 1OIBA 4DI4B 2H9BA 2DE2A 2FBPA 2REJA 1B2HA 2V25A 4P56A 1NV7A 4KYDA 1FPGA 2B3BA 3BFUA 5TP9B 3VV5A 2Q8MA 5L8DA 3USDA 1MRPA 3SEXA 1O64A 3AXFA 3CR9A 4N6PA 1XI6A 1H43A 1B7UA 5EQ9A 2BJJX 1M5EA 4Q8RA 2PFYA 3HSTA 4ZE9A 1O63A 3H4ZA 1JW1A 1Y9UA 1TFDA 3HV1A 5CI5A 1QW0A 4PC9A 3ECRA 3FVNA 2ZZVA 1FQFA 3CIJA 1FSAA 3FVGA 3T66A 1MY3A 3W9VA 2KR0A 1QUJA 2E1SA 3TDJA 2YPNA 1H76A 5I2NB 1M5DA 1YPNA 2Y7WA 5ET7A 3C33A 1IMDA 2Y7KA 2O7IA 3B7DA 3HFUA 4GWWA 2DE4A 5I58A 5H8NB 5I59B 4OWDA 4QFKA 4H1XA 2ZXTA 3ODBA 4C1TA 3KSJA 3BIHA 2UVGA 4N15A 1VR5A 3KGCA 5EHMA 2HAVA 1B0LA 4NG7A 4EF1A 1NUWA 1EH3A 2ONSA 4F19A 2CZLA 3RTFB 4R74A 3KC0A 3K6UA 2YLNA 5TPAB 2H25A 4L17A 2F8DA 1M5CA 2WYPA 3KEIA 3OMBA 3C4MA 3L6GA 1NUYA 4PGNA 2D3IA 4KPTA 3H3GA 4OVPA 3PUVE 5FHMA 2DQVA 1FTKA 4JVCA 4G77A 2F3BA 3C36A 4NWCA 4PF6A 4GRKA 3VVFA 1NV3A 2X7PA 5IGAA 4OXVA 1GGGA 4JVDA 4PE5B 2QMXA 3O29A 5F1QA 1LSTA 1B3EA 1XVXA 4MNPA 2Y7PA 3MYUA 3ONMA 4F1VA 4RPNA 4FJPA 1KA1A 3TCGA 2O68A 3KBRA 3PGFA 1MM6A 4O3CA 5J1DA 3G3GA 2F35A 1FPLA 2VPNA 4FEDA 4U22A 4M4GA 1BP5A 2H98A 2HAUA 5L9MA 2WEFA 4PFIA 4GBVA 3I6VA 2GH9A 4QSDA 3MPKA 2Y7IA 4P9KA 2XWKA 4TLLB 4ZECA 4ZEBA 5H8HA 4MX6A 4DZ1A 1UTHA 1FPDA 2Y5KA 2OPDA 2PVUA 4MMPA 1B05A 1JEVA 1IMFA 2B3FA 3PPPA 4FE8A 4WXJA 1MXYA 2F78A 4N4UA 2CZHA 3SDFA 4EUOA 5A5XA 1SI0A 1IEJA 3QSLA 4HE1A 3HCQA 4NF6A 1FPBA 2R8TA 1NV5A 2NVUB 2DVCA 3PPRA 3S9NC 1JNFA 3LUZA 1O7TA 4I9DA 4KFQA 4NAPA 5I56B 4PDHA 3JZJA 2O1LA 3LC8A 3W15C 2DWIA 5B70A 1FBFA 1B3FA 4KYEA 4PF8A 3PMXA 2F97A 2A5TB 2QVVA 3QMFA 4IO2A 4FECA 3IB0A 2PX1A 1VSOA 4YKJA 1NI9A 1MY4A 1FPEA 1K9ZA 1NFTA 2UYEA 1Y4CA 4P8BA 1LGBC 4KD5A 5CMCA 4IGRA 1SPIA 4ELRA 2VHAA 4YKIA 4OVJA 4U23A 1NMUA 3I3VA 4NN3A 4FAJA 3SKPA 1WODA 1MY2A 4MCOA 4C0RA 4HW8A 3E3KA 1UIUA 3HPIA 4IGTA 4YKPA 3TQLA 5ICTA 1SYIA 4MJOA 2D21A 3IFCA 5JTYB 2I4BA 2GRVA 4NF4A 2PFZA 3A29A 1PB9A 3IFAA 3FD3A 4LQ2A 2I3VA 2DP8A 4YAHX 3OO6A 4M1VA 2XWVA 3PU5A 2HZKA 3BKIB 4O8MA 2ZYMA 3IK6B 3MVWA 1A55A 5AA4B 2XXPA 5ELVA 1A8EA 1RDZA 1FBPA 1EZOA 5J16A 2RF1A 2OPEA 1B4HA 2CZIA 3RNNA 4C1UA 4EXKA 1DK4A 3OENA 2FVZA 4KR5A 1P1QA 4NF8B 1RDXA 3SEVA 5AA2B 1LBBA 2O84X 4ZEDA 2ZMBA 5CM6A 3M3FA 3VVEA 4NHBA 1IZ1A 4IO4A 3OXNA 2DXRA 3O6HA 3TODA 1B51A 1NUZA 1QVSA 3I5OA 4QRZA 4ND9A 3VLVA 4E0XA 2XHDA 3CFZA 5TU0A 4U2RA 1AWBA 2HHMA 3WAEA 4F1UA 1SW1A 2ZYOA 1B46A 1USYH 4MH5A 1LFGA 3K6XA 2IEEA 4OVSA 2F7CA 1II5A 5LOMA 1LBCA 3THIA 2XXQA 4O3BA 2F36A 4MHFA 1DPEA 4G2ZA 5AA1A 5FHOA 3TUSA 1A99A 2YJPA 1NNFA 2F7BA 2GHAA 5FBPA 3EHTA 5B7DA 3FJMA 4FBPA 1IMCA 4MNIA 4QFLA 4E0WA 1FTLA 4H0WA 3SEUA 4KXPA 4U1ZA 3U72A 1NKXA 2XD2A 2RKMA 3ISPA 1IQ7A 1B3GA 1MDP1 5KCJA 4PDDA 3ROJA 5ESYA 1S7YA 4ZEKA 1B4ZA 3D4CA 1HSLA 1UQWA 1NV6A 1H3DA 4OTEA 4O3AA 5EYGA 5EYHA 4N13A 4OFOA 5I58B 1FQEA 3PPNA 2PYYA 1FTAA 1BTJA 3MPLA 4P1LA 4OEUA 1EU8A 3V83A 1UIVA 1FBEA 4PCDA 1ZU0A 2P0SA 1AOVA 1QUIA 2JJKA 2QMWA 3K1MA 4NQ8A 1PDAA 4DCYA 4OESA 1LCTA 2F5XA 1B52A 3N94A 3QYTA 1DMBA 1NV2A 2XXRA 2GQ1A 1XHYA 4MF3A 4N81A 5IZ1A 4ZEFA 3G7WA 4PBHA 3H6TA 5DVJA 3TCFA 4O7MA 3K00A 3JYRA 4GL8A 3M3LA 4G68C 4BDQA 4JB7A 2DE3A 2ZNUA 2LAOA 3K2DA 4XKPA 3VXBA 4QFPA 3Q27A 5ET8A 4TQUQ 1WVJA 4KCDA 4JXIA 1MQHA 3G3FA 3IB2A 1HSEA 3CFXA 3CI8A 3IR1A 3KN8A 1FBCA 1LBWA 4EDPA 1LEVA 1JVXA 2HCAA 3FJGA 4I3YA 1LBZA 4R6YA 1MDQA 2Z8EA 2KQZA 3CSBA 4Z0IA 3UP9A 3V8XB 1AIVA 4GX4A 1TFAA 5DW8A 5AE4A 3UN6A 1FQAA 1XS5A 3GYYA 3T22A 4LQ5A 4H46A 2RINA 1GV8A 4PGPA 2FYIA 2XX9A 5IAIA 5EQ7A 5IZZA 3RTWB 2P3VA 1NV0A 2HFBA 1FPIA 4PFBA 4LVQA 5CBRA 3KBZA 1JW5A 1OMPA 4YZZA 3W9WA 1B9JA 4I40A 4GWSA 1FPFA 2HXRA 2REGA 5BUUA 3CRBA 3IJOB 4R9GA 3CG1A 2Q2CA 3DLNA 4NE4A 4PFTA 2BJIA 3WAFA 5HM4B 2W7YA 2Q74A 1UTHB 3GBAA 1FJ9A 4MBPA 3FXUA 1R1NA 1LBYA 3RY3A 1USYE 3UK4A 2ZNSA 4GWOA 1B7HA 2THIA 5H8QA 4P3LA 5I57A 4F22A 3VE1B 5A5XB 3PPOA 4OVTA 3IOWA 4NF6B 3SERA 2QRYA 1QGXA 1QKAA 3DP8A 4UABA 1Z7ME 3TAJA 4GWYA 1T0KA 4F39A 2P1SA 4H8IA 3N6UA 2O7UA 2OCUA 1B32A 3KOTA 2FNCA 1LAFE 1K9YA 3OSQA 4P0GA 1AL3A 4DXCA 3O2AA 3A09A 1Y1ZA 3MJNA 2O51A 1MXZA 4PQJA 3VVDA 1GVCA 1NNPA 1WDNA 4GFRA 4N8YA 1LB9A 3TTNA 3RPLA 4POWA 3O97A 4F3BA 1Y20A 1KZ8A 5DEXA 2DOJA 3QUFA 3D4GA 4QFOA 5I7IA 5M2VA 2QS4A 1P99A 4ZDMA 3LR1A 4Q0CA 4MAGA 3DP6A 2P2AA 4NF4B 4RYAA 2ZYNA 4LZ5A 1OVBA 4NTLA 4HE0A 1MQGA 4HE2A 1MH3A 5FHNA 1MPBA 4HS7A 3C9HA 3SEWA 4GXAA 3JV9A 1SW2A 4JDFA 1B40A 4PFWA 1P1WA 4H67A 4X8RA 4GF8A 2Q9TA 1DSNA 1NV4A 2UXAA 3LSXA 3HO7A 3EPEA 5JK4A 2Q8JA 3CVGA 3BBRA 3V89B 1P1UA 5DVFA 5IM2A 1PC3A 3OO9A 4EF2A 3PPQA 2CEYA 4BDRA 4MIJA 3K6WA 2V3TA 2NXOA 1KA0A 3S2VA 1XC1A 4BDLA 3IO4A 4N6DA 1YXIA 1JEUA 4H5GA 5I84A 2O69A 1Y4TA 1I69A 3K0VA 2B4MA 2DS9A 4ZE8A 4PETA 2XXVA 1RKMA 4DCXA 4R73A 2WYKA 3OELA 1PBQA 2Z23A 3LSLA 4FORA 4PFUA 5I2KA 3FV1A 2Z8DA 4AB6A 4RK2A 4U1OA 3FXRA 4N07A 4EXLA 1GTKA 2I48A 3M3KA 1MPDA 2PBWA 2CEXA 4NF5B 3EF7A 3RUMA 3PUZE 2ZZXA 1NNKA 1N7XA 5I2NA 2H5YA 3E13X 1B7ZA 4DXUA 5KDTB 3N5LA 3OD7A 5FTIA 2OJTA 4XXUA 2RC7A 1MY1A 4AQ4A 3LSFB 2NUVA 2GFEA 2OWTA 4JSDA 5ITOA 4YMAA 4R6HA 2V3QA 4OQOA 4IR8A 4PE3A 3CSGA 1B5IA 3O6IA 2I49A 4I3EA 3ZSFA 5K2XA 2R9JA 4GD5A 2ALUA 3IAZA 1JVYA 2QVUA 3TPAA 5KZTA 4KI0E 3FBPA 4OETA 2ABHA 5EQ8A 4XKRA 1Q9DA 3N26A 4DIGA 4NWDA 2WX9A 1R9QA 4H6DA 1J1NA 4MFIA 4OANA 4QHQA 1ZJLA 2QJEA 4GX6A 3KN3A 4F3PA 3RYDA 4XEQA 4JBZA 1LAXA 1ZTYA 5DTBA 4F1YA 2FHYA 2PT1A 4Q30B 3RLFE 2AIXA 4LATA 4O94A 3EN3A 1OQGA 4QSEA 1B6HA 3MP8A 3PUXE 1AMFA 3KN7A 4PBQA 2A5SA 4H8JA 4JVIA 4IO6A 1NNTA 1QKBA 4GIZA 3R26A 1UTBB 4HXVA 5ISUA 1CB6A 3SESA 2V4CA 3B6WA 3R6UA 4IY5A 3T9UA 3UA8A 1XOCA 4JWOA 3VDFA 4OVRA 2V93A 2O6AA 4TOZA 1LAHE 3TEPA 2XXIA 4F31B 4X1DA 2ONKE 2G93A 3RT6B 2IA4A 3SETA 3KSXA 1N3XA 1LFHA 4H65A 1URSA 4F3GA 4GX3A 3T1BA 4XTCQ 4U4XA 2AL5A 4ESXA 2DDKA 2F34A 4GL0A 4YMBA 4OEVA 1SVXB 1N0TA 3T9VA 1IXCA 3HHGA 1HSJA 3T93B 4BLAA 3MP1A 1SW4A 5LDZA 3GLBA 2MKZA 4POXA 1G0IA 3H7MA 4XKNA 1AH5A 4IY6A 3VFJA 1MH4A 3T0JA 5I56A 1RYXA 3B50A 1SYHA
chains in the Genus database with same CATH topology
4PFBA 4YICA 4PF6A 1FBGA 3KBZA 4YZZA 1NV3A 3W9WA 4I40A 4GWSA 1FPFA 2L5VA 2HXRA 5IGAA 4JVDA 2BJIA 4MNPA 2Q74A 3MYUA 2XXKA 4F1VA 1FJ9A 4N8GA 1KA1A 1LBYA 5J1DA 1FPLA 2VPNA 2XWIA 4P3LA 2WEFA 4PFIA 4GBVA 2QFLA 4OVTA 3D1RA 4NGUA 1QGXA 4UABA 4P9KA 2XWKA 4GWYA 1EYJA 4H45A 4MX6A 2F3DA 4GWXA 4PAFA 4QXDA 3RPLB 1FPDA 2Y5KA 4PFRA 1FBDA 4MMPA 4NF0A 1IMFA 1K9YA 4N4UA 2CZHA 4GWZA 2QPQA 4GWUA 2P3VA 4PAIA 4HE1A 4OVQA 1IMBA 1FPBA 2R8TA 1NV5A 2Y5LA 4HCWA 1FJ6A 4X04A 2QVRA 3NOHA 4O7IA 4PAKA 4N8YA 3LUZA 4NAPA 3RPLA 4PDHA 1FBFA 5ET5A 5IZ3B 1KZ8A 4PF8A 2QVVA 3QMFA 2XA5A 5I7IA 4MNCA 1FPKA 1NI9A 4G61A 1FPEA 1K9ZA 4MAGA 1EYIA 4P8BA 1DBZA 3B8BA 1SPIA 4NX1A 4HE0A 4HE2A 4NN3A 4AS4A 4F18A 3PTYA 3U65A 3EKIA 4MCOA 5IZ3A 5T3JA 5I3SA 5A5LA 4MJOA 4MEVA 4X8RA 3IFCA 2Q9TA 1NV4A 4PTKA 2OX3A 5JK4A 2PFZA 3A29A 1NV1A 3IFAA 5IM2A 4M1VA 2XWVA 2HZKA 2CEYA 4MIJA 4O8MA 1NUXA 2VT5A 1KA0A 1D9QA 4N6DA 1YXIA 5EQAA 1RDZA 2B4MA 2B4LA 1YZ0A 1FBPA 4PETA 5J16A 3MSTA 4AS5A 5ET6A 2CZIA 1DK4A 2WYKA 2FVZA 2XWOA 1RDXA 1VDWA 4QBAA 1G0HA 2VPOA 5CM6A 4NHBA 3CHGA 1IMAA 2FIEA 1DCUA 1FRPA 5F24A 1YYZA 1NUZA 3BIGA 2CEXA 4OA4A 3SZPA 1LBXA 1BK4A 1AWBA 2ZZXA 2HHMA 5I5PA 4F1UA 4N91A 4OVSA 2OWZA 4MHFA 2CZKA 5LTCA 4HCYA 1RDYA 4P1EA 4P47A 5FBPA 2PCRA 4XF5A 4FBPA 2V3QA 1IMCA 4MNIA 1FBHA 4XFEA 4IR8A 4PE3A 4DI4B 4KXPA 4X9TA 2DE2A 2FIXA 2FBPA 2ZZWA 1IMEA 3ISPA 4I3EA 4P56A 1NV7A 1FPGA 4PDDA 2Q8MA 3ROJA 5ESYA 2QVUA 2P3NA 1XI6A 4GBWA 5EQ9A 3FBPA 1NV6A 5EQ8A 2PFYA 1Q9DA 5EYGA 2HZLA 1INPA 1CNQA 2WX9A 5EYHA 4PC9A 4OANA 4DI3D 4GX6A 1FTAA 3RYDA 2ZZVA 1FSAA 4P1LA 4XEQA 3W9VA 2KR0A 1FBEA 4PCDA 2JJKA 4NQ8A 2FHYA 2F5XA 4O94A 4N17A 5ET7A 2WBDA 1IMDA 2WBBA 3HFUA 4PBQA 1NV2A 4JVIA 2GQ1A 4GWWA 2DE4A 3E78A 4N81A 4HXVA 4N6KA 3BIHA 2HPGA 4N15A 5IZ1A 2V4CA 1JP4A 4PBHA 4OVRA 4O7MA 2DE3A 4NG7A 1NUWA 5ET8A 4GX3A 3T1BA 4F19A 2DDKA 3KC0A 4JVCA 1FBCA 1LBWA 1LEVA 3LV0A 4I3YA 1LBZA 2KQZA 1EYKA 2WYPA 3KC1A 4GX4A 5DW8A 5LDZA 2MKZA 1LBVA 1NUYA 3GYYA 4PGNA 2DVZA 1G0IA 1FPJA 4OVPA 3FXBA 4LN5A 4H46A 3T0JA 4PGPA 3E79A 5EQ7A 5IZZA 3B50A 1NV0A 2F3BA 1FPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZ8 A;  4GX6 A;  1FTA A;  3RYD A;  2QVV A;  1FBG A;  1FSA A;  3QMF A;  3KBZ A;  1IMA A;  1NV3 A;  2FIE A;  1DCU A;  1FBE A;  1FRP A;  1FPK A;  1NI9 A;  4I40 A;  5F24 A;  2JJK A;  4G61 A;  1YYZ A;  1FPE A;  1NUZ A;  4GWS A;  3BIG A;  1FPF A;  1K9Z A;  1EYI A;  1DBZ A;  2FHY A;  3B8B A;  1G0H A;  1SPI A;  1LBX A;  1BK4 A;  1AWB A;  2BJI A;  2HHM A;  5ET7 A;  4HE0 A;  4HE2 A;  2WBD A;  1IMD A;  2WBB A;  4AS4 A;  2Q74 A;  1NV2 A;  2GQ1 A;  4GWW A;  1FJ9 A;  5IZ3 A;  5T3J A;  5I3S A;  1KA1 A;  1LBY A;  2OWZ A;  4N81 A;  4HXV A;  5A5L A;  3BIH A;  2CZK A;  5IZ1 A;  1FPL A;  4MJO A;  1JP4 A;  3IFC A;  1NV4 A;  4PTK A;  2OX3 A;  2WEF A;  4GBV A;  2QFL A;  3A29 A;  3D1R A;  1RDY A;  1NV1 A;  3IFA A;  1QGX A;  5FBP A;  2PCR A;  1NUW A;  4GWY A;  4FBP A;  1EYJ A;  1IMC A;  4H45 A;  5ET5 A;  5ET8 A;  1FBH A;  4GX3 A;  2F3D A;  4IR8 A;  4GWX A;  5IZ3 B;  4QXD A;  3RPL B;  4KXP A;  2VT5 A;  1FPD A;  2Y5K A;  1FBD A;  2DDK A;  1KA0 A;  2FIX A;  2FBP A;  3KC0 A;  1IMF A;  1IME A;  1D9Q A;  1FBC A;  4I3E A;  1LBW A;  1YXI A;  1NV7 A;  1FPG A;  1LEV A;  1K9Y A;  5EQA A;  3LV0 A;  2Q8M A;  1RDZ A;  4I3Y A;  1LBZ A;  2CZH A;  3ROJ A;  4GWZ A;  5ESY A;  2QVU A;  1YZ0 A;  1EYK A;  1FBP A;  4GWU A;  5J16 A;  2P3N A;  1XI6 A;  4HE1 A;  4GBW A;  5EQ9 A;  3FBP A;  1IMB A;  3KC1 A;  1FPB A;  2R8T A;  4AS5 A;  5ET6 A;  1NV6 A;  1NV5 A;  2Y5L A;  4GX4 A;  5DW8 A;  1FJ6 A;  5EQ8 A;  1FPI A;  5LDZ A;  2CZI A;  1Q9D A;  2QVR A;  1LBV A;  4O7I A;  1DK4 A;  1NUY A;  5EYG A;  2FVZ A;  1G0I A;  3LUZ A;  1FPJ A;  1INP A;  3RPL A;  1CNQ A;  1RDX A;  4H46 A;  5EYH A;  3T0J A;  1FBF A;  1VDW A;  5EQ7 A;  2P3V A;  1NV0 A;  2F3B A;  1NUX A; 
#chains in the Genus database with same CATH topology
 2D5W A;  3MVX A;  4EQB A;  3FAT A;  2A5T A;  3G3I A;  5H8Q B;  3RPW A;  5I57 B;  3MZ9 A;  2L5V A;  3FUZ A;  2XXW A;  3ILT B;  1A40 A;  4OZ9 A;  2XX7 A;  5CMK A;  1JQF A;  3V5A A;  4N8G A;  4XIG Q;  2QS2 A;  1Y3N A;  3MP6 A;  3KFM A;  4Q5T A;  2ESN A;  4I62 A;  3K02 A;  5L9O A;  3S9M C;  2DXY A;  2XWI A;  3TZA A;  2QFL A;  3Q26 A;  4R72 A;  3O66 A;  2Z8F A;  4ESW A;  5K2Y A;  4H45 A;  4PAF A;  2H99 A;  3RPL B;  4OER A;  4PFR A;  1B0H A;  3FAS A;  3OSR A;  4UAC A;  1PEB A;  3L6H A;  3MWB A;  4GQO A;  1IIT A;  1ELJ A;  3SEY A;  1VE4 A;  4GWU A;  3MAM A;  3P7I A;  3U93 A;  2F6P A;  1IMB A;  2Q2A A;  4LUB A;  3HHF A;  2Y5L A;  1FJ6 A;  2QL3 A;  5EHS A;  2QVR A;  3TCH A;  4O7I A;  4P11 A;  2HEU A;  2HXW A;  3PD9 A;  3QAX A;  1DOT A;  1SI1 A;  2XA5 A;  3A3C A;  4KCC A;  1SBP A;  4RY1 A;  4MNC A;  4MLV A;  1H45 A;  4G61 A;  2I3W A;  3OOA A;  1MM7 A;  1EYI A;  5CC2 A;  2HQ0 A;  1DBZ A;  3TYH A;  3E4R A;  3B8B A;  1OLA A;  3OO8 A;  1FTO A;  1Q35 A;  4G8H A;  5DT6 A;  1RYO A;  2DYX A;  2M8C A;  4F18 A;  4I1D A;  3PTY A;  2UVH A;  4IO3 A;  1L5T A;  5IZ3 A;  4JWX A;  4YB6 A;  1URD A;  2QS3 A;  4MEV A;  4X1B A;  1TWY A;  4FAT A;  3UGW A;  4PTK A;  2OX3 A;  1LB8 A;  1ZMG A;  1NH8 A;  3EQ1 A;  3LUY A;  2VGQ A;  4BDO A;  3T9H B;  4EQ9 A;  5H8H B;  1D4N A;  2B65 A;  2V3U A;  3A3U A;  5F7V A;  4YKK A;  4G68 A;  2R6G E;  3G3J A;  3TFL A;  4KQP A;  2XXH A;  1B5H A;  1D9V A;  5I2K B;  2QSX A;  4MLQ A;  4RA1 A;  1D9Q A;  3VXC A;  1S50 A;  2UVI A;  4DDD A;  3Q28 A;  4G8M A;  3KOS A;  1LAG E;  4ZZA A;  5AA2 D;  2B4L A;  1YZ0 A;  1US5 A;  1JET A;  3FZV A;  3U8Q A;  3EHU A;  4Z7E A;  4RK9 A;  3MBP A;  3TQW A;  3F11 A;  1ZBM A;  5AA3 A;  5HPQ A;  2I0C A;  2XXT A;  2F7A A;  1MXV A;  2X7Q A;  5ICQ A;  3QIM A;  1VDW A;  1P1N A;  1BKA A;  4QBA A;  3Q25 A;  2XXX A;  2DWJ A;  2VPO A;  3K4U A;  3CHG A;  5F24 A;  4WED A;  1YYZ A;  4R2B A;  4WEP A;  4RJZ A;  4ELO A;  1PB7 A;  4OA4 A;  3ZKK A;  1EZP A;  1B3L A;  1LBX A;  4AB5 A;  1PBP A;  4R2F A;  1D3K A;  3G3K A;  4YB5 A;  4N91 A;  1IXI A;  3O28 A;  3DP4 A;  5BWJ A;  1SW5 A;  3FJ7 A;  3IO6 A;  3VLU A;  1FTJ A;  2CMO A;  2OWZ A;  4F2O A;  4LZ7 A;  3CG3 A;  2CZK A;  5CRY A;  1P1O A;  1MG1 A;  3GZG A;  1JW4 A;  5LTC A;  3U94 A;  3H06 B;  4UA8 A;  1RDY A;  2ANJ A;  2AYS A;  4P1E A;  4RXL A;  4ELP A;  4P47 A;  4R6K A;  1Y3P A;  4XF5 A;  3IOT A;  2WKY A;  3BFT A;  1B3H A;  1FTM A;  4F29 A;  1FBH A;  1QUK A;  4X9T A;  1YCJ A;  2FIX A;  2ZZW A;  1IME A;  1MQI A;  4XKQ A;  5H8F A;  3C31 A;  4ECF A;  3FGS A;  1N84 A;  3PMV A;  5H8S A;  4NMY A;  3ZS6 A;  5DYH A;  2P3N A;  3TTM A;  2OK2 A;  1MQD A;  4GBW A;  2Y7R A;  1H44 A;  1BIY A;  1LCF A;  4IO5 A;  3IOR A;  3OEK A;  4G8N A;  2HZL A;  1INP A;  1CNQ A;  2XX8 A;  4R75 A;  1XT8 A;  4DI3 D;  4DLD A;  3VLW A;  1MQJ A;  5TP9 A;  4FIM A;  4PFY A;  3U1O A;  4OMB A;  3HN0 A;  3T9X B;  1ANF A;  3UIF A;  4ONY A;  1MXU A;  3FV2 A;  1FQB A;  4K3F A;  4BDM A;  4THI A;  3GBB A;  1DTZ A;  4N17 A;  4OYV A;  3PUY E;  3IL1 B;  2WBD A;  3ZKL A;  2WBB A;  2ZYK A;  3EHS A;  2DWA A;  1YTV A;  3E78 A;  4N6K A;  2HPG A;  3KZG A;  1JP4 A;  3IB1 A;  5IKB A;  2UYF A;  3T96 B;  2H4I A;  3MVY A;  3TTK A;  5JEI A;  1DTG A;  1MPC A;  1US4 A;  1IIW A;  3MUQ A;  4GOT A;  2OBG A;  1NH7 A;  3RGY A;  3UOR A;  5H8N A;  5I59 A;  4KYS A;  3OEM A;  5EYF A;  5KCJ B;  2Q89 A;  2G29 A;  1XVY A;  4QF9 A;  1VFE A;  3LV0 A;  2PMS A;  2GHB A;  1N3W A;  1EYK A;  4R9F A;  1F9B A;  1I6A A;  3IOU A;  3KC1 A;  1QUL A;  1BLF A;  1A8F A;  1LBV A;  2DVZ A;  1FPJ A;  2E0S A;  3FXB A;  4LN5 A;  1PB8 A;  3R7X A;  2Q88 A;  3E79 A;  4LP2 B;  4PP0 A;  1NUX A;  1POY 1;  4OFL A;  4YIC A;  4FEB A;  3B6T A;  1FBG A;  1OVT A;  2I0B A;  3K01 A;  5TPA A;  2KLF A;  4ZEI A;  3K1N A;  3N6T A;  4GXS B;  4OHN A;  1SDX A;  3MZ1 A;  1GR2 A;  3C32 A;  3B6Q A;  2Z22 A;  3M8U A;  2ZNT A;  1OLC A;  3CFL A;  2XXK A;  3ILU B;  4QSC A;  2RC9 A;  2DSF A;  3Q29 A;  1SQY A;  3G3H A;  2XXU A;  3KG2 A;  1M5F A;  4DE8 A;  3FXQ A;  3QK6 A;  4RPO A;  3D1R A;  4NGU A;  1TT1 A;  1ZLQ A;  3MVZ A;  2VP1 A;  3S9E A;  2R71 A;  3MZB A;  3O9P A;  1EYJ A;  2OWS A;  4LZ8 A;  2F3D A;  1I6B A;  4GWX A;  1MXW A;  4QXD A;  4OEN A;  5HBC A;  1FBD A;  1POT A;  2I58 A;  1N04 A;  4NF0 A;  3KJT A;  3E9X A;  2ONR A;  4P0I A;  1LLS A;  5CMM A;  4GWZ A;  4JWY A;  2QPQ A;  1IUD A;  1B1H A;  4PAI A;  2I4C A;  2VD3 A;  4OVQ A;  4U4S A;  1M5B A;  4HCW A;  4X04 A;  1CE2 A;  1FQC A;  1QJM A;  3TMG A;  4WKM A;  3NOH A;  4EQ7 A;  4PAK A;  1B1X A;  1Z7N E;  1DPP A;  4JSO A;  2I6E A;  5ET5 A;  5IZ3 B;  3TEL A;  2PT2 A;  1MXX A;  3K6V A;  2DWH A;  4RNS A;  1YAE A;  4QFN A;  3PV0 E;  1FPK A;  1NL5 A;  4IB2 A;  1FCK A;  4LON B;  3H6V A;  2NWJ A;  2AL4 A;  2V84 A;  1A7L A;  4DXB A;  4NX1 A;  3IOV A;  2RC8 A;  4NF5 A;  1R6Z A;  3TKD A;  4AS4 A;  4G68 B;  4TLM B;  3U65 A;  3EKI A;  5T3J A;  5I3S A;  1SD3 A;  3RT8 A;  5A5L A;  3DM0 A;  4GLI A;  5KDT A;  3PUW E;  3C35 A;  1D9Y A;  4HTG A;  1R9L A;  3DEL B;  3GXA A;  4OFJ A;  4G4P A;  4U21 A;  4YU0 A;  1KWH A;  4F2Q A;  3C34 A;  4BDN A;  4ISU A;  1NV1 A;  3IJX B;  3OO7 A;  2O1M A;  1URG A;  2VT5 A;  5L9S A;  3PMW A;  1Y3Q A;  3LBS A;  2VD2 A;  2VOZ A;  5EQA A;  1EZ9 A;  3TTL A;  1ZKB A;  1IXH A;  1LFI A;  5FTH A;  2OZZ A;  4I8C A;  5JTY A;  1FQD A;  1MS7 A;  2FA7 A;  3K1P A;  3O6G A;  4LA9 A;  2UVJ A;  3H03 A;  3MST A;  2RCA A;  3FIR A;  4AS5 A;  3S4U A;  5ET6 A;  2Y84 A;  4ZZE A;  3MW0 A;  2XWO A;  5ITP A;  2XXY A;  4IO7 A;  5DEX B;  1I6Q A;  1ZIU A;  5AA4 A;  1OQH A;  1Y1M A;  1G0H A;  5DVI A;  4F3S A;  1S9T A;  4ZS9 A;  1A54 A;  2QS1 A;  3QXM A;  3FVO A;  3KJ7 A;  1IMA A;  2FIE A;  1DCU A;  2NOO A;  1FRP A;  2F6G A;  3BIG A;  1TXF A;  3SZP A;  1IXG A;  2OLB A;  2XD3 A;  2X26 A;  1BK4 A;  5I5P A;  3H6U A;  3TTR A;  1N76 A;  1Q1K A;  4NF8 A;  5CMB A;  3S9L C;  1ATG A;  5AA2 A;  3IX1 A;  3MC2 A;  4X48 A;  4H5F A;  3MQ9 A;  5CBS A;  5H8F B;  1UTB A;  3LSW A;  2RCB A;  3RQT A;  3QUJ A;  4HCY A;  3PD8 A;  1N7W A;  3H6W A;  3RN8 A;  4YB7 A;  3U92 A;  2PCR A;  3FVK A;  4KHZ E;  1VFD A;  1FW0 A;  1B58 A;  4GVO A;  4NED A;  1B5J A;  4XFE A;  4ELQ A;  1MY0 A;  1OIB A;  4DI4 B;  2H9B A;  2DE2 A;  2FBP A;  2REJ A;  1B2H A;  2V25 A;  4P56 A;  1NV7 A;  4KYD A;  1FPG A;  2B3B A;  3BFU A;  5TP9 B;  3VV5 A;  2Q8M A;  5L8D A;  3USD A;  1MRP A;  3SEX A;  1O64 A;  3AXF A;  3CR9 A;  4N6P A;  1XI6 A;  1H43 A;  1B7U A;  5EQ9 A;  2BJJ X;  1M5E A;  4Q8R A;  2PFY A;  3HST A;  4ZE9 A;  1O63 A;  3H4Z A;  1JW1 A;  1Y9U A;  1TFD A;  3HV1 A;  5CI5 A;  1QW0 A;  4PC9 A;  3ECR A;  3FVN A;  2ZZV A;  1FQF A;  3CIJ A;  1FSA A;  3FVG A;  3T66 A;  1MY3 A;  3W9V A;  2KR0 A;  1QUJ A;  2E1S A;  3TDJ A;  2YPN A;  1H76 A;  5I2N B;  1M5D A;  1YPN A;  2Y7W A;  5ET7 A;  3C33 A;  1IMD A;  2Y7K A;  2O7I A;  3B7D A;  3HFU A;  4GWW A;  2DE4 A;  5I58 A;  5H8N B;  5I59 B;  4OWD A;  4QFK A;  4H1X A;  2ZXT A;  3ODB A;  4C1T A;  3KSJ A;  3BIH A;  2UVG A;  4N15 A;  1VR5 A;  3KGC A;  5EHM A;  2HAV A;  1B0L A;  4NG7 A;  4EF1 A;  1NUW A;  1EH3 A;  2ONS A;  4F19 A;  2CZL A;  3RTF B;  4R74 A;  3KC0 A;  3K6U A;  2YLN A;  5TPA B;  2H25 A;  4L17 A;  2F8D A;  1M5C A;  2WYP A;  3KEI A;  3OMB A;  3C4M A;  3L6G A;  1NUY A;  4PGN A;  2D3I A;  4KPT A;  3H3G A;  4OVP A;  3PUV E;  5FHM A;  2DQV A;  1FTK A;  4JVC A;  4G77 A;  2F3B A;  3C36 A;  4NWC A;  4PF6 A;  4GRK A;  3VVF A;  1NV3 A;  2X7P A;  5IGA A;  4OXV A;  1GGG A;  4JVD A;  4PE5 B;  2QMX A;  3O29 A;  5F1Q A;  1LST A;  1B3E A;  1XVX A;  4MNP A;  2Y7P A;  3MYU A;  3ONM A;  4F1V A;  4RPN A;  4FJP A;  1KA1 A;  3TCG A;  2O68 A;  3KBR A;  3PGF A;  1MM6 A;  4O3C A;  5J1D A;  3G3G A;  2F35 A;  1FPL A;  2VPN A;  4FED A;  4U22 A;  4M4G A;  1BP5 A;  2H98 A;  2HAU A;  5L9M A;  2WEF A;  4PFI A;  4GBV A;  3I6V A;  2GH9 A;  4QSD A;  3MPK A;  2Y7I A;  4P9K A;  2XWK A;  4TLL B;  4ZEC A;  4ZEB A;  5H8H A;  4MX6 A;  4DZ1 A;  1UTH A;  1FPD A;  2Y5K A;  2OPD A;  2PVU A;  4MMP A;  1B05 A;  1JEV A;  1IMF A;  2B3F A;  3PPP A;  4FE8 A;  4WXJ A;  1MXY A;  2F78 A;  4N4U A;  2CZH A;  3SDF A;  4EUO A;  5A5X A;  1SI0 A;  1IEJ A;  3QSL A;  4HE1 A;  3HCQ A;  4NF6 A;  1FPB A;  2R8T A;  1NV5 A;  2NVU B;  2DVC A;  3PPR A;  3S9N C;  1JNF A;  3LUZ A;  1O7T A;  4I9D A;  4KFQ A;  4NAP A;  5I56 B;  4PDH A;  3JZJ A;  2O1L A;  3LC8 A;  3W15 C;  2DWI A;  5B70 A;  1FBF A;  1B3F A;  4KYE A;  4PF8 A;  3PMX A;  2F97 A;  2A5T B;  2QVV A;  3QMF A;  4IO2 A;  4FEC A;  3IB0 A;  2PX1 A;  1VSO A;  4YKJ A;  1NI9 A;  1MY4 A;  1FPE A;  1K9Z A;  1NFT A;  2UYE A;  1Y4C A;  4P8B A;  1LGB C;  4KD5 A;  5CMC A;  4IGR A;  1SPI A;  4ELR A;  2VHA A;  4YKI A;  4OVJ A;  4U23 A;  1NMU A;  3I3V A;  4NN3 A;  4FAJ A;  3SKP A;  1WOD A;  1MY2 A;  4MCO A;  4C0R A;  4HW8 A;  3E3K A;  1UIU A;  3HPI A;  4IGT A;  4YKP A;  3TQL A;  5ICT A;  1SYI A;  4MJO A;  2D21 A;  3IFC A;  5JTY B;  2I4B A;  2GRV A;  4NF4 A;  2PFZ A;  3A29 A;  1PB9 A;  3IFA A;  3FD3 A;  4LQ2 A;  2I3V A;  2DP8 A;  4YAH X;  3OO6 A;  4M1V A;  2XWV A;  3PU5 A;  2HZK A;  3BKI B;  4O8M A;  2ZYM A;  3IK6 B;  3MVW A;  1A55 A;  5AA4 B;  2XXP A;  5ELV A;  1A8E A;  1RDZ A;  1FBP A;  1EZO A;  5J16 A;  2RF1 A;  2OPE A;  1B4H A;  2CZI A;  3RNN A;  4C1U A;  4EXK A;  1DK4 A;  3OEN A;  2FVZ A;  4KR5 A;  1P1Q A;  4NF8 B;  1RDX A;  3SEV A;  5AA2 B;  1LBB A;  2O84 X;  4ZED A;  2ZMB A;  5CM6 A;  3M3F A;  3VVE A;  4NHB A;  1IZ1 A;  4IO4 A;  3OXN A;  2DXR A;  3O6H A;  3TOD A;  1B51 A;  1NUZ A;  1QVS A;  3I5O A;  4QRZ A;  4ND9 A;  3VLV A;  4E0X A;  2XHD A;  3CFZ A;  5TU0 A;  4U2R A;  1AWB A;  2HHM A;  3WAE A;  4F1U A;  1SW1 A;  2ZYO A;  1B46 A;  1USY H;  4MH5 A;  1LFG A;  3K6X A;  2IEE A;  4OVS A;  2F7C A;  1II5 A;  5LOM A;  1LBC A;  3THI A;  2XXQ A;  4O3B A;  2F36 A;  4MHF A;  1DPE A;  4G2Z A;  5AA1 A;  5FHO A;  3TUS A;  1A99 A;  2YJP A;  1NNF A;  2F7B A;  2GHA A;  5FBP A;  3EHT A;  5B7D A;  3FJM A;  4FBP A;  1IMC A;  4MNI A;  4QFL A;  4E0W A;  1FTL A;  4H0W A;  3SEU A;  4KXP A;  4U1Z A;  3U72 A;  1NKX A;  2XD2 A;  2RKM A;  3ISP A;  1IQ7 A;  1B3G A;  1MDP 1;  5KCJ A;  4PDD A;  3ROJ A;  5ESY A;  1S7Y A;  4ZEK A;  1B4Z A;  3D4C A;  1HSL A;  1UQW A;  1NV6 A;  1H3D A;  4OTE A;  4O3A A;  5EYG A;  5EYH A;  4N13 A;  4OFO A;  5I58 B;  1FQE A;  3PPN A;  2PYY A;  1FTA A;  1BTJ A;  3MPL A;  4P1L A;  4OEU A;  1EU8 A;  3V83 A;  1UIV A;  1FBE A;  4PCD A;  1ZU0 A;  2P0S A;  1AOV A;  1QUI A;  2JJK A;  2QMW A;  3K1M A;  4NQ8 A;  1PDA A;  4DCY A;  4OES A;  1LCT A;  2F5X A;  1B52 A;  3N94 A;  3QYT A;  1DMB A;  1NV2 A;  2XXR A;  2GQ1 A;  1XHY A;  4MF3 A;  4N81 A;  5IZ1 A;  4ZEF A;  3G7W A;  4PBH A;  3H6T A;  5DVJ A;  3TCF A;  4O7M A;  3K00 A;  3JYR A;  4GL8 A;  3M3L A;  4G68 C;  4BDQ A;  4JB7 A;  2DE3 A;  2ZNU A;  2LAO A;  3K2D A;  4XKP A;  3VXB A;  4QFP A;  3Q27 A;  5ET8 A;  4TQU Q;  1WVJ A;  4KCD A;  4JXI A;  1MQH A;  3G3F A;  3IB2 A;  1HSE A;  3CFX A;  3CI8 A;  3IR1 A;  3KN8 A;  1FBC A;  1LBW A;  4EDP A;  1LEV A;  1JVX A;  2HCA A;  3FJG A;  4I3Y A;  1LBZ A;  4R6Y A;  1MDQ A;  2Z8E A;  2KQZ A;  3CSB A;  4Z0I A;  3UP9 A;  3V8X B;  1AIV A;  4GX4 A;  1TFA A;  5DW8 A;  5AE4 A;  3UN6 A;  1FQA A;  1XS5 A;  3GYY A;  3T22 A;  4LQ5 A;  4H46 A;  2RIN A;  1GV8 A;  4PGP A;  2FYI A;  2XX9 A;  5IAI A;  5EQ7 A;  5IZZ A;  3RTW B;  2P3V A;  1NV0 A;  2HFB A;  1FPI A;  4PFB A;  4LVQ A;  5CBR A;  3KBZ A;  1JW5 A;  1OMP A;  4YZZ A;  3W9W A;  1B9J A;  4I40 A;  4GWS A;  1FPF A;  2HXR A;  2REG A;  5BUU A;  3CRB A;  3IJO B;  4R9G A;  3CG1 A;  2Q2C A;  3DLN A;  4NE4 A;  4PFT A;  2BJI A;  3WAF A;  5HM4 B;  2W7Y A;  2Q74 A;  1UTH B;  3GBA A;  1FJ9 A;  4MBP A;  3FXU A;  1R1N A;  1LBY A;  3RY3 A;  1USY E;  3UK4 A;  2ZNS A;  4GWO A;  1B7H A;  2THI A;  5H8Q A;  4P3L A;  5I57 A;  4F22 A;  3VE1 B;  5A5X B;  3PPO A;  4OVT A;  3IOW A;  4NF6 B;  3SER A;  2QRY A;  1QGX A;  1QKA A;  3DP8 A;  4UAB A;  1Z7M E;  3TAJ A;  4GWY A;  1T0K A;  4F39 A;  2P1S A;  4H8I A;  3N6U A;  2O7U A;  2OCU A;  1B32 A;  3KOT A;  2FNC A;  1LAF E;  1K9Y A;  3OSQ A;  4P0G A;  1AL3 A;  4DXC A;  3O2A A;  3A09 A;  1Y1Z A;  3MJN A;  2O51 A;  1MXZ A;  4PQJ A;  3VVD A;  1GVC A;  1NNP A;  1WDN A;  4GFR A;  4N8Y A;  1LB9 A;  3TTN A;  3RPL A;  4POW A;  3O97 A;  4F3B A;  1Y20 A;  1KZ8 A;  5DEX A;  2DOJ A;  3QUF A;  3D4G A;  4QFO A;  5I7I A;  5M2V A;  2QS4 A;  1P99 A;  4ZDM A;  3LR1 A;  4Q0C A;  4MAG A;  3DP6 A;  2P2A A;  4NF4 B;  4RYA A;  2ZYN A;  4LZ5 A;  1OVB A;  4NTL A;  4HE0 A;  1MQG A;  4HE2 A;  1MH3 A;  5FHN A;  1MPB A;  4HS7 A;  3C9H A;  3SEW A;  4GXA A;  3JV9 A;  1SW2 A;  4JDF A;  1B40 A;  4PFW A;  1P1W A;  4H67 A;  4X8R A;  4GF8 A;  2Q9T A;  1DSN A;  1NV4 A;  2UXA A;  3LSX A;  3HO7 A;  3EPE A;  5JK4 A;  2Q8J A;  3CVG A;  3BBR A;  3V89 B;  1P1U A;  5DVF A;  5IM2 A;  1PC3 A;  3OO9 A;  4EF2 A;  3PPQ A;  2CEY A;  4BDR A;  4MIJ A;  3K6W A;  2V3T A;  2NXO A;  1KA0 A;  3S2V A;  1XC1 A;  4BDL A;  3IO4 A;  4N6D A;  1YXI A;  1JEU A;  4H5G A;  5I84 A;  2O69 A;  1Y4T A;  1I69 A;  3K0V A;  2B4M A;  2DS9 A;  4ZE8 A;  4PET A;  2XXV A;  1RKM A;  4DCX A;  4R73 A;  2WYK A;  3OEL A;  1PBQ A;  2Z23 A;  3LSL A;  4FOR A;  4PFU A;  5I2K A;  3FV1 A;  2Z8D A;  4AB6 A;  4RK2 A;  4U1O A;  3FXR A;  4N07 A;  4EXL A;  1GTK A;  2I48 A;  3M3K A;  1MPD A;  2PBW A;  2CEX A;  4NF5 B;  3EF7 A;  3RUM A;  3PUZ E;  2ZZX A;  1NNK A;  1N7X A;  5I2N A;  2H5Y A;  3E13 X;  1B7Z A;  4DXU A;  5KDT B;  3N5L A;  3OD7 A;  5FTI A;  2OJT A;  4XXU A;  2RC7 A;  1MY1 A;  4AQ4 A;  3LSF B;  2NUV A;  2GFE A;  2OWT A;  4JSD A;  5ITO A;  4YMA A;  4R6H A;  2V3Q A;  4OQO A;  4IR8 A;  4PE3 A;  3CSG A;  1B5I A;  3O6I A;  2I49 A;  4I3E A;  3ZSF A;  5K2X A;  2R9J A;  4GD5 A;  2ALU A;  3IAZ A;  1JVY A;  2QVU A;  3TPA A;  5KZT A;  4KI0 E;  3FBP A;  4OET A;  2ABH A;  5EQ8 A;  4XKR A;  1Q9D A;  3N26 A;  4DIG A;  4NWD A;  2WX9 A;  1R9Q A;  4H6D A;  1J1N A;  4MFI A;  4OAN A;  4QHQ A;  1ZJL A;  2QJE A;  4GX6 A;  3KN3 A;  4F3P A;  3RYD A;  4XEQ A;  4JBZ A;  1LAX A;  1ZTY A;  5DTB A;  4F1Y A;  2FHY A;  2PT1 A;  4Q30 B;  3RLF E;  2AIX A;  4LAT A;  4O94 A;  3EN3 A;  1OQG A;  4QSE A;  1B6H A;  3MP8 A;  3PUX E;  1AMF A;  3KN7 A;  4PBQ A;  2A5S A;  4H8J A;  4JVI A;  4IO6 A;  1NNT A;  1QKB A;  4GIZ A;  3R26 A;  1UTB B;  4HXV A;  5ISU A;  1CB6 A;  3SES A;  2V4C A;  3B6W A;  3R6U A;  4IY5 A;  3T9U A;  3UA8 A;  1XOC A;  4JWO A;  3VDF A;  4OVR A;  2V93 A;  2O6A A;  4TOZ A;  1LAH E;  3TEP A;  2XXI A;  4F31 B;  4X1D A;  2ONK E;  2G93 A;  3RT6 B;  2IA4 A;  3SET A;  3KSX A;  1N3X A;  1LFH A;  4H65 A;  1URS A;  4F3G A;  4GX3 A;  3T1B A;  4XTC Q;  4U4X A;  2AL5 A;  4ESX A;  2DDK A;  2F34 A;  4GL0 A;  4YMB A;  4OEV A;  1SVX B;  1N0T A;  3T9V A;  1IXC A;  3HHG A;  1HSJ A;  3T93 B;  4BLA A;  3MP1 A;  1SW4 A;  5LDZ A;  3GLB A;  2MKZ A;  4POX A;  1G0I A;  3H7M A;  4XKN A;  1AH5 A;  4IY6 A;  3VFJ A;  1MH4 A;  3T0J A;  5I56 A;  1RYX A;  3B50 A;  1SYH A; 
#chains in the Genus database with same CATH homology
 4PFB A;  4YIC A;  4PF6 A;  1FBG A;  3KBZ A;  4YZZ A;  1NV3 A;  3W9W A;  4I40 A;  4GWS A;  1FPF A;  2L5V A;  2HXR A;  5IGA A;  4JVD A;  2BJI A;  4MNP A;  2Q74 A;  3MYU A;  2XXK A;  4F1V A;  1FJ9 A;  4N8G A;  1KA1 A;  1LBY A;  5J1D A;  1FPL A;  2VPN A;  2XWI A;  4P3L A;  2WEF A;  4PFI A;  4GBV A;  2QFL A;  4OVT A;  3D1R A;  4NGU A;  1QGX A;  4UAB A;  4P9K A;  2XWK A;  4GWY A;  1EYJ A;  4H45 A;  4MX6 A;  2F3D A;  4GWX A;  4PAF A;  4QXD A;  3RPL B;  1FPD A;  2Y5K A;  4PFR A;  1FBD A;  4MMP A;  4NF0 A;  1IMF A;  1K9Y A;  4N4U A;  2CZH A;  4GWZ A;  2QPQ A;  4GWU A;  2P3V A;  4PAI A;  4HE1 A;  4OVQ A;  1IMB A;  1FPB A;  2R8T A;  1NV5 A;  2Y5L A;  4HCW A;  1FJ6 A;  4X04 A;  2QVR A;  3NOH A;  4O7I A;  4PAK A;  4N8Y A;  3LUZ A;  4NAP A;  3RPL A;  4PDH A;  1FBF A;  5ET5 A;  5IZ3 B;  1KZ8 A;  4PF8 A;  2QVV A;  3QMF A;  2XA5 A;  5I7I A;  4MNC A;  1FPK A;  1NI9 A;  4G61 A;  1FPE A;  1K9Z A;  4MAG A;  1EYI A;  4P8B A;  1DBZ A;  3B8B A;  1SPI A;  4NX1 A;  4HE0 A;  4HE2 A;  4NN3 A;  4AS4 A;  4F18 A;  3PTY A;  3U65 A;  3EKI A;  4MCO A;  5IZ3 A;  5T3J A;  5I3S A;  5A5L A;  4MJO A;  4MEV A;  4X8R A;  3IFC A;  2Q9T A;  1NV4 A;  4PTK A;  2OX3 A;  5JK4 A;  2PFZ A;  3A29 A;  1NV1 A;  3IFA A;  5IM2 A;  4M1V A;  2XWV A;  2HZK A;  2CEY A;  4MIJ A;  4O8M A;  1NUX A;  2VT5 A;  1KA0 A;  1D9Q A;  4N6D A;  1YXI A;  5EQA A;  1RDZ A;  2B4M A;  2B4L A;  1YZ0 A;  1FBP A;  4PET A;  5J16 A;  3MST A;  4AS5 A;  5ET6 A;  2CZI A;  1DK4 A;  2WYK A;  2FVZ A;  2XWO A;  1RDX A;  1VDW A;  4QBA A;  1G0H A;  2VPO A;  5CM6 A;  4NHB A;  3CHG A;  1IMA A;  2FIE A;  1DCU A;  1FRP A;  5F24 A;  1YYZ A;  1NUZ A;  3BIG A;  2CEX A;  4OA4 A;  3SZP A;  1LBX A;  1BK4 A;  1AWB A;  2ZZX A;  2HHM A;  5I5P A;  4F1U A;  4N91 A;  4OVS A;  2OWZ A;  4MHF A;  2CZK A;  5LTC A;  4HCY A;  1RDY A;  4P1E A;  4P47 A;  5FBP A;  2PCR A;  4XF5 A;  4FBP A;  2V3Q A;  1IMC A;  4MNI A;  1FBH A;  4XFE A;  4IR8 A;  4PE3 A;  4DI4 B;  4KXP A;  4X9T A;  2DE2 A;  2FIX A;  2FBP A;  2ZZW A;  1IME A;  3ISP A;  4I3E A;  4P56 A;  1NV7 A;  1FPG A;  4PDD A;  2Q8M A;  3ROJ A;  5ESY A;  2QVU A;  2P3N A;  1XI6 A;  4GBW A;  5EQ9 A;  3FBP A;  1NV6 A;  5EQ8 A;  2PFY A;  1Q9D A;  5EYG A;  2HZL A;  1INP A;  1CNQ A;  2WX9 A;  5EYH A;  4PC9 A;  4OAN A;  4DI3 D;  4GX6 A;  1FTA A;  3RYD A;  2ZZV A;  1FSA A;  4P1L A;  4XEQ A;  3W9V A;  2KR0 A;  1FBE A;  4PCD A;  2JJK A;  4NQ8 A;  2FHY A;  2F5X A;  4O94 A;  4N17 A;  5ET7 A;  2WBD A;  1IMD A;  2WBB A;  3HFU A;  4PBQ A;  1NV2 A;  4JVI A;  2GQ1 A;  4GWW A;  2DE4 A;  3E78 A;  4N81 A;  4HXV A;  4N6K A;  3BIH A;  2HPG A;  4N15 A;  5IZ1 A;  2V4C A;  1JP4 A;  4PBH A;  4OVR A;  4O7M A;  2DE3 A;  4NG7 A;  1NUW A;  5ET8 A;  4GX3 A;  3T1B A;  4F19 A;  2DDK A;  3KC0 A;  4JVC A;  1FBC A;  1LBW A;  1LEV A;  3LV0 A;  4I3Y A;  1LBZ A;  2KQZ A;  1EYK A;  2WYP A;  3KC1 A;  4GX4 A;  5DW8 A;  5LDZ A;  2MKZ A;  1LBV A;  1NUY A;  3GYY A;  4PGN A;  2DVZ A;  1G0I A;  1FPJ A;  4OVP A;  3FXB A;  4LN5 A;  4H46 A;  3T0J A;  4PGP A;  3E79 A;  5EQ7 A;  5IZZ A;  3B50 A;  1NV0 A;  2F3B A;  1FPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...