3KC1A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 19a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 97
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc1A02
2QVUA 2QVVA 2FBPA 4GWUA 4GWSA 3BIGA 3BIHA 1Q9DA 4GWWA 1NV2A 5EQ9A 4O7IA 1LBVA 4H46A 1LBZA 2Y5KA 1FPDA 1FTAA 1FBFA 1IMCA 1LEVA 3RPLB 4FBPA 3QMFA 1NV4A 4PTKA 1IMBA 4HE2A 1IMDA 1NV0A 1RDZA 5T3JA 1FPKA 3A29A 3RYDA 5ET6A 1NV5A 3IFAA 1INPA 4I3YA 2F3DA 1IMEA 3KC0A 1JP4A 1EYIA 1NV7A 2WBDA 1FSAA 2Q74A 1CNQA 4GX6A 2WEFA 1RDXA 1IMAA 1D9QA 5IZ3A 5ET8A 5ET7A 1AWBA 1FJ9A 2P3NA 2QFLA 2WBBA 1NUWA 2OX3A 4HE1A 2FIEA 5EQ7A 4AS4A 1KA1A 3IFCA 1IMFA 1NUZA 1YZ0A 1KA0A 3T0JA 2R8TA 3LUZA 1LBWA 2BJIA 4QXDA 5I3SA 5EYHA 2F3BA 1NV6A 1NUYA 5LDZA 2JJKA 5FBPA 1KZ8A 4HE0A 4I40A 1G0HA 1FBHA 1FBCA 2FIXA 4GBWA 2Q8MA 1LBXA 2OWZA 1DBZA 2PCRA 2CZKA 4G61A 1FBPA 1XI6A 3B8BA 1VDWA 1FJ6A 1K9ZA 1NV3A 1SPIA 1FPGA 1FPFA 1FPIA 4KXPA 1LBYA 1DK4A 1G0IA 4GX4A 2VT5A 5J16A 1FBEA 1DCUA 3LV0A 1FPBA 5EQ8A 1RDYA 3KBZA 3ROJA 5IZ1A 3KC1A 1YYZA 1BK4A 4GWZA 4AS5A 5ESYA 1K9YA 1FBGA 1FBDA 4GX3A 2CZIA 5ET5A 4GBVA 5EYGA 4HXVA 1FPEA 2FVZA 4N81A 5F24A 4GWXA 4GWYA 4H45A 4I3EA 5A5LA 1NV1A 2P3VA 1NUXA 2HHMA 2GQ1A 2CZHA 1YXIA 1EYJA 2FHYA 2QVRA 3RPLA 1EYKA 2Y5LA 1NI9A 1FRPA 5IZ3B 3FBPA 4MJOA 3D1RA 1FPLA 5EQAA 2DDKA 1FPJA 1QGXA 4IR8A 5DW8A
chains in the Genus database with same CATH superfamily
2QVUA 3N6TA 2XWIA 3KSJA 3ZSFA 5B7DA 3RT6B 3CG1A 1IMBA 3E13X 1SBPA 1UIVA 2KR0A 4OA4A 4EQ9A 1NV5A 4RK2A 4I1DA 2VOZA 2ZYMA 2AL5A 2Q89A 1IMAA 5IZ3A 1F9BA 1N3WA 3SKPA 3H4ZA 4H5FA 1UTBA 3LSLA 1MXYA 2H99A 5AA1A 3SEVA 4JXIA 1N7XA 2F36A 4ZE8A 3I3VA 3MVWA 4WEPA 1Q1KA 4DI3D 3DP4A 1DOTA 2OWZA 1JW5A 3USDA 5CC2A 1QUIA 4YAHX 1ZMGA 3CR9A 1DK4A 5A5XA 2DE3A 5M2VA 5DVIA 5IZ1A 4JVCA 3AXFA 2XXPA 1B3GA 2O69A 2XXTA 5KDTB 4KYDA 4GL8A 3VFJA 3RTFB 1QW0A 1HSEA 4GWXA 4H1XA 1PB8A 4H45A 4U1OA 4X8RA 4FECA 2ZYNA 4PFRA 4FJPA 2CZHA 3TTRA 1UTHB 1Z7NE 3QSLA 2DSFA 2I3VA 1H45A 3T93B 3OSQA 4IR8A 1ZJLA 2HPGA 1AIVA 3KOTA 4QRZA 1HSJA 5HM4B 4O8MA 4ZDMA 4N13A 1US4A 2XXIA 3KC0A 4PETA 5TU0A 4RA1A 2AIXA 4RYAA 3MZBA 4N8YA 3BFTA 2QSXA 1QJMA 3TDJA 3PU5A 1BIYA 1AWBA 2DOJA 4OEUA 3KN8A 1BLFA 3W15C 3IO4A 1MH4A 4AS4A 1JVXA 4I62A 2REGA 1KA0A 1J1NA 1XVYA 4H6DA 4HE0A 1JQFA 3H03A 5IM2A 1MXZA 5KCJA 4R73A 3VVEA 2XXRA 1B7ZA 1K9ZA 3K6WA 4XEQA 3KZGA 1ANFA 1SQYA 2UYEA 3IOUA 3RGYA 4NWCA 5EQ8A 2DE2A 1S7YA 4OFJA 5IZZA 2G29A 3FASA 1D3KA 2NOOA 5H8FB 3RNNA 5EHSA 3CFLA 2UVJA 3E79A 1FPJA 2OLBA 3H7MA 1A7LA 1SW4A 4KYEA 2RCAA 3OO8A 2I0CA 3U1OA 4ELOA 1S50A 3OO9A 1RKMA 3PUWE 5TP9A 3WAEA 3QXMA 3ZKKA 3O2AA 1NV4A 2IEEA 1A40A 1FPKA 4YB7A 4IY5A 3G3JA 4MFIA 3U65A 3IR1A 3K1MA 2ZXTA 3JV9A 1B6HA 3T9VA 3DP6A 4ZE9A 1P1NA 1NUWA 3P7IA 2Y7RA 1LFHA 4DLDA 1UIUA 4KHZE 4ISUA 5CM6A 3GXAA 4PFBA 1ATGA 4FIMA 4PDHA 5CBSA 3V89B 1H43A 2VPNA 3PUYE 1QUJA 2QS4A 4KPTA 1AL3A 1B5JA 1ELJA 4E0WA 1IEJA 1RYOA 3HHFA 1FTMA 2OCUA 3K1NA 1URSA 4PE5B 1FQBA 1FBEA 3RLFE 3E3KA 4KYSA 3OXNA 4IY6A 5EYGA 1TWYA 1IXCA 5I2KB 4N81A 3VXBA 3D4CA 1DTGA 3TKDA 2ALUA 3E9XA 1US5A 3T96B 1EYJA 1IITA 2XXXA 1FQEA 1FPLA 4P9KA 4FORA 3C32A 1NNTA 2FBPA 4GWSA 4OVSA 1OMPA 3MZ9A 2X26A 2HAUA 3HSTA 5IKBA 4JDFA 3THIA 4G68C 4MLVA 1NMUA 2ZNTA 4AB6A 4F1YA 2HCAA 1AMFA 3W9VA 2XX9A 3PD8A 4NF4B 2H25A 1LCTA 2I49A 2FIEA 5EQ7A 4MF3A 4N91A 1Y9UA 4QFNA 5I59A 1LBWA 3FUZA 4MEVA 1SW5A 1ZIUA 3MWBA 4R72A 3C36A 4I40A 2XWVA 2O84X 4ELQA 4RK9A 3M8UA 2Q8MA 1N0TA 1DBZA 5TPAB 3B8BA 3CSGA 3PTYA 1NV3A 4N8GA 4OESA 1EZ9A 2DE4A 1B05A 3S9MC 2V3UA 5AA4A 1YCJA 4QSCA 1FBGA 3IAZA 3MVYA 4UA8A 3WAFA 2HAVA 1NL5A 2F5XA 3TTLA 5DTBA 4OVJA 3B6WA 2DWAA 5IZ3B 3B50A 4YKPA 5IAIA 2ANJA 3CIJA 4GQOA 3RQTA 4XKRA 1MM6A 2F8DA 3Q27A 4C0RA 1IXHA 5CI5A 5EQ9A 2RF1A 4G68B 3SDFA 4O7IA 3T9HB 2DP8A 3O9PA 4PFUA 3OOAA 4OFOA 1IMDA 3EHSA 1B5IA 2F6GA 3IJOB 4QSEA 2DWHA 4EF2A 4KFQA 4Q0CA 4POXA 4YB5A 1XOCA 4NF6A 3SERA 1KWHA 2I0BA 4GD5A 1I6QA 3IFCA 1B5HA 2F97A 1FTJA 3GZGA 3PUZE 2QMXA 3U72A 4GF8A 3TCGA 1IXGA 1VSOA 5FBPA 5AA2A 3R26A 4NMYA 3Q26A 4GBWA 4KCCA 4PGPA 1XI6A 1XHYA 4JWOA 2V4CA 1SPIA 4MLQA 4U4XA 1DTZA 5HPQA 5I2KA 4XXUA 2ONRA 1UTBB 3CFZA 4JVIA 2F6PA 4ZS9A 4H8IA 4GWZA 4FEBA 4P8BA 2FVZA 2XXQA 3B6QA 4GWYA 5F1QA 3IO6A 3T9XB 3MP1A 5EHMA 2HHMA 2CEXA 4POWA 5JEIA 5H8NA 2KQZA 2Q8JA 3MVZA 4FAJA 4MH5A 3MAMA 1PC3A 5FHNA 4GWUA 3OELA 1EH3A 1LAXA 4KD5A 1FBFA 4GXSB 1XC1A 4RPNA 3RPLB 2P1SA 1B51A 1NV0A 1Q35A 3TTMA 2I48A 4XF5A 3IB2A 2WBDA 5DEXA 1SYHA 4BLAA 2DS9A 3G3KA 1SI0A 3DLNA 3OO7A 2Y84A 3NOHA 4MAGA 4F29A 2P3NA 3UIFA 4F2QA 2QS1A 2PT2A 5DT6A 4KQPA 2PBWA 3OD7A 3QIMA 3LUZA 1N84A 2YLNA 2BJIA 4IO3A 2F78A 1MH3A 1NNFA 4BDQA 2V84A 2XXUA 4NF6B 3U94A 2RCBA 1MQDA 3S9LC 3PMWA 1FBCA 4P11A 5IGAA 2PFZA 1FPGA 1BP5A 4MNCA 5CMMA 1MS7A 3FXUA 2YPNA 1JEVA 3KC1A 4R2FA 2Y7PA 4G8NA 2Q88A 1SI1A 3PMVA 3K2DA 4DXBA 4EUOA 4C1UA 1OQGA 1A8EA 3FGSA 3RY3A 3FXBA 5DVJA 3PMXA 2RINA 4X04A 2B3FA 2H9BA 1FRPA 5K2YA 4F22A 2I6EA 2I4BA 2A5TB 5ISUA 1P99A 2XXWA 3H6TA 2DYXA 2RKMA 4OERA 2H98A 4ND9A 4NF5A 1YPNA 4IO2A 1II5A 1FW0A 4GIZA 1RDZA 4O94A 4QFOA 1R6ZA 5ET6A 3O97A 4IO5A 2F3DA 2REJA 3LBSA 1H44A 4PF6A 1JW1A 4ZEBA 5K2XA 5ET8A 2DQVA 2HZKA 1B40A 2OZZA 4E0XA 2F7AA 2ESNA 2NVUB 2Y7IA 4NTLA 5DYHA 1URGA 2ABHA 1OLCA 4JB7A 4GFRA 4DE8A 3IB1A 5ITOA 3T66A 3T9UA 3FVOA 4BDLA 2NUVA 2XWKA 4DIGA 1NNPA 5H8HB 4H0WA 3OMBA 4YICA 4DXCA 4O3CA 1SDXA 5CMKA 1XT8A 2Q2AA 5J16A 4H67A 4QF9A 4PFTA 4AB5A 3ROJA 4PBHA 1RDYA 3OO6A 3S4UA 2OJTA 2PX1A 1SW2A 4OVTA 4P56A 2XD3A 1B3HA 3MP6A 1B3EA 2X7PA 1FBDA 2ZNUA 2XA5A 4BDOA 3FVNA 3KEIA 3TFLA 4PQJA 3O66A 4I3EA 1TT1A 1MM7A 2YJPA 2Z22A 2AYSA 2ZZWA 3U93A 5I2NA 3LSXA 4F18A 5H8QB 2ZZVA 2Y5LA 1NNKA 1EZPA 2DDKA 1JNFA 4KI0E 5L9SA 1P1WA 4H65A 5F7VA 3VV5A 1Q9DA 4R75A 4XFEA 3VXCA 5I59B 1Y4CA 4OZ9A 3HPIA 4GL0A 3A09A 1M5EA 4PTKA 2O68A 2M8CA 3OSRA 4JWXA 4ZEKA 1BTJA 1MY3A 2F34A 1JP4A 4F1VA 3MUQA 4YKJA 1A55A 2VHAA 4R9FA 4XKPA 5AA3A 1D9QA 3N26A 4ELRA 1Y1ZA 5ITPA 4LONB 2XHDA 4NX1A 4H5GA 4YKKA 1NUZA 2OPEA 2R8TA 1B58A 4RPOA 1OIBA 1NUYA 4P3LA 1N3XA 1P1UA 5CRYA 4XTCQ 1LAGE 4IB2A 3T1BA 1MDQA 2RC8A 4I9DA 4F3BA 3DM0A 2XXHA 2E0SA 1VFEA 3VVFA 4TQUQ 1O63A 3O28A 3KJ7A 4GOTA 4NF4A 4PAKA 2AL4A 2QMWA 4IO6A 5JK4A 3FXRA 3R7XA 3TTKA 5I56A 1OLAA 4KR5A 4X1BA 2CZIA 5ET5A 5F24A 1MY1A 4OFLA 3C33A 3UORA 3PPPA 4OXVA 3M3KA 3H6VA 1GV8A 4OETA 3KSXA 3BFUA 2B3BA 3D1RA 3BBRA 1QGXA 3KFMA 3KGCA 3I6VA 1EU8A 1VFDA 4WKMA 5L8DA 4ESWA 3T22A 1FPDA 4NEDA 4OENA 3UA8A 3O29A 4NF0A 5KDTA 4GWOA 3ILUB 3RYDA 3E78A 4I3YA 1M5FA 2G93A 1EYIA 2I4CA 4X48A 3MQ9A 4ZEIA 4F39A 3UN6A 2ZMBA 5ET7A 1A99A 4MHFA 2QFLA 1MY2A 2BJJX 5HBCA 4F3GA 4PDDA 1GGGA 4ECFA 4PAIA 2OPDA 1LB8A 4FATA 3SESA 4Q5TA 3GYYA 3LSWA 2F35A 1S9TA 3FV2A 4NN3A 1R9LA 2MKZA 1G0IA 1FQAA 3VLVA 4N6DA 4OVPA 4OWDA 2PT1A 4AS5A 1LAFE 2FYIA 4O3BA 5L9MA 1H76A 1PDAA 4PP0A 4DXUA 1IUDA 1B46A 4HCWA 1OVTA 1UQWA 4G4PA 3K01A 1WODA 4NHBA 3O6IA 2O7UA 3U92A 1MPDA 5AA2D 3KN3A 1MPBA 1LGBC 3CSBA 3RT8A 3CI8A 1LLSA 3IOTA 2B4MA 2Z8FA 1T0KA 2FNCA 2RC7A 2H5YA 4X1DA 1JW4A 3IL1B 4H8JA 3QMFA 4OYVA 4EQ7A 4PAFA 3FJMA 2GRVA 4R6YA 3G7WA 2QL3A 1B3LA 4IO4A 2Q74A 1CNQA 3GBAA 3EF7A 2QJEA 2L5VA 5H8NB 3V8XB 3L6GA 2O1LA 1FCKA 4HE1A 4ZZEA 4MIJA 4NF8B 3SEXA 1Z7ME 3Q28A 4PFWA 3MSTA 4HTGA 1YZ0A 1MPCA 3MPKA 4QXDA 1DSNA 3MC2A 4EXLA 2ZYKA 3CFXA 4WEDA 1NV6A 4JWYA 1KZ8A 4YMAA 3FVGA 2O6AA 5I56B 1SVXB 4R2BA 4LP2B 1PBQA 1PB9A 3VDFA 1Y4TA 3HN0A 3B7DA 1FPIA 5DEXB 2QPQA 1LBYA 4QBAA 2RC9A 3MJNA 4QFLA 1LB9A 3JZJA 4U22A 4DDDA 1DCUA 1JVYA 3IORA 3KBZA 1B7UA 2XXVA 4QFKA 4F31B 1BK4A 1URDA 5CBRA 1NKXA 2WX9A 3F11A 2QS3A 3HCQA 3MPLA 3EN3A 2O1MA 4IO7A 2R9JA 2NWJA 4WXJA 2ONSA 1ZTYA 5AA4B 3TQLA 4U21A 2OK2A 5AE4A 2ZYOA 2FHYA 1LBBA 1D9VA 5I57A 2XWOA 1B4HA 4DZ1A 3UGWA 3IK6B 1N04A 5ICTA 3CRBA 2IA4A 1MQJA 1LBVA 4MNIA 4OVQA 4MCOA 3TPAA 3B6TA 3SZPA 4M1VA 5I84A 3IFAA 5I58A 4N07A 1NV7A 3A3CA 4OHNA 5ELVA 4LVQA 2D21A 1POTA 2O7IA 1BKAA 4LUBA 2UVIA 2THIA 4OEVA 3FIRA 1ZLQA 1WDNA 4PE3A 4MX6A 5EYHA 4LATA 3S9EA 2JJKA 2QS2A 2W7YA 1N76A 4LA9A 5I2NB 1LBXA 3K6VA 3SEUA 3N94A 4RNSA 4UABA 1TFAA 4GVOA 1FTLA 5DVFA 1UTHA 3FZVA 3O6HA 3HHGA 4GX3A 4G2ZA 4O7MA 2ZNSA 1QKAA 5I58B 3PPNA 4P47A 1M5CA 4ZEDA 3S9NC 2XXKA 5L9OA 4OANA 4BDMA 2QVRA 1EYKA 2WYPA 4Q30B 3DELB 1DPPA 1Y1MA 2GHAA 4GWWA 4TOZA 4LZ7A 2E1SA 1DPEA 1PB7A 1B0LA 3SEWA 5T3JA 3GBBA 4YB6A 3EKIA 3KOSA 4KCDA 3IOWA 3VLWA 2Q9TA 4GX6A 4EQBA 3CHGA 1Y20A 2VGQA 5FHOA 1B1HA 5TP9B 3U8QA 1PEBA 3QK6A 1FJ9A 2F7BA 5KCJB 3K1PA 3QUFA 3FV1A 4P0GA 4PBQA 1KA1A 3FJGA 3PUVE 2Q2CA 3KN7A 4JSOA 4TLMB 4U1ZA 3TODA 1IIWA 3M3FA 2PFYA 3TUSA 4PF8A 1H3DA 1FJ6A 3TAJA 3BKIB 1P1QA 1IQ7A 4EXKA 3CVGA 2X7QA 4F1UA 2HFBA 3KG2A 1L5TA 2R6GE 4ONYA 1MRPA 2WKYA 3S2VA 1FPEA 3PGFA 4TLLB 2HXRA 5A5LA 3LSFB 3PD9A 2P3VA 1NFTA 2A5SA 2GQ1A 2I3WA 2PVUA 4UACA 4FEDA 1YXIA 4DI4B 3LR1A 2XD2A 3RPLA 1OVBA 4LN5A 5EQAA 3C9HA 1QVSA 5DW8A 3MBPA 2QVVA 3BIHA 4MBPA 1SD3A 4Z7EA 1LBZA 4JBZA 1GR2A 1XVXA 2VD2A 3C34A 2WYKA 4LZ5A 4PCDA 1FQDA 3OENA 5TPAA 2XX8A 3G3GA 3MW0A 2V3TA 3MVXA 4C1TA 3HFUA 1B32A 1POY1 1ZBMA 4PC9A 2UYFA 3HV1A 2D5WA 4GXAA 4P0IA 2F3BA 2DWJA 3TQWA 3VLUA 1B0HA 2CZLA 1FBHA 3RTWB 5FHMA 2PCRA 1QUKA 3QYTA 1FBPA 3FJ7A 4DCYA 4RY1A 4RXLA 4QSDA 4I8CA 4XKNA 2Y7WA 4NGUA 1D4NA 3N6UA 2LAOA 4HW8A 3UP9A 2HEUA 1YYZA 5LTCA 2DVCA 1P1OA 4R6KA 1K9YA 3R6UA 2DWIA 1MXUA 3D4GA 4HCYA 4HXVA 1MXVA 1TXFA 2CEYA 3VE1B 1MQIA 2CMOA 4LZ8A 4NWDA 2ONKE 1MY0A 3MZ1A 4N4UA 3KBRA 1MG1A 1MXWA 4N15A 4U2RA 1Y3PA 5BUUA 1A54A 4N17A 2H4IA 2Z8EA 3EQ1A 2V93A 1LBCA 3IOVA 1PBPA 4IGRA 1CE2A 4BDRA 4EF1A 3RUMA 1SW1A 3QUJA 1MQGA 1JETA 3PUXE 3JYRA 2V3QA 4FBPA 4FE8A 1QULA 2KLFA 5AA2B 4HE2A 1GVCA 3PPRA 1YAEA 1B3FA 3H6UA 4YU0A 4N6KA 1MDP1 4XKQA 1RDXA 3A3UA 4THIA 3EPEA 3Q29A 2PMSA 2D3IA 3K0VA 3L6HA 4P1EA 2OX3A 2A5TA 4DCXA 3T0JA 4ZZAA 3PPOA 3H6WA 2HZLA 1VE4A 4GRKA 1B52A 5LDZA 3FVKA 4R74A 3G3HA 4LQ2A 3FD3A 4YMBA 2F7CA 2CZKA 3K00A 1I69A 4QFPA 2V25A 1RYXA 3TZAA 4KXPA 3IB0A 3RN8A 4GX4A 3C4MA 1MY4A 1VR5A 3M3LA 1FPBA 1O64A 2OWTA 2HQ0A 5JTYA 4F3SA 1EZOA 2R71A 3OEMA 5CMCA 5J1DA 4NF8A 5ESYA 3SEYA 2Z23A 1AOVA 1N7WA 4YZZA 1LFIA 1HSLA 3W9WA 3N5LA 4OMBA 2GH9A 3ODBA 1FTKA 1LSTA 4EDPA 4YKIA 3TYHA 4OQOA 1FTOA 4MJOA 2Z8DA 3DP8A 1IZ1A 1ZU0A 2Y7KA 3PV0E 4NG7A 4L17A 2XXYA 1A8FA 1USYE 2Y5KA 3K02A 3PPQA 3QAXA 2QRYA 1YTVA 4O3AA 5FTHA 4P1LA 4G8MA 1XS5A 3GLBA 3A29A 4F2OA 4ELPA 1IMEA 1B2HA 3FXQA 1R9QA 2VP1A 2I58A 4PFIA 1FSAA 3ZS6A 1GTKA 4U23A 3ILTB 3CG3A 4Q8RA 2P2AA 4NAPA 5H8QA 4G8HA 5H8FA 3TMGA 5I57B 5KZTA 2GFEA 3MYUA 2OWSA 1M5DA 4G77A 4AQ4A 4QHQA 2HXWA 5EYFA 3LUYA 3E4RA 1G0HA 3V83A 3KJTA 3ISPA 5LOMA 1I6AA 3TEPA 5BWJA 1LCFA 1FPFA 5ICQA 3ECRA 3H06B 1NH7A 1ZKBA 2PYYA 2XX7A 2DXRA 5I5PA 4F3PA 3LV0A 4R9GA 1B9JA 1B1XA 1QKBA 2P0SA 4Z0IA 3RPWA 1R1NA 4NE4A 3I5OA 4ESXA 1LFGA 5B70A 1NV1A 3UK4A 4GLIA 1NUXA 4HS7A 5I7IA 5JTYB 1FQCA 5H8SA 3G3IA 3TTNA 1CB6A 1B4ZA 3FBPA 2DVZA 1TFDA 3Q25A 2OBGA 2VD3A 4ZECA 3V5AA 3BIGA 1D9YA 4XIGQ 3TCHA 1NV2A 3K6UA 1AH5A 4H46A 1FTAA 4MNPA 1IMCA 3C35A 1LEVA 4NQ8A 1B7HA 4U4SA 5H8HA 3K4UA 4RJZA 1INPA 3ZKLA 2UVHA 4N6PA 3ONMA 1OQHA 1MXXA 1NH8A 4NF5B 2WEFA 4ZEFA 1SYIA 4LQ5A 3VVDA 2WBBA 4OVRA 2GHBA 4BDNA 1Y3NA 1IMFA 2UVGA 3IX1A 3H3GA 4F19A 5I3SA 2VPOA 3FATA 4OTEA 5A5XB 1USYH 2B4LA 2NXOA 3OEKA 1LAHE 5CMBA 2FIXA 1JEUA 4G61A 1DMBA 4JVDA 4MMPA 1O7TA 1VDWA 3MP8A 2FA7A 1MQHA 4K3FA 3IJXB 2VT5A 3HO7A 1Y3QA 4G68A 3K6XA 3G3FA 4PGNA 4IGTA 3C31A 2O51A 4PFYA 4GBVA 3SETA 4R6HA 1FQFA 3O6GA 3EHTA 3TELA 1WVJA 1M5BA 3LC8A 4X9TA 3TCFA 3EHUA 1NI9A 2B65A 4M4GA 5FTIA 2DXYA 4JSDA 1IXIA 2UXAA 1I6BA 2ZZXA
chains in the Genus database with same CATH topology
2QVUA 2HPGA 2QVVA 4NG7A 2FBPA 4GWUA 4GWSA 3BIGA 3BIHA 1Q9DA 4GWWA 2B4MA 4XFEA 1NV2A 5EQ9A 4OVSA 4O7IA 1LBVA 4MNIA 4H46A 1LBZA 2Y5KA 2XWIA 1FPDA 1FTAA 1FBFA 4MCOA 4MNPA 4OVQA 1IMCA 1LEVA 2V3QA 3RPLB 4FBPA 3QMFA 4NF0A 4NQ8A 2WYKA 1NV4A 4O8MA 4PTKA 1IMBA 4P1LA 4PCDA 4HE2A 1IMDA 4PAFA 3SZPA 2KR0A 4M1VA 1NV0A 1RDZA 5T3JA 4O94A 4OA4A 1FPKA 5JK4A 3A29A 3RYDA 3E78A 5ET6A 1NV5A 3IFAA 1INPA 4I3YA 4XF5A 2F3DA 1IMEA 3KC0A 1JP4A 1EYIA 1NV7A 2WBDA 4N6KA 4PETA 4F1VA 3EKIA 4PFIA 1FSAA 3U65A 2Q74A 1CNQA 4GX6A 2Q9TA 3B50A 4N8YA 4PF6A 2WEFA 1RDXA 4X04A 3CHGA 3HFUA 2L5VA 1IMAA 4NAPA 1D9QA 5IZ3A 3W9VA 5ET8A 3NOHA 5ET7A 4MAGA 1AWBA 2HZKA 4MHFA 1FJ9A 2P3NA 2QFLA 2WBBA 4NX1A 4P1EA 4PC9A 1NUWA 4PBQA 2OX3A 4HE1A 3MYUA 2FIEA 5EQ7A 4AS4A 4MIJA 1KA1A 4OVRA 3MSTA 3IFCA 1IMFA 1NUZA 1YZ0A 4N91A 4PDDA 1KA0A 3T0JA 2R8TA 3LUZA 2HZLA 1LBWA 2BJIA 4QXDA 5I3SA 2VPOA 4MEVA 4PAIA 4F19A 4PE3A 4DI3D 5CM6A 4MX6A 5EYHA 3GYYA 2F3BA 1NV6A 1NUYA 5LDZA 2JJKA 5FBPA 4P3LA 1KZ8A 4HE0A 4I40A 1G0HA 2B4LA 2XWVA 4PDHA 4PFBA 1FBHA 2PFYA 5IM2A 3ISPA 1FBCA 2FIXA 4GBWA 2Q8MA 1LBXA 2VPNA 2XWKA 2OWZA 1DBZA 2PCRA 2CZKA 4G61A 1FBPA 1XI6A 4JVDA 4MMPA 4PF8A 3B8BA 2PFZA 1VDWA 1FJ6A 1K9ZA 3PTYA 1NV3A 4XEQA 4YICA 2V4CA 1SPIA 1FPGA 1FPFA 4MNCA 4N8GA 1FPIA 4KXPA 2QPQA 4NN3A 1LBYA 4QBAA 4UABA 2MKZA 1DK4A 1G0IA 4NGUA 4GX4A 2VT5A 5J16A 5I5PA 4N6DA 2DE3A 1FBEA 1DCUA 3LV0A 4OVPA 4PAKA 2DE4A 1FPBA 5EQ8A 1RDYA 3KBZA 3ROJA 5IZ1A 4JVIA 4JVCA 2DE2A 4PBHA 4F1UA 4OVTA 4P56A 4PGNA 3KC1A 1YYZA 5LTCA 1BK4A 5J1DA 4GWZA 2WX9A 4AS5A 5ESYA 1K9YA 4P8BA 5IZZA 1FBGA 1FBDA 4GX3A 2CZIA 4YZZA 5ET5A 4GBVA 5EYGA 4HCYA 4HXVA 4O7MA 1FPEA 2FVZA 2XA5A 4PGPA 4N81A 5F24A 3W9WA 4GWXA 2CEYA 2F5XA 4GWYA 2HXRA 2ZZVA 4H45A 4X8RA 4I3EA 5IGAA 5A5LA 1NV1A 2P3VA 4P47A 1NUXA 4PFRA 3FXBA 2HHMA 2XXKA 2GQ1A 2ZZWA 4HCWA 5I7IA 2CZHA 2CEXA 4N4UA 3T1BA 4X9TA 1YXIA 4OANA 4DI4B 1EYJA 4F18A 2FHYA 2QVRA 3RPLA 1EYKA 2Y5LA 1NI9A 1FRPA 5IZ3B 3FBPA 4MJOA 3D1RA 1FPLA 2DVZA 2KQZA 5EQAA 2WYPA 4LN5A 4N15A 4NHBA 4N17A 2DDKA 1FPJA 1QGXA 2XWOA 3E79A 4P9KA 4IR8A 5DW8A 2ZZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVU A;  2QVV A;  2FBP A;  4GWU A;  4GWS A;  3BIG A;  3BIH A;  1Q9D A;  4GWW A;  1NV2 A;  5EQ9 A;  4O7I A;  1LBV A;  4H46 A;  1LBZ A;  2Y5K A;  1FPD A;  1FTA A;  1FBF A;  1IMC A;  1LEV A;  3RPL B;  4FBP A;  3QMF A;  1NV4 A;  4PTK A;  1IMB A;  4HE2 A;  1IMD A;  1NV0 A;  1RDZ A;  5T3J A;  1FPK A;  3A29 A;  3RYD A;  5ET6 A;  1NV5 A;  3IFA A;  1INP A;  4I3Y A;  2F3D A;  1IME A;  3KC0 A;  1JP4 A;  1EYI A;  1NV7 A;  2WBD A;  1FSA A;  2Q74 A;  1CNQ A;  4GX6 A;  2WEF A;  1RDX A;  1IMA A;  1D9Q A;  5IZ3 A;  5ET8 A;  5ET7 A;  1AWB A;  1FJ9 A;  2P3N A;  2QFL A;  2WBB A;  1NUW A;  2OX3 A;  4HE1 A;  2FIE A;  5EQ7 A;  4AS4 A;  1KA1 A;  3IFC A;  1IMF A;  1NUZ A;  1YZ0 A;  1KA0 A;  3T0J A;  2R8T A;  3LUZ A;  1LBW A;  2BJI A;  4QXD A;  5I3S A;  5EYH A;  2F3B A;  1NV6 A;  1NUY A;  5LDZ A;  2JJK A;  5FBP A;  1KZ8 A;  4HE0 A;  4I40 A;  1G0H A;  1FBH A;  1FBC A;  2FIX A;  4GBW A;  2Q8M A;  1LBX A;  2OWZ A;  1DBZ A;  2PCR A;  2CZK A;  4G61 A;  1FBP A;  1XI6 A;  3B8B A;  1VDW A;  1FJ6 A;  1K9Z A;  1NV3 A;  1SPI A;  1FPG A;  1FPF A;  1FPI A;  4KXP A;  1LBY A;  1DK4 A;  1G0I A;  4GX4 A;  2VT5 A;  5J16 A;  1FBE A;  1DCU A;  3LV0 A;  1FPB A;  5EQ8 A;  1RDY A;  3KBZ A;  3ROJ A;  5IZ1 A;  3KC1 A;  1YYZ A;  1BK4 A;  4GWZ A;  4AS5 A;  5ESY A;  1K9Y A;  1FBG A;  1FBD A;  4GX3 A;  2CZI A;  5ET5 A;  4GBV A;  5EYG A;  4HXV A;  1FPE A;  2FVZ A;  4N81 A;  5F24 A;  4GWX A;  4GWY A;  4H45 A;  4I3E A;  5A5L A;  1NV1 A;  2P3V A;  1NUX A;  2HHM A;  2GQ1 A;  2CZH A;  1YXI A;  1EYJ A;  2FHY A;  2QVR A;  3RPL A;  1EYK A;  2Y5L A;  1NI9 A;  1FRP A;  5IZ3 B;  3FBP A;  4MJO A;  3D1R A;  1FPL A;  5EQA A;  2DDK A;  1FPJ A;  1QGX A;  4IR8 A;  5DW8 A; 
#chains in the Genus database with same CATH topology
 2QVU A;  3N6T A;  2XWI A;  3KSJ A;  3ZSF A;  5B7D A;  3RT6 B;  3CG1 A;  1IMB A;  3E13 X;  1SBP A;  1UIV A;  2KR0 A;  4OA4 A;  4EQ9 A;  1NV5 A;  4RK2 A;  4I1D A;  2VOZ A;  2ZYM A;  2AL5 A;  2Q89 A;  1IMA A;  5IZ3 A;  1F9B A;  1N3W A;  3SKP A;  3H4Z A;  4H5F A;  1UTB A;  3LSL A;  1MXY A;  2H99 A;  5AA1 A;  3SEV A;  4JXI A;  1N7X A;  2F36 A;  4ZE8 A;  3I3V A;  3MVW A;  4WEP A;  1Q1K A;  4DI3 D;  3DP4 A;  1DOT A;  2OWZ A;  1JW5 A;  3USD A;  5CC2 A;  1QUI A;  4YAH X;  1ZMG A;  3CR9 A;  1DK4 A;  5A5X A;  2DE3 A;  5M2V A;  5DVI A;  5IZ1 A;  4JVC A;  3AXF A;  2XXP A;  1B3G A;  2O69 A;  2XXT A;  5KDT B;  4KYD A;  4GL8 A;  3VFJ A;  3RTF B;  1QW0 A;  1HSE A;  4GWX A;  4H1X A;  1PB8 A;  4H45 A;  4U1O A;  4X8R A;  4FEC A;  2ZYN A;  4PFR A;  4FJP A;  2CZH A;  3TTR A;  1UTH B;  1Z7N E;  3QSL A;  2DSF A;  2I3V A;  1H45 A;  3T93 B;  3OSQ A;  4IR8 A;  1ZJL A;  2HPG A;  1AIV A;  3KOT A;  4QRZ A;  1HSJ A;  5HM4 B;  4O8M A;  4ZDM A;  4N13 A;  1US4 A;  2XXI A;  3KC0 A;  4PET A;  5TU0 A;  4RA1 A;  2AIX A;  4RYA A;  3MZB A;  4N8Y A;  3BFT A;  2QSX A;  1QJM A;  3TDJ A;  3PU5 A;  1BIY A;  1AWB A;  2DOJ A;  4OEU A;  3KN8 A;  1BLF A;  3W15 C;  3IO4 A;  1MH4 A;  4AS4 A;  1JVX A;  4I62 A;  2REG A;  1KA0 A;  1J1N A;  1XVY A;  4H6D A;  4HE0 A;  1JQF A;  3H03 A;  5IM2 A;  1MXZ A;  5KCJ A;  4R73 A;  3VVE A;  2XXR A;  1B7Z A;  1K9Z A;  3K6W A;  4XEQ A;  3KZG A;  1ANF A;  1SQY A;  2UYE A;  3IOU A;  3RGY A;  4NWC A;  5EQ8 A;  2DE2 A;  1S7Y A;  4OFJ A;  5IZZ A;  2G29 A;  3FAS A;  1D3K A;  2NOO A;  5H8F B;  3RNN A;  5EHS A;  3CFL A;  2UVJ A;  3E79 A;  1FPJ A;  2OLB A;  3H7M A;  1A7L A;  1SW4 A;  4KYE A;  2RCA A;  3OO8 A;  2I0C A;  3U1O A;  4ELO A;  1S50 A;  3OO9 A;  1RKM A;  3PUW E;  5TP9 A;  3WAE A;  3QXM A;  3ZKK A;  3O2A A;  1NV4 A;  2IEE A;  1A40 A;  1FPK A;  4YB7 A;  4IY5 A;  3G3J A;  4MFI A;  3U65 A;  3IR1 A;  3K1M A;  2ZXT A;  3JV9 A;  1B6H A;  3T9V A;  3DP6 A;  4ZE9 A;  1P1N A;  1NUW A;  3P7I A;  2Y7R A;  1LFH A;  4DLD A;  1UIU A;  4KHZ E;  4ISU A;  5CM6 A;  3GXA A;  4PFB A;  1ATG A;  4FIM A;  4PDH A;  5CBS A;  3V89 B;  1H43 A;  2VPN A;  3PUY E;  1QUJ A;  2QS4 A;  4KPT A;  1AL3 A;  1B5J A;  1ELJ A;  4E0W A;  1IEJ A;  1RYO A;  3HHF A;  1FTM A;  2OCU A;  3K1N A;  1URS A;  4PE5 B;  1FQB A;  1FBE A;  3RLF E;  3E3K A;  4KYS A;  3OXN A;  4IY6 A;  5EYG A;  1TWY A;  1IXC A;  5I2K B;  4N81 A;  3VXB A;  3D4C A;  1DTG A;  3TKD A;  2ALU A;  3E9X A;  1US5 A;  3T96 B;  1EYJ A;  1IIT A;  2XXX A;  1FQE A;  1FPL A;  4P9K A;  4FOR A;  3C32 A;  1NNT A;  2FBP A;  4GWS A;  4OVS A;  1OMP A;  3MZ9 A;  2X26 A;  2HAU A;  3HST A;  5IKB A;  4JDF A;  3THI A;  4G68 C;  4MLV A;  1NMU A;  2ZNT A;  4AB6 A;  4F1Y A;  2HCA A;  1AMF A;  3W9V A;  2XX9 A;  3PD8 A;  4NF4 B;  2H25 A;  1LCT A;  2I49 A;  2FIE A;  5EQ7 A;  4MF3 A;  4N91 A;  1Y9U A;  4QFN A;  5I59 A;  1LBW A;  3FUZ A;  4MEV A;  1SW5 A;  1ZIU A;  3MWB A;  4R72 A;  3C36 A;  4I40 A;  2XWV A;  2O84 X;  4ELQ A;  4RK9 A;  3M8U A;  2Q8M A;  1N0T A;  1DBZ A;  5TPA B;  3B8B A;  3CSG A;  3PTY A;  1NV3 A;  4N8G A;  4OES A;  1EZ9 A;  2DE4 A;  1B05 A;  3S9M C;  2V3U A;  5AA4 A;  1YCJ A;  4QSC A;  1FBG A;  3IAZ A;  3MVY A;  4UA8 A;  3WAF A;  2HAV A;  1NL5 A;  2F5X A;  3TTL A;  5DTB A;  4OVJ A;  3B6W A;  2DWA A;  5IZ3 B;  3B50 A;  4YKP A;  5IAI A;  2ANJ A;  3CIJ A;  4GQO A;  3RQT A;  4XKR A;  1MM6 A;  2F8D A;  3Q27 A;  4C0R A;  1IXH A;  5CI5 A;  5EQ9 A;  2RF1 A;  4G68 B;  3SDF A;  4O7I A;  3T9H B;  2DP8 A;  3O9P A;  4PFU A;  3OOA A;  4OFO A;  1IMD A;  3EHS A;  1B5I A;  2F6G A;  3IJO B;  4QSE A;  2DWH A;  4EF2 A;  4KFQ A;  4Q0C A;  4POX A;  4YB5 A;  1XOC A;  4NF6 A;  3SER A;  1KWH A;  2I0B A;  4GD5 A;  1I6Q A;  3IFC A;  1B5H A;  2F97 A;  1FTJ A;  3GZG A;  3PUZ E;  2QMX A;  3U72 A;  4GF8 A;  3TCG A;  1IXG A;  1VSO A;  5FBP A;  5AA2 A;  3R26 A;  4NMY A;  3Q26 A;  4GBW A;  4KCC A;  4PGP A;  1XI6 A;  1XHY A;  4JWO A;  2V4C A;  1SPI A;  4MLQ A;  4U4X A;  1DTZ A;  5HPQ A;  5I2K A;  4XXU A;  2ONR A;  1UTB B;  3CFZ A;  4JVI A;  2F6P A;  4ZS9 A;  4H8I A;  4GWZ A;  4FEB A;  4P8B A;  2FVZ A;  2XXQ A;  3B6Q A;  4GWY A;  5F1Q A;  3IO6 A;  3T9X B;  3MP1 A;  5EHM A;  2HHM A;  2CEX A;  4POW A;  5JEI A;  5H8N A;  2KQZ A;  2Q8J A;  3MVZ A;  4FAJ A;  4MH5 A;  3MAM A;  1PC3 A;  5FHN A;  4GWU A;  3OEL A;  1EH3 A;  1LAX A;  4KD5 A;  1FBF A;  4GXS B;  1XC1 A;  4RPN A;  3RPL B;  2P1S A;  1B51 A;  1NV0 A;  1Q35 A;  3TTM A;  2I48 A;  4XF5 A;  3IB2 A;  2WBD A;  5DEX A;  1SYH A;  4BLA A;  2DS9 A;  3G3K A;  1SI0 A;  3DLN A;  3OO7 A;  2Y84 A;  3NOH A;  4MAG A;  4F29 A;  2P3N A;  3UIF A;  4F2Q A;  2QS1 A;  2PT2 A;  5DT6 A;  4KQP A;  2PBW A;  3OD7 A;  3QIM A;  3LUZ A;  1N84 A;  2YLN A;  2BJI A;  4IO3 A;  2F78 A;  1MH3 A;  1NNF A;  4BDQ A;  2V84 A;  2XXU A;  4NF6 B;  3U94 A;  2RCB A;  1MQD A;  3S9L C;  3PMW A;  1FBC A;  4P11 A;  5IGA A;  2PFZ A;  1FPG A;  1BP5 A;  4MNC A;  5CMM A;  1MS7 A;  3FXU A;  2YPN A;  1JEV A;  3KC1 A;  4R2F A;  2Y7P A;  4G8N A;  2Q88 A;  1SI1 A;  3PMV A;  3K2D A;  4DXB A;  4EUO A;  4C1U A;  1OQG A;  1A8E A;  3FGS A;  3RY3 A;  3FXB A;  5DVJ A;  3PMX A;  2RIN A;  4X04 A;  2B3F A;  2H9B A;  1FRP A;  5K2Y A;  4F22 A;  2I6E A;  2I4B A;  2A5T B;  5ISU A;  1P99 A;  2XXW A;  3H6T A;  2DYX A;  2RKM A;  4OER A;  2H98 A;  4ND9 A;  4NF5 A;  1YPN A;  4IO2 A;  1II5 A;  1FW0 A;  4GIZ A;  1RDZ A;  4O94 A;  4QFO A;  1R6Z A;  5ET6 A;  3O97 A;  4IO5 A;  2F3D A;  2REJ A;  3LBS A;  1H44 A;  4PF6 A;  1JW1 A;  4ZEB A;  5K2X A;  5ET8 A;  2DQV A;  2HZK A;  1B40 A;  2OZZ A;  4E0X A;  2F7A A;  2ESN A;  2NVU B;  2Y7I A;  4NTL A;  5DYH A;  1URG A;  2ABH A;  1OLC A;  4JB7 A;  4GFR A;  4DE8 A;  3IB1 A;  5ITO A;  3T66 A;  3T9U A;  3FVO A;  4BDL A;  2NUV A;  2XWK A;  4DIG A;  1NNP A;  5H8H B;  4H0W A;  3OMB A;  4YIC A;  4DXC A;  4O3C A;  1SDX A;  5CMK A;  1XT8 A;  2Q2A A;  5J16 A;  4H67 A;  4QF9 A;  4PFT A;  4AB5 A;  3ROJ A;  4PBH A;  1RDY A;  3OO6 A;  3S4U A;  2OJT A;  2PX1 A;  1SW2 A;  4OVT A;  4P56 A;  2XD3 A;  1B3H A;  3MP6 A;  1B3E A;  2X7P A;  1FBD A;  2ZNU A;  2XA5 A;  4BDO A;  3FVN A;  3KEI A;  3TFL A;  4PQJ A;  3O66 A;  4I3E A;  1TT1 A;  1MM7 A;  2YJP A;  2Z22 A;  2AYS A;  2ZZW A;  3U93 A;  5I2N A;  3LSX A;  4F18 A;  5H8Q B;  2ZZV A;  2Y5L A;  1NNK A;  1EZP A;  2DDK A;  1JNF A;  4KI0 E;  5L9S A;  1P1W A;  4H65 A;  5F7V A;  3VV5 A;  1Q9D A;  4R75 A;  4XFE A;  3VXC A;  5I59 B;  1Y4C A;  4OZ9 A;  3HPI A;  4GL0 A;  3A09 A;  1M5E A;  4PTK A;  2O68 A;  2M8C A;  3OSR A;  4JWX A;  4ZEK A;  1BTJ A;  1MY3 A;  2F34 A;  1JP4 A;  4F1V A;  3MUQ A;  4YKJ A;  1A55 A;  2VHA A;  4R9F A;  4XKP A;  5AA3 A;  1D9Q A;  3N26 A;  4ELR A;  1Y1Z A;  5ITP A;  4LON B;  2XHD A;  4NX1 A;  4H5G A;  4YKK A;  1NUZ A;  2OPE A;  2R8T A;  1B58 A;  4RPO A;  1OIB A;  1NUY A;  4P3L A;  1N3X A;  1P1U A;  5CRY A;  4XTC Q;  1LAG E;  4IB2 A;  3T1B A;  1MDQ A;  2RC8 A;  4I9D A;  4F3B A;  3DM0 A;  2XXH A;  2E0S A;  1VFE A;  3VVF A;  4TQU Q;  1O63 A;  3O28 A;  3KJ7 A;  4GOT A;  4NF4 A;  4PAK A;  2AL4 A;  2QMW A;  4IO6 A;  5JK4 A;  3FXR A;  3R7X A;  3TTK A;  5I56 A;  1OLA A;  4KR5 A;  4X1B A;  2CZI A;  5ET5 A;  5F24 A;  1MY1 A;  4OFL A;  3C33 A;  3UOR A;  3PPP A;  4OXV A;  3M3K A;  3H6V A;  1GV8 A;  4OET A;  3KSX A;  3BFU A;  2B3B A;  3D1R A;  3BBR A;  1QGX A;  3KFM A;  3KGC A;  3I6V A;  1EU8 A;  1VFD A;  4WKM A;  5L8D A;  4ESW A;  3T22 A;  1FPD A;  4NED A;  4OEN A;  3UA8 A;  3O29 A;  4NF0 A;  5KDT A;  4GWO A;  3ILU B;  3RYD A;  3E78 A;  4I3Y A;  1M5F A;  2G93 A;  1EYI A;  2I4C A;  4X48 A;  3MQ9 A;  4ZEI A;  4F39 A;  3UN6 A;  2ZMB A;  5ET7 A;  1A99 A;  4MHF A;  2QFL A;  1MY2 A;  2BJJ X;  5HBC A;  4F3G A;  4PDD A;  1GGG A;  4ECF A;  4PAI A;  2OPD A;  1LB8 A;  4FAT A;  3SES A;  4Q5T A;  3GYY A;  3LSW A;  2F35 A;  1S9T A;  3FV2 A;  4NN3 A;  1R9L A;  2MKZ A;  1G0I A;  1FQA A;  3VLV A;  4N6D A;  4OVP A;  4OWD A;  2PT1 A;  4AS5 A;  1LAF E;  2FYI A;  4O3B A;  5L9M A;  1H76 A;  1PDA A;  4PP0 A;  4DXU A;  1IUD A;  1B46 A;  4HCW A;  1OVT A;  1UQW A;  4G4P A;  3K01 A;  1WOD A;  4NHB A;  3O6I A;  2O7U A;  3U92 A;  1MPD A;  5AA2 D;  3KN3 A;  1MPB A;  1LGB C;  3CSB A;  3RT8 A;  3CI8 A;  1LLS A;  3IOT A;  2B4M A;  2Z8F A;  1T0K A;  2FNC A;  2RC7 A;  2H5Y A;  4X1D A;  1JW4 A;  3IL1 B;  4H8J A;  3QMF A;  4OYV A;  4EQ7 A;  4PAF A;  3FJM A;  2GRV A;  4R6Y A;  3G7W A;  2QL3 A;  1B3L A;  4IO4 A;  2Q74 A;  1CNQ A;  3GBA A;  3EF7 A;  2QJE A;  2L5V A;  5H8N B;  3V8X B;  3L6G A;  2O1L A;  1FCK A;  4HE1 A;  4ZZE A;  4MIJ A;  4NF8 B;  3SEX A;  1Z7M E;  3Q28 A;  4PFW A;  3MST A;  4HTG A;  1YZ0 A;  1MPC A;  3MPK A;  4QXD A;  1DSN A;  3MC2 A;  4EXL A;  2ZYK A;  3CFX A;  4WED A;  1NV6 A;  4JWY A;  1KZ8 A;  4YMA A;  3FVG A;  2O6A A;  5I56 B;  1SVX B;  4R2B A;  4LP2 B;  1PBQ A;  1PB9 A;  3VDF A;  1Y4T A;  3HN0 A;  3B7D A;  1FPI A;  5DEX B;  2QPQ A;  1LBY A;  4QBA A;  2RC9 A;  3MJN A;  4QFL A;  1LB9 A;  3JZJ A;  4U22 A;  4DDD A;  1DCU A;  1JVY A;  3IOR A;  3KBZ A;  1B7U A;  2XXV A;  4QFK A;  4F31 B;  1BK4 A;  1URD A;  5CBR A;  1NKX A;  2WX9 A;  3F11 A;  2QS3 A;  3HCQ A;  3MPL A;  3EN3 A;  2O1M A;  4IO7 A;  2R9J A;  2NWJ A;  4WXJ A;  2ONS A;  1ZTY A;  5AA4 B;  3TQL A;  4U21 A;  2OK2 A;  5AE4 A;  2ZYO A;  2FHY A;  1LBB A;  1D9V A;  5I57 A;  2XWO A;  1B4H A;  4DZ1 A;  3UGW A;  3IK6 B;  1N04 A;  5ICT A;  3CRB A;  2IA4 A;  1MQJ A;  1LBV A;  4MNI A;  4OVQ A;  4MCO A;  3TPA A;  3B6T A;  3SZP A;  4M1V A;  5I84 A;  3IFA A;  5I58 A;  4N07 A;  1NV7 A;  3A3C A;  4OHN A;  5ELV A;  4LVQ A;  2D21 A;  1POT A;  2O7I A;  1BKA A;  4LUB A;  2UVI A;  2THI A;  4OEV A;  3FIR A;  1ZLQ A;  1WDN A;  4PE3 A;  4MX6 A;  5EYH A;  4LAT A;  3S9E A;  2JJK A;  2QS2 A;  2W7Y A;  1N76 A;  4LA9 A;  5I2N B;  1LBX A;  3K6V A;  3SEU A;  3N94 A;  4RNS A;  4UAB A;  1TFA A;  4GVO A;  1FTL A;  5DVF A;  1UTH A;  3FZV A;  3O6H A;  3HHG A;  4GX3 A;  4G2Z A;  4O7M A;  2ZNS A;  1QKA A;  5I58 B;  3PPN A;  4P47 A;  1M5C A;  4ZED A;  3S9N C;  2XXK A;  5L9O A;  4OAN A;  4BDM A;  2QVR A;  1EYK A;  2WYP A;  4Q30 B;  3DEL B;  1DPP A;  1Y1M A;  2GHA A;  4GWW A;  4TOZ A;  4LZ7 A;  2E1S A;  1DPE A;  1PB7 A;  1B0L A;  3SEW A;  5T3J A;  3GBB A;  4YB6 A;  3EKI A;  3KOS A;  4KCD A;  3IOW A;  3VLW A;  2Q9T A;  4GX6 A;  4EQB A;  3CHG A;  1Y20 A;  2VGQ A;  5FHO A;  1B1H A;  5TP9 B;  3U8Q A;  1PEB A;  3QK6 A;  1FJ9 A;  2F7B A;  5KCJ B;  3K1P A;  3QUF A;  3FV1 A;  4P0G A;  4PBQ A;  1KA1 A;  3FJG A;  3PUV E;  2Q2C A;  3KN7 A;  4JSO A;  4TLM B;  4U1Z A;  3TOD A;  1IIW A;  3M3F A;  2PFY A;  3TUS A;  4PF8 A;  1H3D A;  1FJ6 A;  3TAJ A;  3BKI B;  1P1Q A;  1IQ7 A;  4EXK A;  3CVG A;  2X7Q A;  4F1U A;  2HFB A;  3KG2 A;  1L5T A;  2R6G E;  4ONY A;  1MRP A;  2WKY A;  3S2V A;  1FPE A;  3PGF A;  4TLL B;  2HXR A;  5A5L A;  3LSF B;  3PD9 A;  2P3V A;  1NFT A;  2A5S A;  2GQ1 A;  2I3W A;  2PVU A;  4UAC A;  4FED A;  1YXI A;  4DI4 B;  3LR1 A;  2XD2 A;  3RPL A;  1OVB A;  4LN5 A;  5EQA A;  3C9H A;  1QVS A;  5DW8 A;  3MBP A;  2QVV A;  3BIH A;  4MBP A;  1SD3 A;  4Z7E A;  1LBZ A;  4JBZ A;  1GR2 A;  1XVX A;  2VD2 A;  3C34 A;  2WYK A;  4LZ5 A;  4PCD A;  1FQD A;  3OEN A;  5TPA A;  2XX8 A;  3G3G A;  3MW0 A;  2V3T A;  3MVX A;  4C1T A;  3HFU A;  1B32 A;  1POY 1;  1ZBM A;  4PC9 A;  2UYF A;  3HV1 A;  2D5W A;  4GXA A;  4P0I A;  2F3B A;  2DWJ A;  3TQW A;  3VLU A;  1B0H A;  2CZL A;  1FBH A;  3RTW B;  5FHM A;  2PCR A;  1QUK A;  3QYT A;  1FBP A;  3FJ7 A;  4DCY A;  4RY1 A;  4RXL A;  4QSD A;  4I8C A;  4XKN A;  2Y7W A;  4NGU A;  1D4N A;  3N6U A;  2LAO A;  4HW8 A;  3UP9 A;  2HEU A;  1YYZ A;  5LTC A;  2DVC A;  1P1O A;  4R6K A;  1K9Y A;  3R6U A;  2DWI A;  1MXU A;  3D4G A;  4HCY A;  4HXV A;  1MXV A;  1TXF A;  2CEY A;  3VE1 B;  1MQI A;  2CMO A;  4LZ8 A;  4NWD A;  2ONK E;  1MY0 A;  3MZ1 A;  4N4U A;  3KBR A;  1MG1 A;  1MXW A;  4N15 A;  4U2R A;  1Y3P A;  5BUU A;  1A54 A;  4N17 A;  2H4I A;  2Z8E A;  3EQ1 A;  2V93 A;  1LBC A;  3IOV A;  1PBP A;  4IGR A;  1CE2 A;  4BDR A;  4EF1 A;  3RUM A;  1SW1 A;  3QUJ A;  1MQG A;  1JET A;  3PUX E;  3JYR A;  2V3Q A;  4FBP A;  4FE8 A;  1QUL A;  2KLF A;  5AA2 B;  4HE2 A;  1GVC A;  3PPR A;  1YAE A;  1B3F A;  3H6U A;  4YU0 A;  4N6K A;  1MDP 1;  4XKQ A;  1RDX A;  3A3U A;  4THI A;  3EPE A;  3Q29 A;  2PMS A;  2D3I A;  3K0V A;  3L6H A;  4P1E A;  2OX3 A;  2A5T A;  4DCX A;  3T0J A;  4ZZA A;  3PPO A;  3H6W A;  2HZL A;  1VE4 A;  4GRK A;  1B52 A;  5LDZ A;  3FVK A;  4R74 A;  3G3H A;  4LQ2 A;  3FD3 A;  4YMB A;  2F7C A;  2CZK A;  3K00 A;  1I69 A;  4QFP A;  2V25 A;  1RYX A;  3TZA A;  4KXP A;  3IB0 A;  3RN8 A;  4GX4 A;  3C4M A;  1MY4 A;  1VR5 A;  3M3L A;  1FPB A;  1O64 A;  2OWT A;  2HQ0 A;  5JTY A;  4F3S A;  1EZO A;  2R71 A;  3OEM A;  5CMC A;  5J1D A;  4NF8 A;  5ESY A;  3SEY A;  2Z23 A;  1AOV A;  1N7W A;  4YZZ A;  1LFI A;  1HSL A;  3W9W A;  3N5L A;  4OMB A;  2GH9 A;  3ODB A;  1FTK A;  1LST A;  4EDP A;  4YKI A;  3TYH A;  4OQO A;  1FTO A;  4MJO A;  2Z8D A;  3DP8 A;  1IZ1 A;  1ZU0 A;  2Y7K A;  3PV0 E;  4NG7 A;  4L17 A;  2XXY A;  1A8F A;  1USY E;  2Y5K A;  3K02 A;  3PPQ A;  3QAX A;  2QRY A;  1YTV A;  4O3A A;  5FTH A;  4P1L A;  4G8M A;  1XS5 A;  3GLB A;  3A29 A;  4F2O A;  4ELP A;  1IME A;  1B2H A;  3FXQ A;  1R9Q A;  2VP1 A;  2I58 A;  4PFI A;  1FSA A;  3ZS6 A;  1GTK A;  4U23 A;  3ILT B;  3CG3 A;  4Q8R A;  2P2A A;  4NAP A;  5H8Q A;  4G8H A;  5H8F A;  3TMG A;  5I57 B;  5KZT A;  2GFE A;  3MYU A;  2OWS A;  1M5D A;  4G77 A;  4AQ4 A;  4QHQ A;  2HXW A;  5EYF A;  3LUY A;  3E4R A;  1G0H A;  3V83 A;  3KJT A;  3ISP A;  5LOM A;  1I6A A;  3TEP A;  5BWJ A;  1LCF A;  1FPF A;  5ICQ A;  3ECR A;  3H06 B;  1NH7 A;  1ZKB A;  2PYY A;  2XX7 A;  2DXR A;  5I5P A;  4F3P A;  3LV0 A;  4R9G A;  1B9J A;  1B1X A;  1QKB A;  2P0S A;  4Z0I A;  3RPW A;  1R1N A;  4NE4 A;  3I5O A;  4ESX A;  1LFG A;  5B70 A;  1NV1 A;  3UK4 A;  4GLI A;  1NUX A;  4HS7 A;  5I7I A;  5JTY B;  1FQC A;  5H8S A;  3G3I A;  3TTN A;  1CB6 A;  1B4Z A;  3FBP A;  2DVZ A;  1TFD A;  3Q25 A;  2OBG A;  2VD3 A;  4ZEC A;  3V5A A;  3BIG A;  1D9Y A;  4XIG Q;  3TCH A;  1NV2 A;  3K6U A;  1AH5 A;  4H46 A;  1FTA A;  4MNP A;  1IMC A;  3C35 A;  1LEV A;  4NQ8 A;  1B7H A;  4U4S A;  5H8H A;  3K4U A;  4RJZ A;  1INP A;  3ZKL A;  2UVH A;  4N6P A;  3ONM A;  1OQH A;  1MXX A;  1NH8 A;  4NF5 B;  2WEF A;  4ZEF A;  1SYI A;  4LQ5 A;  3VVD A;  2WBB A;  4OVR A;  2GHB A;  4BDN A;  1Y3N A;  1IMF A;  2UVG A;  3IX1 A;  3H3G A;  4F19 A;  5I3S A;  2VPO A;  3FAT A;  4OTE A;  5A5X B;  1USY H;  2B4L A;  2NXO A;  3OEK A;  1LAH E;  5CMB A;  2FIX A;  1JEU A;  4G61 A;  1DMB A;  4JVD A;  4MMP A;  1O7T A;  1VDW A;  3MP8 A;  2FA7 A;  1MQH A;  4K3F A;  3IJX B;  2VT5 A;  3HO7 A;  1Y3Q A;  4G68 A;  3K6X A;  3G3F A;  4PGN A;  4IGT A;  3C31 A;  2O51 A;  4PFY A;  4GBV A;  3SET A;  4R6H A;  1FQF A;  3O6G A;  3EHT A;  3TEL A;  1WVJ A;  1M5B A;  3LC8 A;  4X9T A;  3TCF A;  3EHU A;  1NI9 A;  2B65 A;  4M4G A;  5FTI A;  2DXY A;  4JSD A;  1IXI A;  2UXA A;  1I6B A;  2ZZX A; 
#chains in the Genus database with same CATH homology
 2QVU A;  2HPG A;  2QVV A;  4NG7 A;  2FBP A;  4GWU A;  4GWS A;  3BIG A;  3BIH A;  1Q9D A;  4GWW A;  2B4M A;  4XFE A;  1NV2 A;  5EQ9 A;  4OVS A;  4O7I A;  1LBV A;  4MNI A;  4H46 A;  1LBZ A;  2Y5K A;  2XWI A;  1FPD A;  1FTA A;  1FBF A;  4MCO A;  4MNP A;  4OVQ A;  1IMC A;  1LEV A;  2V3Q A;  3RPL B;  4FBP A;  3QMF A;  4NF0 A;  4NQ8 A;  2WYK A;  1NV4 A;  4O8M A;  4PTK A;  1IMB A;  4P1L A;  4PCD A;  4HE2 A;  1IMD A;  4PAF A;  3SZP A;  2KR0 A;  4M1V A;  1NV0 A;  1RDZ A;  5T3J A;  4O94 A;  4OA4 A;  1FPK A;  5JK4 A;  3A29 A;  3RYD A;  3E78 A;  5ET6 A;  1NV5 A;  3IFA A;  1INP A;  4I3Y A;  4XF5 A;  2F3D A;  1IME A;  3KC0 A;  1JP4 A;  1EYI A;  1NV7 A;  2WBD A;  4N6K A;  4PET A;  4F1V A;  3EKI A;  4PFI A;  1FSA A;  3U65 A;  2Q74 A;  1CNQ A;  4GX6 A;  2Q9T A;  3B50 A;  4N8Y A;  4PF6 A;  2WEF A;  1RDX A;  4X04 A;  3CHG A;  3HFU A;  2L5V A;  1IMA A;  4NAP A;  1D9Q A;  5IZ3 A;  3W9V A;  5ET8 A;  3NOH A;  5ET7 A;  4MAG A;  1AWB A;  2HZK A;  4MHF A;  1FJ9 A;  2P3N A;  2QFL A;  2WBB A;  4NX1 A;  4P1E A;  4PC9 A;  1NUW A;  4PBQ A;  2OX3 A;  4HE1 A;  3MYU A;  2FIE A;  5EQ7 A;  4AS4 A;  4MIJ A;  1KA1 A;  4OVR A;  3MST A;  3IFC A;  1IMF A;  1NUZ A;  1YZ0 A;  4N91 A;  4PDD A;  1KA0 A;  3T0J A;  2R8T A;  3LUZ A;  2HZL A;  1LBW A;  2BJI A;  4QXD A;  5I3S A;  2VPO A;  4MEV A;  4PAI A;  4F19 A;  4PE3 A;  4DI3 D;  5CM6 A;  4MX6 A;  5EYH A;  3GYY A;  2F3B A;  1NV6 A;  1NUY A;  5LDZ A;  2JJK A;  5FBP A;  4P3L A;  1KZ8 A;  4HE0 A;  4I40 A;  1G0H A;  2B4L A;  2XWV A;  4PDH A;  4PFB A;  1FBH A;  2PFY A;  5IM2 A;  3ISP A;  1FBC A;  2FIX A;  4GBW A;  2Q8M A;  1LBX A;  2VPN A;  2XWK A;  2OWZ A;  1DBZ A;  2PCR A;  2CZK A;  4G61 A;  1FBP A;  1XI6 A;  4JVD A;  4MMP A;  4PF8 A;  3B8B A;  2PFZ A;  1VDW A;  1FJ6 A;  1K9Z A;  3PTY A;  1NV3 A;  4XEQ A;  4YIC A;  2V4C A;  1SPI A;  1FPG A;  1FPF A;  4MNC A;  4N8G A;  1FPI A;  4KXP A;  2QPQ A;  4NN3 A;  1LBY A;  4QBA A;  4UAB A;  2MKZ A;  1DK4 A;  1G0I A;  4NGU A;  4GX4 A;  2VT5 A;  5J16 A;  5I5P A;  4N6D A;  2DE3 A;  1FBE A;  1DCU A;  3LV0 A;  4OVP A;  4PAK A;  2DE4 A;  1FPB A;  5EQ8 A;  1RDY A;  3KBZ A;  3ROJ A;  5IZ1 A;  4JVI A;  4JVC A;  2DE2 A;  4PBH A;  4F1U A;  4OVT A;  4P56 A;  4PGN A;  3KC1 A;  1YYZ A;  5LTC A;  1BK4 A;  5J1D A;  4GWZ A;  2WX9 A;  4AS5 A;  5ESY A;  1K9Y A;  4P8B A;  5IZZ A;  1FBG A;  1FBD A;  4GX3 A;  2CZI A;  4YZZ A;  5ET5 A;  4GBV A;  5EYG A;  4HCY A;  4HXV A;  4O7M A;  1FPE A;  2FVZ A;  2XA5 A;  4PGP A;  4N81 A;  5F24 A;  3W9W A;  4GWX A;  2CEY A;  2F5X A;  4GWY A;  2HXR A;  2ZZV A;  4H45 A;  4X8R A;  4I3E A;  5IGA A;  5A5L A;  1NV1 A;  2P3V A;  4P47 A;  1NUX A;  4PFR A;  3FXB A;  2HHM A;  2XXK A;  2GQ1 A;  2ZZW A;  4HCW A;  5I7I A;  2CZH A;  2CEX A;  4N4U A;  3T1B A;  4X9T A;  1YXI A;  4OAN A;  4DI4 B;  1EYJ A;  4F18 A;  2FHY A;  2QVR A;  3RPL A;  1EYK A;  2Y5L A;  1NI9 A;  1FRP A;  5IZ3 B;  3FBP A;  4MJO A;  3D1R A;  1FPL A;  2DVZ A;  2KQZ A;  5EQA A;  2WYP A;  4LN5 A;  4N15 A;  4NHB A;  4N17 A;  2DDK A;  1FPJ A;  1QGX A;  2XWO A;  3E79 A;  4P9K A;  4IR8 A;  5DW8 A;  2ZZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...