3KC1A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 19a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
319
Chain Sequence
b'DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 97
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc1A02
1FBPA 2F3DA 2WBDA 5A5LA 1RDXA 5DW8A 1NUYA 1LBYA 5EQ9A 1FPDA 1SPIA 4GWUA 4KXPA 2FIEA 4G61A 4I40A 1NV6A 4GBVA 4FBPA 1YZ0A 1G0IA 1NV1A 4GWXA 3BIGA 2Q74A 2FVZA 5LDZA 5ET7A 5IZ1A 1DBZA 3RPLA 2QVVA 1VDWA 1LBZA 1YYZA 1FBCA 3BIHA 4GBWA 1K9ZA 2Y5LA 5EYHA 2Q8MA 1NV5A 1IMEA 4I3YA 3LUZA 2FBPA 2DDKA 1DCUA 1LEVA 5IZ3B 5EQAA 4GWWA 1CNQA 1Q9DA 3T0JA 1NV2A 2Y5KA 3KC0A 5EYGA 5ET5A 2P3NA 4N81A 5FBPA 1FSAA 1NUXA 2CZKA 4HE0A 3B8BA 4GWYA 5F24A 2VT5A 4GX3A 1FJ9A 1NV7A 4IR8A 1NUZA 1DK4A 1BK4A 1D9QA 2CZHA 1FPBA 2GQ1A 4GWSA 2BJIA 1FPFA 1IMFA 1FPLA 4O7IA 2WBBA 2PCRA 1FBEA 1YXIA 1FPEA 5IZ3A 5EQ7A 1XI6A 5J16A 4HE2A 1JP4A 4H46A 1NV3A 1LBXA 1FPKA 1K9YA 1AWBA 2HHMA 2OWZA 4HE1A 3RYDA 2QVUA 3IFCA 5EQ8A 1FTAA 1QGXA 1IMAA 4AS4A 1G0HA 1KZ8A 2FIXA 1EYKA 1EYJA 3IFAA 2FHYA 2P3VA 4HXVA 5ET6A 1FPJA 1FPGA 1NUWA 4AS5A 1NV4A 5ET8A 1INPA 1FBFA 3KBZA 1FBDA 3QMFA 5ESYA 4I3EA 3KC1A 1EYIA 2F3BA 3A29A 4MJOA 5I3SA 4GWZA 1IMBA 1RDZA 4PTKA 1RDYA 1FPIA 1NV0A 2CZIA 3FBPA 3RPLB 3ROJA 1FBHA 1KA0A 1LBVA 2R8TA 1KA1A 1LBWA 1FJ6A 4GX6A 4GX4A 4QXDA 1FBGA 2WEFA 3LV0A 2OX3A 2QVRA 5T3JA 2QFLA 1IMCA 2JJKA 4H45A 1FRPA 1IMDA 3D1RA 1NI9A
chains in the Genus database with same CATH superfamily
3PPQA 1N04A 3OENA 4H5GA 1HSJA 3SZPA 3N94A 1MM7A 3GZGA 1QVSA 3MW0A 4LQ5A 1A99A 5EYHA 2Y7KA 4OHNA 1MS7A 4IGRA 4TOZA 4F29A 2Z22A 2QMWA 4F1VA 4ZECA 3OMBA 4DZ1A 1VE4A 2O1MA 3O6HA 2NXOA 4XKRA 3GLBA 4LP2B 1MY0A 2NOOA 1NV7A 2XXHA 1AIVA 3TTKA 3S4UA 3HPIA 2O51A 2WBBA 3W9VA 1IQ7A 3MBPA 5IM2A 4FE8A 4H46A 4LUBA 3TZAA 1MQGA 5ICQA 5TU0A 4AS4A 2OBGA 1LSTA 3EHSA 2DWIA 4WEDA 5AA2B 4JWXA 3ZKKA 4MNPA 3B6TA 2CZLA 4AS5A 1NNPA 2XXVA 4F2QA 1M5FA 2REJA 4P1LA 2Y84A 4RPOA 1RDYA 1TFDA 3S9EA 3G3JA 4O3CA 1I69A 3ROJA 1FBHA 4R9GA 1FTMA 4DLDA 2UVIA 2OX3A 3LR1A 3CFXA 4NF5B 3TTLA 1FRPA 5A5LA 3S9NC 4R72A 3IO4A 4PF8A 3OO7A 3VE1B 5I57A 3KJ7A 3K6VA 3VXBA 3CG3A 1LAFE 2A5SA 4ONYA 2NUVA 1B1HA 1UQWA 3CR9A 1A40A 5H8HB 1NV5A 1IMEA 2Z23A 3FJMA 2HFBA 4EQ7A 4G8NA 3MVXA 1FQEA 2HZKA 4ND9A 1UTHB 3IAZA 1A7LA 4DCYA 4F1UA 3FVNA 2G93A 3HSTA 3KN8A 3OD7A 5CMCA 3T96B 3OELA 1H76A 4ZEBA 4YU0A 3SEVA 2HEUA 5I58A 1IXHA 3W9WA 3SEYA 1NH8A 2Y7WA 1JP4A 1UIVA 4OVQA 4Q30B 4YMAA 1P1OA 5B7DA 4HE1A 1Y3PA 2QVUA 3IFCA 1R6ZA 1MPBA 5F1QA 1UTBB 4G68B 2ZYMA 3MVZA 3E4RA 2GH9A 4MLQA 4I1DA 4QHQA 4WKMA 3RUMA 3VVEA 3TAJA 3PPPA 2QL3A 1FJ6A 4L17A 3H7MA 1B6HA 3LV0A 4O8MA 4N4UA 4C0RA 2GRVA 1RKMA 2O69A 2O84X 5H8NA 1BKAA 1R1NA 3H03A 1DTZA 4KD5A 4KR5A 4KI0E 1N7XA 1DTGA 2D3IA 5LDZA 4FATA 3LBSA 1MH4A 4R2FA 1N0TA 1SI0A 1FQFA 3N26A 2I48A 2I6EA 3SETA 5ET5A 4PQJA 3MWBA 4DXUA 3IOWA 3K1MA 4U21A 4U1OA 5FBPA 3P7IA 2CMOA 1IXIA 1FQDA 4QFKA 2H4IA 4GXSB 4IR8A 2F97A 5L9MA 5CI5A 1FTKA 4GWSA 3MUQA 4NF4B 1YAEA 5BWJA 2XXYA 4QFNA 4YKIA 3IO6A 5HPQA 4LZ5A 4QSCA 4OETA 2UYEA 1FPKA 1IITA 3RYDA 5EQ8A 1RYXA 4GIZA 1MPDA 1KZ8A 4QFPA 1LGBC 1EYJA 3IFAA 4PAKA 3CIJA 4MMPA 2O68A 1FPGA 4QRZA 2VD2A 1LAXA 1FBFA 4HW8A 2NWJA 2XXUA 2DYXA 1MY3A 1FQCA 1RYOA 3QXMA 2DWJA 1YCJA 4ZDMA 2OZZA 2QMXA 4OTEA 3QSLA 2DVCA 1ZMGA 2F7CA 1NUYA 1URSA 4GWUA 1IUDA 4KXPA 5AA2D 2FIEA 1A55A 2ZYNA 1NV6A 4I8CA 4N91A 4ELRA 5H8FB 3QIMA 4U23A 3NOHA 5DYHA 3HHGA 2XX9A 4HTGA 4GOTA 4NX1A 1N7WA 4X9TA 2FBPA 2X26A 4O94A 4MIJA 3O28A 3KC0A 2HAVA 1PB9A 1Q35A 4PE3A 4FJPA 2CEXA 4RNSA 3JV9A 3JYRA 4GVOA 2VT5A 1BTJA 1NUZA 2REGA 4XKNA 1VSOA 2F6GA 2UVJA 3PUYE 3L6GA 4MH5A 2F36A 5H8QB 4QSDA 3FIRA 2PCRA 4OESA 1P1WA 4R6HA 2QSXA 4QSEA 4R6YA 4PAFA 3C31A 3FXQA 4MEVA 1ZLQA 3FJ7A 1TXFA 4G4PA 3PUZE 2B4MA 2R9JA 4G2ZA 5I2KB 1NV4A 1B4ZA 1MPCA 1EZPA 1LLSA 3L6HA 3V8XB 2NVUB 4NMYA 1FPIA 4C1UA 1T0KA 4LONB 3E79A 1M5EA 4GX6A 5AA2A 1LFHA 1LB8A 4LQ2A 3OO9A 4N6DA 1FTJA 1RDXA 4P9KA 5HM4B 4I40A 2PT2A 1YZ0A 2RF1A 3B7DA 3PUWE 1VFDA 1TT1A 1F9BA 4NAPA 4NF5A 1OVBA 5DVIA 1BIYA 1Q9DA 4FECA 2Y5KA 1GVCA 3MP8A 1B5IA 3UK4A 2B3BA 1PDAA 2I49A 3IX1A 1NL5A 4H6DA 1QUKA 2Y7IA 4ELPA 5H8HA 4GD5A 1YXIA 4MLVA 3OOAA 3VLUA 1UTHA 1NV3A 1MXUA 2F34A 5AA3A 2HCAA 3MC2A 4YAHX 4MNIA 5DT6A 1WVJA 1MQHA 1QKBA 4N8GA 1US5A 4E0XA 1NUWA 5DVJA 2OPEA 3ILUB 1MH3A 5ET8A 1INPA 3TCHA 1AL3A 4X04A 3PPRA 3A29A 4LVQA 3GXAA 2XWKA 5DEXB 4F3BA 5CMKA 1LBWA 2Q88A 4BDNA 1UTBA 4G68A 4JSOA 4LA9A 4O3AA 1NKXA 4POWA 2OCUA 3HHFA 3EN3A 4NE4A 3T9XB 1PC3A 2HPGA 4ZE9A 3G3KA 2Q2CA 3T93B 1URGA 4GWOA 1FBCA 2X7QA 1K9ZA 1D9VA 1MG1A 5CMBA 5HBCA 2KQZA 5IZ3B 4GF8A 3V89B 3FUZA 1VR5A 4PETA 4PFTA 2AL5A 2DVZA 3RN8A 1M5CA 4OANA 3O9PA 4PGNA 4OWDA 4BDQA 3CFLA 2L5VA 1MXZA 5F24A 1BK4A 4XKPA 4P8BA 2FA7A 5CM6A 1FPEA 3RT8A 3V5AA 4OXVA 2ZXTA 2RC9A 2QS3A 4MAGA 5CBSA 1CB6A 2OWZA 1IEJA 1OQGA 1USYE 1QGXA 3PMXA 1UIUA 2A5TB 2DP8A 4DI3D 2FHYA 4NF4A 1SVXB 2Z8DA 4AB5A 1N84A 1ANFA 3IK6B 4EF2A 2B3FA 4F31B 3E13X 3K6UA 3THIA 2DE3A 5ESYA 3IOTA 2PVUA 3FATA 5JK4A 3F11A 2QJEA 3PMVA 4U4SA 5CC2A 5ITOA 2G29A 3G3GA 3PPOA 1GTKA 2HXRA 3Q27A 1H43A 1IMAA 1DMBA 1I6BA 4M1VA 5FTHA 4MCOA 4F3GA 4JDFA 2FNCA 3M3KA 4IO3A 4Q0CA 2I3WA 2V4CA 4JWYA 5F7VA 2IA4A 2ZYOA 3CRBA 1Y4TA 4WEPA 3U8QA 3FVGA 5L9OA 4NQ8A 2THIA 1YYZA 3IB2A 2XXKA 4PFYA 3H6TA 1LEVA 1DOTA 3U72A 4ELQA 3KN7A 4JWOA 3MZBA 4IGTA 3TTMA 1NMUA 2AYSA 2ZNSA 3E3KA 3U93A 5H8FA 2QPQA 3EQ1A 5EHMA 4GX3A 4YKKA 4YICA 4JVCA 1M5DA 3LSXA 4F19A 4XKQA 2HZLA 4NF6B 4EQBA 4EF1A 5J16A 5KZTA 3VDFA 2YLNA 1AWBA 2DSFA 2B65A 4ZS9A 2FIXA 1XVXA 3R7XA 3FXRA 3MSTA 1MQDA 1POTA 1POY1 4OENA 4XXUA 3K01A 1D9YA 5H8QA 3MYUA 1BP5A 2H25A 5FHOA 2ZMBA 5IGAA 3IB0A 3FV1A 2V3UA 3FGSA 3QMFA 5I3SA 3H6VA 4GWZA 4KQPA 1IXCA 4ZEKA 4OVTA 3B6WA 2WX9A 2QS2A 3O6IA 2O7IA 4PDDA 1B0LA 4UA8A 1XS5A 4GX4A 2XD2A 2V93A 3ODBA 3KJTA 4OEVA 4I62A 4U1ZA 4NWCA 1D4NA 5I2KA 4YKJA 1NI9A 2F3DA 3TODA 1SDXA 4ISUA 3VXCA 1TWYA 4G61A 1GR2A 2BJJX 4YZZA 4MNCA 2XWOA 5IZ1A 5IZZA 4OFJA 3PMWA 2ANJA 3H4ZA 3LUZA 1JW5A 1JVXA 1CE2A 2DDKA 2ZZXA 4K3FA 5I56B 2VGQA 4BDRA 3T0JA 4DDDA 4IO2A 4PC9A 4JVIA 4G68C 2CZKA 3B8BA 2AIXA 4NN3A 1PEBA 4XEQA 4PCDA 1OLCA 4R75A 1S50A 1OVTA 5AE4A 4O7IA 3O2AA 4PDHA 4OYVA 4PFIA 4EXKA 4HE2A 3QAXA 3KOTA 3GYYA 1LBXA 3SDFA 4PAIA 3QUJA 3G3FA 1B4HA 1DPPA 3M8UA 4MBPA 4H8JA 5A5XB 1I6AA 5ET6A 2V25A 5FHNA 1NNTA 1ZIUA 2OJTA 4GRKA 2F8DA 4H5FA 4NGUA 4N15A 2DXYA 3SEWA 1SW2A 3MPLA 4OVRA 1FBDA 2X7PA 1EYIA 2H98A 4MJOA 4JB7A 1FTLA 2Y7RA 4Q8RA 4H0WA 3UA8A 4QFLA 1FTOA 2RC7A 4OA4A 1OQHA 2ONKE 1I6QA 3FASA 4N8YA 2XXXA 3OSRA 1LAGE 2ABHA 3DLNA 3K1NA 1A54A 1XOCA 2Y7PA 1B58A 3FV2A 5DTBA 4H67A 5DEXA 4R74A 2F7BA 2ALUA 4DE8A 2I58A 1WDNA 4XF5A 4GBWA 3G7WA 1B7UA 4TQUQ 4PFRA 1MRPA 1EU8A 1JNFA 5I2NB 1JQFA 1B5JA 2QS4A 3KBRA 4AB6A 2KR0A 4O7MA 3MP1A 4OQOA 2PT1A 4KFQA 1FPBA 4NG7A 1N3XA 3CFZA 1IMFA 1FPLA 1JEVA 5IAIA 2HXWA 1B52A 5IZ3A 2MKZA 4LZ7A 1MY2A 1MDQA 3U94A 4R9FA 3D4GA 3CSBA 4C1TA 4FORA 5CBRA 3QUFA 3K6WA 4F3PA 1EYKA 1FQAA 2PBWA 1OLAA 4LATA 2PFYA 4H65A 5LTCA 4PBQA 3UORA 1B3GA 5ICTA 3K2DA 3LC8A 4BLAA 5M2VA 1KA1A 2A5TA 3ECRA 3RPWA 1B3LA 2V3QA 3MZ1A 5ISUA 4FAJA 3C32A 5B70A 3OSQA 3MQ9A 4DCXA 1S7YA 4GLIA 2FYIA 1SW5A 4POXA 4GBVA 3RNNA 4DXBA 1FCKA 2V3TA 5I5PA 3EKIA 2PFZA 1VDWA 3RY3A 1DCUA 3MAMA 5EYFA 2I4BA 5EYGA 4HCWA 3HV1A 2I0BA 1JVYA 1NUXA 4NWDA 1XT8A 2RCBA 1FJ9A 1Z7ME 3OO6A 1DK4A 1DPEA 3FXUA 1LBBA 3I5OA 2Q9TA 4KYDA 4KYEA 1NNKA 5CMMA 3KG2A 3EHUA 4RJZA 4FIMA 4X1DA 2ZNTA 1Y1ZA 4NF8B 3IOUA 1Y4CA 2DS9A 4F3SA 1HSEA 3HN0A 4QFOA 4DIGA 3K1PA 1GGGA 4YMBA 3VFJA 4WXJA 4NF6A 2F6PA 2GFEA 2UVGA 3SERA 1PBQA 4N13A 2PYYA 4PTKA 4E0WA 1B9JA 1LCFA 3OEMA 1NV0A 1L5TA 3U92A 2XX7A 1B3EA 3TPAA 3Q26A 4GQOA 4YB6A 4FEDA 4NEDA 2VD3A 3O97A 1MY1A 1OMPA 4DI4B 1FPDA 3EPEA 3DELB 1G0IA 4GWXA 1LFGA 4GXAA 3H3GA 2QVVA 3CHGA 4OEUA 4P0GA 2WYKA 3Q28A 4P11A 2HQ0A 1QUIA 2PX1A 1XVYA 1ELJA 1VFEA 1WODA 3OO8A 3WAFA 4OZ9A 4F22A 1Y20A 4NHBA 3TQLA 3ILTB 3T1BA 1TFAA 3VVFA 3MP6A 5AA1A 2CZHA 2GQ1A 3DM0A 3H06B 3UIFA 4ZZAA 4F2OA 2E0SA 4X48A 1FBEA 4EQ9A 1ZBMA 2Z8EA 2GHBA 3O6GA 5I56A 2O7UA 3TFLA 1Y9UA 2F7AA 3FXBA 3N6TA 1ZKBA 2E1SA 1SW4A 2R71A 3FJGA 1B0HA 4XFEA 2DXRA 1AMFA 1O64A 1QKAA 3CG1A 3IL1B 1B32A 1NFTA 4BDMA 2P2AA 1LBCA 3O29A 1FPJA 1JW1A 1URDA 4H1XA 3KEIA 1B46A 4DXCA 3SESA 3O66A 1IMBA 5H8SA 1RDZA 3V83A 3LSWA 1XC1A 4YB7A 5A5XA 5KDTB 3TTRA 4IY6A 5AA4B 4THIA 3RGYA 4BDOA 1B3HA 1O63A 1R9LA 3U65A 3D1RA 5TPAB 3TUSA 3G3HA 3JZJA 4OMBA 5L9SA 3A09A 4FBPA 1NV1A 3I3VA 5ET7A 4Q5TA 4PP0A 1AOVA 1N3WA 3TKDA 3QYTA 2Y5LA 2I0CA 3ISPA 1ZTYA 3VVDA 4LN5A 5BUUA 4GWWA 2D5WA 1B40A 2DQVA 2P3NA 4N81A 4N07A 2XHDA 4HE0A 4GWYA 1JETA 2O6AA 4UABA 4ESXA 2P0SA 1IIWA 3U1OA 3M3LA 3C33A 4QF9A 2DE2A 2RKMA 4X1BA 5I2NA 4N17A 4JBZA 3TYHA 2UVHA 4NTLA 2VHAA 1J1NA 4U2RA 1MXWA 5K2XA 2PMSA 4KCCA 4G8HA 5IKBA 3TDJA 3HO7A 3G3IA 3GBAA 2M8CA 4I3EA 3KC1A 2Q8JA 4IO6A 1KWHA 4ESWA 2F5XA 2OK2A 1QW0A 3RPLB 2ESNA 1KA0A 3H6UA 2R8TA 3KN3A 1FBGA 2QVRA 5I59B 4RPNA 3TEPA 3RLFE 2JJKA 5TP9B 3T9HB 3WAEA 2H99A 5DW8A 1LBYA 2XD3A 4KYSA 1ZU0A 2O1LA 3AXFA 2VPOA 2HAUA 5KCJB 3BIGA 3IJOB 4M4GA 3ZS6A 3KZGA 3IB1A 3KFMA 3TCGA 4P1EA 3B6QA 1P1UA 4OVSA 5EQAA 2H5YA 2DWHA 4YKPA 1MY4A 3PTYA 4RA1A 4IO7A 1EZ9A 1B2HA 1FSAA 4P3LA 3IOVA 1GV8A 2QRYA 5JTYB 2LAOA 3HFUA 2RINA 2XXQA 2ZZWA 4P56A 5I7IA 3IJXB 4YB5A 2BJIA 1P1QA 1MM6A 3H6WA 4BDLA 5LOMA 3E78A 2XWVA 4G8MA 1XHYA 3TQWA 4R2BA 1QUJA 3R26A 4PFBA 1G0HA 4JXIA 3S9LC 2IEEA 1P1NA 1MXXA 4JVDA 3I6VA 2P3VA 1HSLA 3C4MA 5CRYA 1B7ZA 5L8DA 4NF8A 1MXYA 1LBVA 3N6UA 5I84A 3E9XA 1PBPA 4RK9A 3GBBA 3FZVA 1H45A 4H45A 3ZSFA 3PU5A 4KPTA 2XXPA 3C36A 2XWIA 2XXTA 3MJNA 1SPIA 3C9HA 4KHZE 1H44A 2GHAA 2Q74A 3MPKA 1LAHE 3MVWA 1Y3NA 4P47A 3MZ9A 2Q8MA 3D4CA 1JEUA 1LB9A 2VPNA 3UGWA 1R9QA 3W15C 4XTCQ 2WKYA 1USYH 3DP8A 3KSJA 3PV0E 1MDP1 2RCAA 2XXIA 2DE4A 1MXVA 1D9QA 3RT6B 1EH3A 3IORA 2I4CA 2AL4A 2KLFA 5EQ7A 4IB2A 3ZKLA 1SYIA 3T9VA 1S9TA 3C35A 1O7TA 1SI1A 2HHMA 3LSLA 1IXGA 4JSDA 4OFLA 2F78A 1Y1MA 4ZE8A 4PFUA 2D21A 1B05A 3PD8A 4TLLB 3UP9A 3TELA 2W7YA 4N6KA 4F18A 1QULA 3LUYA 3CI8A 1A8EA 1NH7A 3VLWA 2VOZA 2Z8FA 3PD9A 2Q89A 2F35A 3Q29A 5I57B 1SQYA 3RTFB 3K02A 3Q25A 3VLVA 3IR1A 3LSFB 4I9DA 1JW4A 3RQTA 2V84A 5T3JA 1M5BA 3K00A 4H8IA 4PBHA 2QFLA 1IMCA 3TCFA 4IY5A 3BFTA 3PUXE 3TMGA 4TLMB 3BFUA 3A3CA 1A8FA 1DBZA 3OEKA 5KDTA 4PE5B 5DVFA 5AA4A 5I58B 4I3YA 4LZ8A 1NNFA 1US4A 3FVOA 5TPAA 3VV5A 4EXLA 1NV2A 3CVGA 4HS7A 2UYFA 4Z0IA 3KSXA 1B7HA 3PPNA 2R6GE 2I3VA 3KGCA 4ZEDA 5FHMA 3T66A 1QJMA 2YJPA 2RC8A 3PGFA 4NF0A 2ONRA 2CEYA 3K6XA 4EUOA 3S9MC 4MX6A 3S2VA 1SW1A 3USDA 3KOSA 3FD3A 2ZYKA 1FTAA 1YTVA 3K4UA 3BKIB 3DP6A 4XIGQ 2DWAA 4HXVA 4ELOA 1P99A 4MFIA 4R6KA 5H8NB 4PF6A 4Z7EA 4FEBA 1D3KA 1SBPA 5ITPA 3CSGA 4RK2A 2XXRA 2QS1A 4EDPA 2WYPA 4G77A 4OVJA 3UN6A 3M3FA 4AQ4A 3FBPA 2CZIA 2DOJA 4O3BA 4MF3A 2OWSA 2WEFA 4GFRA 3MVYA 3QK6A 1B5HA 1IMDA 3EHTA 1FBPA 2WBDA 1IZ1A 4RY1A 5EQ9A 5FTIA 1MQIA 1EZOA 4KCDA 1Y3QA 1PB8A 2OPDA 2H9BA 2FVZA 3RPLA 4RYAA 4ECFA 1LBZA 2P1SA 4PFWA 3BIHA 4MHFA 2ONSA 3TTNA 3C34A 5I59A 4N6PA 1N76A 2OWTA 3DP4A 5TP9A 1CNQA 2XX8A 1MQJA 1II5A 3SEUA 1ATGA 4OERA 5KCJA 1YPNA 4PGPA 4U22A 3K0VA 2XXWA 2OLBA 2ZNUA 5JEIA 4ZEFA 1FPFA 1ZJLA 3HCQA 1FW0A 2VP1A 1PB7A 4R73A 3FVKA 4IO5A 5EHSA 4OVPA 1XI6A 1DSNA 3SEXA 2YPNA 1B3FA 2XA5A 4HCYA 3N5LA 1Q1KA 1K9YA 3PUVE 1B1XA 1B51A 5JTYA 4F1YA 4P0IA 1FQBA 3OXNA 1Z7NE 3T22A 4GL0A 4ZZEA 1H3DA 4QBAA 1SD3A 3KBZA 4OFOA 3BBRA 5J1DA 2F3BA 4U4XA 3SKPA 4F39A 3R6UA 4RXLA 5ELVA 4ZEIA 3RTWB 4GL8A 3B50A 3EF7A 1AH5A 4X8RA 2UXAA 4IO4A 5K2YA 4UACA 1BLFA 2Q2AA 3A3UA 1LCTA 2ZZVA 3T9UA 1SYHA 1OIBA 4QXDA 3ONMA 1LFIA 2B4LA
chains in the Genus database with same CATH topology
1RDXA 5DW8A 1LBYA 4P9KA 4I40A 2VPOA 1YZ0A 3SZPA 3BIGA 4XF5A 4GBWA 5EYHA 4NAPA 4P1EA 4PFRA 4OVSA 5EQAA 4F1VA 1Q9DA 2Y5KA 3PTYA 1FSAA 4P3LA 2KR0A 4O7MA 1NV7A 3HFUA 2ZZWA 5I7IA 1FPBA 4P56A 4NG7A 2BJIA 1IMFA 1FPLA 2WBBA 1YXIA 3W9VA 5IZ3A 2MKZA 5IM2A 2XWVA 3E78A 4H46A 1NV3A 4PFBA 4AS4A 1G0HA 4MNIA 1EYKA 4JVDA 2P3VA 4MNPA 4N8GA 4AS5A 1NUWA 2PFYA 5LTCA 5ET8A 4PBQA 1INPA 4X04A 4P1LA 3A29A 2XWKA 1RDYA 3ROJA 1FBHA 1LBVA 1KA1A 1LBWA 2V3QA 2OX3A 4H45A 1FRPA 5A5LA 2XWIA 1SPIA 4PF8A 4GBVA 2HPGA 5I5PA 2Q74A 3EKIA 2PFZA 4P47A 1VDWA 1FBCA 1K9ZA 2Q8MA 1NV5A 1IMEA 1DCUA 2KQZA 5IZ3B 2VPNA 4PETA 2HZKA 2DVZA 5EYGA 4OANA 4F1UA 4HCWA 4PGNA 1NUXA 2L5VA 5F24A 1FJ9A 2DE4A 1DK4A 1BK4A 1D9QA 4P8BA 3W9WA 5CM6A 2Q9TA 1FPEA 5EQ7A 1JP4A 4OVQA 4MAGA 2HHMA 2OWZA 4HE1A 2QVUA 3IFCA 1QGXA 4DI3D 2FHYA 4N6KA 4F18A 2DE3A 5ESYA 5JK4A 4PTKA 1NV0A 1FJ6A 2HXRA 3LV0A 4O8MA 5T3JA 4PBHA 4N4UA 2QFLA 1IMCA 1IMAA 4M1VA 4MCOA 4DI4B 1FPDA 2V4CA 1G0IA 4GWXA 5LDZA 1DBZA 4NQ8A 2QVVA 1YYZA 3CHGA 2WYKA 4I3YA 2XXKA 1LEVA 1NV2A 5ET5A 5FBPA 4NHBA 2QPQA 4GX3A 4IR8A 3T1BA 4YICA 2CZHA 4JVCA 2GQ1A 4GWSA 4F19A 4NF0A 1FBEA 2HZLA 2CEYA 5J16A 3FXBA 4MX6A 1FPKA 1AWBA 3RYDA 5EQ8A 1FTAA 4XFEA 1KZ8A 2FIXA 3MSTA 1EYJA 3IFAA 4HXVA 4PAKA 4MMPA 3MYUA 1FPJA 1FPGA 5IGAA 4PF6A 1FBFA 3QMFA 5I3SA 4GWZA 1IMBA 1RDZA 2WYPA 3FBPA 2CZIA 4OVTA 2WX9A 4PDDA 4GX4A 2WEFA 3U65A 1IMDA 3D1RA 1NI9A 1FBPA 2F3DA 2WBDA 1NUYA 5EQ9A 4GWUA 4KXPA 2FIEA 4G61A 1NV6A 4YZZA 4FBPA 4MNCA 1NV1A 4N91A 2XWOA 2FVZA 3NOHA 5ET7A 5IZ1A 3RPLA 5IZZA 1LBZA 3BIHA 4MHFA 2Y5LA 3ISPA 4NX1A 4X9TA 3LUZA 2FBPA 4LN5A 2DDKA 2ZZXA 4GWWA 1CNQA 4O94A 4MIJA 3T0JA 3KC0A 4PC9A 4JVIA 2P3NA 4PE3A 4N81A 2CEXA 2CZKA 4PGPA 4HE0A 3B8BA 4GWYA 4NN3A 2VT5A 4UABA 1NUZA 4XEQA 4PCDA 1FPFA 4O7IA 2DE2A 2PCRA 4PDHA 4PFIA 4OVPA 1XI6A 4HE2A 4HCYA 2XA5A 3GYYA 1LBXA 4N17A 4PAFA 4PAIA 1K9YA 4MEVA 5ET6A 2B4MA 4NGUA 1NV4A 4N15A 4QBAA 3KBZA 4OVRA 1FBDA 4I3EA 3KC1A 1EYIA 5J1DA 2F3BA 4MJOA 3B50A 2F5XA 4X8RA 1FPIA 3RPLB 4OA4A 1KA0A 2R8TA 3E79A 2ZZVA 4GX6A 4QXDA 1FBGA 2QVRA 2JJKA 2B4LA 4N8YA 4N6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBP A;  2F3D A;  2WBD A;  5A5L A;  1RDX A;  5DW8 A;  1NUY A;  1LBY A;  5EQ9 A;  1FPD A;  1SPI A;  4GWU A;  4KXP A;  2FIE A;  4G61 A;  4I40 A;  1NV6 A;  4GBV A;  4FBP A;  1YZ0 A;  1G0I A;  1NV1 A;  4GWX A;  3BIG A;  2Q74 A;  2FVZ A;  5LDZ A;  5ET7 A;  5IZ1 A;  1DBZ A;  3RPL A;  2QVV A;  1VDW A;  1LBZ A;  1YYZ A;  1FBC A;  3BIH A;  4GBW A;  1K9Z A;  2Y5L A;  5EYH A;  2Q8M A;  1NV5 A;  1IME A;  4I3Y A;  3LUZ A;  2FBP A;  2DDK A;  1DCU A;  1LEV A;  5IZ3 B;  5EQA A;  4GWW A;  1CNQ A;  1Q9D A;  3T0J A;  1NV2 A;  2Y5K A;  3KC0 A;  5EYG A;  5ET5 A;  2P3N A;  4N81 A;  5FBP A;  1FSA A;  1NUX A;  2CZK A;  4HE0 A;  3B8B A;  4GWY A;  5F24 A;  2VT5 A;  4GX3 A;  1FJ9 A;  1NV7 A;  4IR8 A;  1NUZ A;  1DK4 A;  1BK4 A;  1D9Q A;  2CZH A;  1FPB A;  2GQ1 A;  4GWS A;  2BJI A;  1FPF A;  1IMF A;  1FPL A;  4O7I A;  2WBB A;  2PCR A;  1FBE A;  1YXI A;  1FPE A;  5IZ3 A;  5EQ7 A;  1XI6 A;  5J16 A;  4HE2 A;  1JP4 A;  4H46 A;  1NV3 A;  1LBX A;  1FPK A;  1K9Y A;  1AWB A;  2HHM A;  2OWZ A;  4HE1 A;  3RYD A;  2QVU A;  3IFC A;  5EQ8 A;  1FTA A;  1QGX A;  1IMA A;  4AS4 A;  1G0H A;  1KZ8 A;  2FIX A;  1EYK A;  1EYJ A;  3IFA A;  2FHY A;  2P3V A;  4HXV A;  5ET6 A;  1FPJ A;  1FPG A;  1NUW A;  4AS5 A;  1NV4 A;  5ET8 A;  1INP A;  1FBF A;  3KBZ A;  1FBD A;  3QMF A;  5ESY A;  4I3E A;  3KC1 A;  1EYI A;  2F3B A;  3A29 A;  4MJO A;  5I3S A;  4GWZ A;  1IMB A;  1RDZ A;  4PTK A;  1RDY A;  1FPI A;  1NV0 A;  2CZI A;  3FBP A;  3RPL B;  3ROJ A;  1FBH A;  1KA0 A;  1LBV A;  2R8T A;  1KA1 A;  1LBW A;  1FJ6 A;  4GX6 A;  4GX4 A;  4QXD A;  1FBG A;  2WEF A;  3LV0 A;  2OX3 A;  2QVR A;  5T3J A;  2QFL A;  1IMC A;  2JJK A;  4H45 A;  1FRP A;  1IMD A;  3D1R A;  1NI9 A; 
#chains in the Genus database with same CATH topology
 3PPQ A;  1N04 A;  3OEN A;  4H5G A;  1HSJ A;  3SZP A;  3N94 A;  1MM7 A;  3GZG A;  1QVS A;  3MW0 A;  4LQ5 A;  1A99 A;  5EYH A;  2Y7K A;  4OHN A;  1MS7 A;  4IGR A;  4TOZ A;  4F29 A;  2Z22 A;  2QMW A;  4F1V A;  4ZEC A;  3OMB A;  4DZ1 A;  1VE4 A;  2O1M A;  3O6H A;  2NXO A;  4XKR A;  3GLB A;  4LP2 B;  1MY0 A;  2NOO A;  1NV7 A;  2XXH A;  1AIV A;  3TTK A;  3S4U A;  3HPI A;  2O51 A;  2WBB A;  3W9V A;  1IQ7 A;  3MBP A;  5IM2 A;  4FE8 A;  4H46 A;  4LUB A;  3TZA A;  1MQG A;  5ICQ A;  5TU0 A;  4AS4 A;  2OBG A;  1LST A;  3EHS A;  2DWI A;  4WED A;  5AA2 B;  4JWX A;  3ZKK A;  4MNP A;  3B6T A;  2CZL A;  4AS5 A;  1NNP A;  2XXV A;  4F2Q A;  1M5F A;  2REJ A;  4P1L A;  2Y84 A;  4RPO A;  1RDY A;  1TFD A;  3S9E A;  3G3J A;  4O3C A;  1I69 A;  3ROJ A;  1FBH A;  4R9G A;  1FTM A;  4DLD A;  2UVI A;  2OX3 A;  3LR1 A;  3CFX A;  4NF5 B;  3TTL A;  1FRP A;  5A5L A;  3S9N C;  4R72 A;  3IO4 A;  4PF8 A;  3OO7 A;  3VE1 B;  5I57 A;  3KJ7 A;  3K6V A;  3VXB A;  3CG3 A;  1LAF E;  2A5S A;  4ONY A;  2NUV A;  1B1H A;  1UQW A;  3CR9 A;  1A40 A;  5H8H B;  1NV5 A;  1IME A;  2Z23 A;  3FJM A;  2HFB A;  4EQ7 A;  4G8N A;  3MVX A;  1FQE A;  2HZK A;  4ND9 A;  1UTH B;  3IAZ A;  1A7L A;  4DCY A;  4F1U A;  3FVN A;  2G93 A;  3HST A;  3KN8 A;  3OD7 A;  5CMC A;  3T96 B;  3OEL A;  1H76 A;  4ZEB A;  4YU0 A;  3SEV A;  2HEU A;  5I58 A;  1IXH A;  3W9W A;  3SEY A;  1NH8 A;  2Y7W A;  1JP4 A;  1UIV A;  4OVQ A;  4Q30 B;  4YMA A;  1P1O A;  5B7D A;  4HE1 A;  1Y3P A;  2QVU A;  3IFC A;  1R6Z A;  1MPB A;  5F1Q A;  1UTB B;  4G68 B;  2ZYM A;  3MVZ A;  3E4R A;  2GH9 A;  4MLQ A;  4I1D A;  4QHQ A;  4WKM A;  3RUM A;  3VVE A;  3TAJ A;  3PPP A;  2QL3 A;  1FJ6 A;  4L17 A;  3H7M A;  1B6H A;  3LV0 A;  4O8M A;  4N4U A;  4C0R A;  2GRV A;  1RKM A;  2O69 A;  2O84 X;  5H8N A;  1BKA A;  1R1N A;  3H03 A;  1DTZ A;  4KD5 A;  4KR5 A;  4KI0 E;  1N7X A;  1DTG A;  2D3I A;  5LDZ A;  4FAT A;  3LBS A;  1MH4 A;  4R2F A;  1N0T A;  1SI0 A;  1FQF A;  3N26 A;  2I48 A;  2I6E A;  3SET A;  5ET5 A;  4PQJ A;  3MWB A;  4DXU A;  3IOW A;  3K1M A;  4U21 A;  4U1O A;  5FBP A;  3P7I A;  2CMO A;  1IXI A;  1FQD A;  4QFK A;  2H4I A;  4GXS B;  4IR8 A;  2F97 A;  5L9M A;  5CI5 A;  1FTK A;  4GWS A;  3MUQ A;  4NF4 B;  1YAE A;  5BWJ A;  2XXY A;  4QFN A;  4YKI A;  3IO6 A;  5HPQ A;  4LZ5 A;  4QSC A;  4OET A;  2UYE A;  1FPK A;  1IIT A;  3RYD A;  5EQ8 A;  1RYX A;  4GIZ A;  1MPD A;  1KZ8 A;  4QFP A;  1LGB C;  1EYJ A;  3IFA A;  4PAK A;  3CIJ A;  4MMP A;  2O68 A;  1FPG A;  4QRZ A;  2VD2 A;  1LAX A;  1FBF A;  4HW8 A;  2NWJ A;  2XXU A;  2DYX A;  1MY3 A;  1FQC A;  1RYO A;  3QXM A;  2DWJ A;  1YCJ A;  4ZDM A;  2OZZ A;  2QMX A;  4OTE A;  3QSL A;  2DVC A;  1ZMG A;  2F7C A;  1NUY A;  1URS A;  4GWU A;  1IUD A;  4KXP A;  5AA2 D;  2FIE A;  1A55 A;  2ZYN A;  1NV6 A;  4I8C A;  4N91 A;  4ELR A;  5H8F B;  3QIM A;  4U23 A;  3NOH A;  5DYH A;  3HHG A;  2XX9 A;  4HTG A;  4GOT A;  4NX1 A;  1N7W A;  4X9T A;  2FBP A;  2X26 A;  4O94 A;  4MIJ A;  3O28 A;  3KC0 A;  2HAV A;  1PB9 A;  1Q35 A;  4PE3 A;  4FJP A;  2CEX A;  4RNS A;  3JV9 A;  3JYR A;  4GVO A;  2VT5 A;  1BTJ A;  1NUZ A;  2REG A;  4XKN A;  1VSO A;  2F6G A;  2UVJ A;  3PUY E;  3L6G A;  4MH5 A;  2F36 A;  5H8Q B;  4QSD A;  3FIR A;  2PCR A;  4OES A;  1P1W A;  4R6H A;  2QSX A;  4QSE A;  4R6Y A;  4PAF A;  3C31 A;  3FXQ A;  4MEV A;  1ZLQ A;  3FJ7 A;  1TXF A;  4G4P A;  3PUZ E;  2B4M A;  2R9J A;  4G2Z A;  5I2K B;  1NV4 A;  1B4Z A;  1MPC A;  1EZP A;  1LLS A;  3L6H A;  3V8X B;  2NVU B;  4NMY A;  1FPI A;  4C1U A;  1T0K A;  4LON B;  3E79 A;  1M5E A;  4GX6 A;  5AA2 A;  1LFH A;  1LB8 A;  4LQ2 A;  3OO9 A;  4N6D A;  1FTJ A;  1RDX A;  4P9K A;  5HM4 B;  4I40 A;  2PT2 A;  1YZ0 A;  2RF1 A;  3B7D A;  3PUW E;  1VFD A;  1TT1 A;  1F9B A;  4NAP A;  4NF5 A;  1OVB A;  5DVI A;  1BIY A;  1Q9D A;  4FEC A;  2Y5K A;  1GVC A;  3MP8 A;  1B5I A;  3UK4 A;  2B3B A;  1PDA A;  2I49 A;  3IX1 A;  1NL5 A;  4H6D A;  1QUK A;  2Y7I A;  4ELP A;  5H8H A;  4GD5 A;  1YXI A;  4MLV A;  3OOA A;  3VLU A;  1UTH A;  1NV3 A;  1MXU A;  2F34 A;  5AA3 A;  2HCA A;  3MC2 A;  4YAH X;  4MNI A;  5DT6 A;  1WVJ A;  1MQH A;  1QKB A;  4N8G A;  1US5 A;  4E0X A;  1NUW A;  5DVJ A;  2OPE A;  3ILU B;  1MH3 A;  5ET8 A;  1INP A;  3TCH A;  1AL3 A;  4X04 A;  3PPR A;  3A29 A;  4LVQ A;  3GXA A;  2XWK A;  5DEX B;  4F3B A;  5CMK A;  1LBW A;  2Q88 A;  4BDN A;  1UTB A;  4G68 A;  4JSO A;  4LA9 A;  4O3A A;  1NKX A;  4POW A;  2OCU A;  3HHF A;  3EN3 A;  4NE4 A;  3T9X B;  1PC3 A;  2HPG A;  4ZE9 A;  3G3K A;  2Q2C A;  3T93 B;  1URG A;  4GWO A;  1FBC A;  2X7Q A;  1K9Z A;  1D9V A;  1MG1 A;  5CMB A;  5HBC A;  2KQZ A;  5IZ3 B;  4GF8 A;  3V89 B;  3FUZ A;  1VR5 A;  4PET A;  4PFT A;  2AL5 A;  2DVZ A;  3RN8 A;  1M5C A;  4OAN A;  3O9P A;  4PGN A;  4OWD A;  4BDQ A;  3CFL A;  2L5V A;  1MXZ A;  5F24 A;  1BK4 A;  4XKP A;  4P8B A;  2FA7 A;  5CM6 A;  1FPE A;  3RT8 A;  3V5A A;  4OXV A;  2ZXT A;  2RC9 A;  2QS3 A;  4MAG A;  5CBS A;  1CB6 A;  2OWZ A;  1IEJ A;  1OQG A;  1USY E;  1QGX A;  3PMX A;  1UIU A;  2A5T B;  2DP8 A;  4DI3 D;  2FHY A;  4NF4 A;  1SVX B;  2Z8D A;  4AB5 A;  1N84 A;  1ANF A;  3IK6 B;  4EF2 A;  2B3F A;  4F31 B;  3E13 X;  3K6U A;  3THI A;  2DE3 A;  5ESY A;  3IOT A;  2PVU A;  3FAT A;  5JK4 A;  3F11 A;  2QJE A;  3PMV A;  4U4S A;  5CC2 A;  5ITO A;  2G29 A;  3G3G A;  3PPO A;  1GTK A;  2HXR A;  3Q27 A;  1H43 A;  1IMA A;  1DMB A;  1I6B A;  4M1V A;  5FTH A;  4MCO A;  4F3G A;  4JDF A;  2FNC A;  3M3K A;  4IO3 A;  4Q0C A;  2I3W A;  2V4C A;  4JWY A;  5F7V A;  2IA4 A;  2ZYO A;  3CRB A;  1Y4T A;  4WEP A;  3U8Q A;  3FVG A;  5L9O A;  4NQ8 A;  2THI A;  1YYZ A;  3IB2 A;  2XXK A;  4PFY A;  3H6T A;  1LEV A;  1DOT A;  3U72 A;  4ELQ A;  3KN7 A;  4JWO A;  3MZB A;  4IGT A;  3TTM A;  1NMU A;  2AYS A;  2ZNS A;  3E3K A;  3U93 A;  5H8F A;  2QPQ A;  3EQ1 A;  5EHM A;  4GX3 A;  4YKK A;  4YIC A;  4JVC A;  1M5D A;  3LSX A;  4F19 A;  4XKQ A;  2HZL A;  4NF6 B;  4EQB A;  4EF1 A;  5J16 A;  5KZT A;  3VDF A;  2YLN A;  1AWB A;  2DSF A;  2B65 A;  4ZS9 A;  2FIX A;  1XVX A;  3R7X A;  3FXR A;  3MST A;  1MQD A;  1POT A;  1POY 1;  4OEN A;  4XXU A;  3K01 A;  1D9Y A;  5H8Q A;  3MYU A;  1BP5 A;  2H25 A;  5FHO A;  2ZMB A;  5IGA A;  3IB0 A;  3FV1 A;  2V3U A;  3FGS A;  3QMF A;  5I3S A;  3H6V A;  4GWZ A;  4KQP A;  1IXC A;  4ZEK A;  4OVT A;  3B6W A;  2WX9 A;  2QS2 A;  3O6I A;  2O7I A;  4PDD A;  1B0L A;  4UA8 A;  1XS5 A;  4GX4 A;  2XD2 A;  2V93 A;  3ODB A;  3KJT A;  4OEV A;  4I62 A;  4U1Z A;  4NWC A;  1D4N A;  5I2K A;  4YKJ A;  1NI9 A;  2F3D A;  3TOD A;  1SDX A;  4ISU A;  3VXC A;  1TWY A;  4G61 A;  1GR2 A;  2BJJ X;  4YZZ A;  4MNC A;  2XWO A;  5IZ1 A;  5IZZ A;  4OFJ A;  3PMW A;  2ANJ A;  3H4Z A;  3LUZ A;  1JW5 A;  1JVX A;  1CE2 A;  2DDK A;  2ZZX A;  4K3F A;  5I56 B;  2VGQ A;  4BDR A;  3T0J A;  4DDD A;  4IO2 A;  4PC9 A;  4JVI A;  4G68 C;  2CZK A;  3B8B A;  2AIX A;  4NN3 A;  1PEB A;  4XEQ A;  4PCD A;  1OLC A;  4R75 A;  1S50 A;  1OVT A;  5AE4 A;  4O7I A;  3O2A A;  4PDH A;  4OYV A;  4PFI A;  4EXK A;  4HE2 A;  3QAX A;  3KOT A;  3GYY A;  1LBX A;  3SDF A;  4PAI A;  3QUJ A;  3G3F A;  1B4H A;  1DPP A;  3M8U A;  4MBP A;  4H8J A;  5A5X B;  1I6A A;  5ET6 A;  2V25 A;  5FHN A;  1NNT A;  1ZIU A;  2OJT A;  4GRK A;  2F8D A;  4H5F A;  4NGU A;  4N15 A;  2DXY A;  3SEW A;  1SW2 A;  3MPL A;  4OVR A;  1FBD A;  2X7P A;  1EYI A;  2H98 A;  4MJO A;  4JB7 A;  1FTL A;  2Y7R A;  4Q8R A;  4H0W A;  3UA8 A;  4QFL A;  1FTO A;  2RC7 A;  4OA4 A;  1OQH A;  2ONK E;  1I6Q A;  3FAS A;  4N8Y A;  2XXX A;  3OSR A;  1LAG E;  2ABH A;  3DLN A;  3K1N A;  1A54 A;  1XOC A;  2Y7P A;  1B58 A;  3FV2 A;  5DTB A;  4H67 A;  5DEX A;  4R74 A;  2F7B A;  2ALU A;  4DE8 A;  2I58 A;  1WDN A;  4XF5 A;  4GBW A;  3G7W A;  1B7U A;  4TQU Q;  4PFR A;  1MRP A;  1EU8 A;  1JNF A;  5I2N B;  1JQF A;  1B5J A;  2QS4 A;  3KBR A;  4AB6 A;  2KR0 A;  4O7M A;  3MP1 A;  4OQO A;  2PT1 A;  4KFQ A;  1FPB A;  4NG7 A;  1N3X A;  3CFZ A;  1IMF A;  1FPL A;  1JEV A;  5IAI A;  2HXW A;  1B52 A;  5IZ3 A;  2MKZ A;  4LZ7 A;  1MY2 A;  1MDQ A;  3U94 A;  4R9F A;  3D4G A;  3CSB A;  4C1T A;  4FOR A;  5CBR A;  3QUF A;  3K6W A;  4F3P A;  1EYK A;  1FQA A;  2PBW A;  1OLA A;  4LAT A;  2PFY A;  4H65 A;  5LTC A;  4PBQ A;  3UOR A;  1B3G A;  5ICT A;  3K2D A;  3LC8 A;  4BLA A;  5M2V A;  1KA1 A;  2A5T A;  3ECR A;  3RPW A;  1B3L A;  2V3Q A;  3MZ1 A;  5ISU A;  4FAJ A;  3C32 A;  5B70 A;  3OSQ A;  3MQ9 A;  4DCX A;  1S7Y A;  4GLI A;  2FYI A;  1SW5 A;  4POX A;  4GBV A;  3RNN A;  4DXB A;  1FCK A;  2V3T A;  5I5P A;  3EKI A;  2PFZ A;  1VDW A;  3RY3 A;  1DCU A;  3MAM A;  5EYF A;  2I4B A;  5EYG A;  4HCW A;  3HV1 A;  2I0B A;  1JVY A;  1NUX A;  4NWD A;  1XT8 A;  2RCB A;  1FJ9 A;  1Z7M E;  3OO6 A;  1DK4 A;  1DPE A;  3FXU A;  1LBB A;  3I5O A;  2Q9T A;  4KYD A;  4KYE A;  1NNK A;  5CMM A;  3KG2 A;  3EHU A;  4RJZ A;  4FIM A;  4X1D A;  2ZNT A;  1Y1Z A;  4NF8 B;  3IOU A;  1Y4C A;  2DS9 A;  4F3S A;  1HSE A;  3HN0 A;  4QFO A;  4DIG A;  3K1P A;  1GGG A;  4YMB A;  3VFJ A;  4WXJ A;  4NF6 A;  2F6P A;  2GFE A;  2UVG A;  3SER A;  1PBQ A;  4N13 A;  2PYY A;  4PTK A;  4E0W A;  1B9J A;  1LCF A;  3OEM A;  1NV0 A;  1L5T A;  3U92 A;  2XX7 A;  1B3E A;  3TPA A;  3Q26 A;  4GQO A;  4YB6 A;  4FED A;  4NED A;  2VD3 A;  3O97 A;  1MY1 A;  1OMP A;  4DI4 B;  1FPD A;  3EPE A;  3DEL B;  1G0I A;  4GWX A;  1LFG A;  4GXA A;  3H3G A;  2QVV A;  3CHG A;  4OEU A;  4P0G A;  2WYK A;  3Q28 A;  4P11 A;  2HQ0 A;  1QUI A;  2PX1 A;  1XVY A;  1ELJ A;  1VFE A;  1WOD A;  3OO8 A;  3WAF A;  4OZ9 A;  4F22 A;  1Y20 A;  4NHB A;  3TQL A;  3ILT B;  3T1B A;  1TFA A;  3VVF A;  3MP6 A;  5AA1 A;  2CZH A;  2GQ1 A;  3DM0 A;  3H06 B;  3UIF A;  4ZZA A;  4F2O A;  2E0S A;  4X48 A;  1FBE A;  4EQ9 A;  1ZBM A;  2Z8E A;  2GHB A;  3O6G A;  5I56 A;  2O7U A;  3TFL A;  1Y9U A;  2F7A A;  3FXB A;  3N6T A;  1ZKB A;  2E1S A;  1SW4 A;  2R71 A;  3FJG A;  1B0H A;  4XFE A;  2DXR A;  1AMF A;  1O64 A;  1QKA A;  3CG1 A;  3IL1 B;  1B32 A;  1NFT A;  4BDM A;  2P2A A;  1LBC A;  3O29 A;  1FPJ A;  1JW1 A;  1URD A;  4H1X A;  3KEI A;  1B46 A;  4DXC A;  3SES A;  3O66 A;  1IMB A;  5H8S A;  1RDZ A;  3V83 A;  3LSW A;  1XC1 A;  4YB7 A;  5A5X A;  5KDT B;  3TTR A;  4IY6 A;  5AA4 B;  4THI A;  3RGY A;  4BDO A;  1B3H A;  1O63 A;  1R9L A;  3U65 A;  3D1R A;  5TPA B;  3TUS A;  3G3H A;  3JZJ A;  4OMB A;  5L9S A;  3A09 A;  4FBP A;  1NV1 A;  3I3V A;  5ET7 A;  4Q5T A;  4PP0 A;  1AOV A;  1N3W A;  3TKD A;  3QYT A;  2Y5L A;  2I0C A;  3ISP A;  1ZTY A;  3VVD A;  4LN5 A;  5BUU A;  4GWW A;  2D5W A;  1B40 A;  2DQV A;  2P3N A;  4N81 A;  4N07 A;  2XHD A;  4HE0 A;  4GWY A;  1JET A;  2O6A A;  4UAB A;  4ESX A;  2P0S A;  1IIW A;  3U1O A;  3M3L A;  3C33 A;  4QF9 A;  2DE2 A;  2RKM A;  4X1B A;  5I2N A;  4N17 A;  4JBZ A;  3TYH A;  2UVH A;  4NTL A;  2VHA A;  1J1N A;  4U2R A;  1MXW A;  5K2X A;  2PMS A;  4KCC A;  4G8H A;  5IKB A;  3TDJ A;  3HO7 A;  3G3I A;  3GBA A;  2M8C A;  4I3E A;  3KC1 A;  2Q8J A;  4IO6 A;  1KWH A;  4ESW A;  2F5X A;  2OK2 A;  1QW0 A;  3RPL B;  2ESN A;  1KA0 A;  3H6U A;  2R8T A;  3KN3 A;  1FBG A;  2QVR A;  5I59 B;  4RPN A;  3TEP A;  3RLF E;  2JJK A;  5TP9 B;  3T9H B;  3WAE A;  2H99 A;  5DW8 A;  1LBY A;  2XD3 A;  4KYS A;  1ZU0 A;  2O1L A;  3AXF A;  2VPO A;  2HAU A;  5KCJ B;  3BIG A;  3IJO B;  4M4G A;  3ZS6 A;  3KZG A;  3IB1 A;  3KFM A;  3TCG A;  4P1E A;  3B6Q A;  1P1U A;  4OVS A;  5EQA A;  2H5Y A;  2DWH A;  4YKP A;  1MY4 A;  3PTY A;  4RA1 A;  4IO7 A;  1EZ9 A;  1B2H A;  1FSA A;  4P3L A;  3IOV A;  1GV8 A;  2QRY A;  5JTY B;  2LAO A;  3HFU A;  2RIN A;  2XXQ A;  2ZZW A;  4P56 A;  5I7I A;  3IJX B;  4YB5 A;  2BJI A;  1P1Q A;  1MM6 A;  3H6W A;  4BDL A;  5LOM A;  3E78 A;  2XWV A;  4G8M A;  1XHY A;  3TQW A;  4R2B A;  1QUJ A;  3R26 A;  4PFB A;  1G0H A;  4JXI A;  3S9L C;  2IEE A;  1P1N A;  1MXX A;  4JVD A;  3I6V A;  2P3V A;  1HSL A;  3C4M A;  5CRY A;  1B7Z A;  5L8D A;  4NF8 A;  1MXY A;  1LBV A;  3N6U A;  5I84 A;  3E9X A;  1PBP A;  4RK9 A;  3GBB A;  3FZV A;  1H45 A;  4H45 A;  3ZSF A;  3PU5 A;  4KPT A;  2XXP A;  3C36 A;  2XWI A;  2XXT A;  3MJN A;  1SPI A;  3C9H A;  4KHZ E;  1H44 A;  2GHA A;  2Q74 A;  3MPK A;  1LAH E;  3MVW A;  1Y3N A;  4P47 A;  3MZ9 A;  2Q8M A;  3D4C A;  1JEU A;  1LB9 A;  2VPN A;  3UGW A;  1R9Q A;  3W15 C;  4XTC Q;  2WKY A;  1USY H;  3DP8 A;  3KSJ A;  3PV0 E;  1MDP 1;  2RCA A;  2XXI A;  2DE4 A;  1MXV A;  1D9Q A;  3RT6 B;  1EH3 A;  3IOR A;  2I4C A;  2AL4 A;  2KLF A;  5EQ7 A;  4IB2 A;  3ZKL A;  1SYI A;  3T9V A;  1S9T A;  3C35 A;  1O7T A;  1SI1 A;  2HHM A;  3LSL A;  1IXG A;  4JSD A;  4OFL A;  2F78 A;  1Y1M A;  4ZE8 A;  4PFU A;  2D21 A;  1B05 A;  3PD8 A;  4TLL B;  3UP9 A;  3TEL A;  2W7Y A;  4N6K A;  4F18 A;  1QUL A;  3LUY A;  3CI8 A;  1A8E A;  1NH7 A;  3VLW A;  2VOZ A;  2Z8F A;  3PD9 A;  2Q89 A;  2F35 A;  3Q29 A;  5I57 B;  1SQY A;  3RTF B;  3K02 A;  3Q25 A;  3VLV A;  3IR1 A;  3LSF B;  4I9D A;  1JW4 A;  3RQT A;  2V84 A;  5T3J A;  1M5B A;  3K00 A;  4H8I A;  4PBH A;  2QFL A;  1IMC A;  3TCF A;  4IY5 A;  3BFT A;  3PUX E;  3TMG A;  4TLM B;  3BFU A;  3A3C A;  1A8F A;  1DBZ A;  3OEK A;  5KDT A;  4PE5 B;  5DVF A;  5AA4 A;  5I58 B;  4I3Y A;  4LZ8 A;  1NNF A;  1US4 A;  3FVO A;  5TPA A;  3VV5 A;  4EXL A;  1NV2 A;  3CVG A;  4HS7 A;  2UYF A;  4Z0I A;  3KSX A;  1B7H A;  3PPN A;  2R6G E;  2I3V A;  3KGC A;  4ZED A;  5FHM A;  3T66 A;  1QJM A;  2YJP A;  2RC8 A;  3PGF A;  4NF0 A;  2ONR A;  2CEY A;  3K6X A;  4EUO A;  3S9M C;  4MX6 A;  3S2V A;  1SW1 A;  3USD A;  3KOS A;  3FD3 A;  2ZYK A;  1FTA A;  1YTV A;  3K4U A;  3BKI B;  3DP6 A;  4XIG Q;  2DWA A;  4HXV A;  4ELO A;  1P99 A;  4MFI A;  4R6K A;  5H8N B;  4PF6 A;  4Z7E A;  4FEB A;  1D3K A;  1SBP A;  5ITP A;  3CSG A;  4RK2 A;  2XXR A;  2QS1 A;  4EDP A;  2WYP A;  4G77 A;  4OVJ A;  3UN6 A;  3M3F A;  4AQ4 A;  3FBP A;  2CZI A;  2DOJ A;  4O3B A;  4MF3 A;  2OWS A;  2WEF A;  4GFR A;  3MVY A;  3QK6 A;  1B5H A;  1IMD A;  3EHT A;  1FBP A;  2WBD A;  1IZ1 A;  4RY1 A;  5EQ9 A;  5FTI A;  1MQI A;  1EZO A;  4KCD A;  1Y3Q A;  1PB8 A;  2OPD A;  2H9B A;  2FVZ A;  3RPL A;  4RYA A;  4ECF A;  1LBZ A;  2P1S A;  4PFW A;  3BIH A;  4MHF A;  2ONS A;  3TTN A;  3C34 A;  5I59 A;  4N6P A;  1N76 A;  2OWT A;  3DP4 A;  5TP9 A;  1CNQ A;  2XX8 A;  1MQJ A;  1II5 A;  3SEU A;  1ATG A;  4OER A;  5KCJ A;  1YPN A;  4PGP A;  4U22 A;  3K0V A;  2XXW A;  2OLB A;  2ZNU A;  5JEI A;  4ZEF A;  1FPF A;  1ZJL A;  3HCQ A;  1FW0 A;  2VP1 A;  1PB7 A;  4R73 A;  3FVK A;  4IO5 A;  5EHS A;  4OVP A;  1XI6 A;  1DSN A;  3SEX A;  2YPN A;  1B3F A;  2XA5 A;  4HCY A;  3N5L A;  1Q1K A;  1K9Y A;  3PUV E;  1B1X A;  1B51 A;  5JTY A;  4F1Y A;  4P0I A;  1FQB A;  3OXN A;  1Z7N E;  3T22 A;  4GL0 A;  4ZZE A;  1H3D A;  4QBA A;  1SD3 A;  3KBZ A;  4OFO A;  3BBR A;  5J1D A;  2F3B A;  4U4X A;  3SKP A;  4F39 A;  3R6U A;  4RXL A;  5ELV A;  4ZEI A;  3RTW B;  4GL8 A;  3B50 A;  3EF7 A;  1AH5 A;  4X8R A;  2UXA A;  4IO4 A;  5K2Y A;  4UAC A;  1BLF A;  2Q2A A;  3A3U A;  1LCT A;  2ZZV A;  3T9U A;  1SYH A;  1OIB A;  4QXD A;  3ONM A;  1LFI A;  2B4L A; 
#chains in the Genus database with same CATH homology
 1RDX A;  5DW8 A;  1LBY A;  4P9K A;  4I40 A;  2VPO A;  1YZ0 A;  3SZP A;  3BIG A;  4XF5 A;  4GBW A;  5EYH A;  4NAP A;  4P1E A;  4PFR A;  4OVS A;  5EQA A;  4F1V A;  1Q9D A;  2Y5K A;  3PTY A;  1FSA A;  4P3L A;  2KR0 A;  4O7M A;  1NV7 A;  3HFU A;  2ZZW A;  5I7I A;  1FPB A;  4P56 A;  4NG7 A;  2BJI A;  1IMF A;  1FPL A;  2WBB A;  1YXI A;  3W9V A;  5IZ3 A;  2MKZ A;  5IM2 A;  2XWV A;  3E78 A;  4H46 A;  1NV3 A;  4PFB A;  4AS4 A;  1G0H A;  4MNI A;  1EYK A;  4JVD A;  2P3V A;  4MNP A;  4N8G A;  4AS5 A;  1NUW A;  2PFY A;  5LTC A;  5ET8 A;  4PBQ A;  1INP A;  4X04 A;  4P1L A;  3A29 A;  2XWK A;  1RDY A;  3ROJ A;  1FBH A;  1LBV A;  1KA1 A;  1LBW A;  2V3Q A;  2OX3 A;  4H45 A;  1FRP A;  5A5L A;  2XWI A;  1SPI A;  4PF8 A;  4GBV A;  2HPG A;  5I5P A;  2Q74 A;  3EKI A;  2PFZ A;  4P47 A;  1VDW A;  1FBC A;  1K9Z A;  2Q8M A;  1NV5 A;  1IME A;  1DCU A;  2KQZ A;  5IZ3 B;  2VPN A;  4PET A;  2HZK A;  2DVZ A;  5EYG A;  4OAN A;  4F1U A;  4HCW A;  4PGN A;  1NUX A;  2L5V A;  5F24 A;  1FJ9 A;  2DE4 A;  1DK4 A;  1BK4 A;  1D9Q A;  4P8B A;  3W9W A;  5CM6 A;  2Q9T A;  1FPE A;  5EQ7 A;  1JP4 A;  4OVQ A;  4MAG A;  2HHM A;  2OWZ A;  4HE1 A;  2QVU A;  3IFC A;  1QGX A;  4DI3 D;  2FHY A;  4N6K A;  4F18 A;  2DE3 A;  5ESY A;  5JK4 A;  4PTK A;  1NV0 A;  1FJ6 A;  2HXR A;  3LV0 A;  4O8M A;  5T3J A;  4PBH A;  4N4U A;  2QFL A;  1IMC A;  1IMA A;  4M1V A;  4MCO A;  4DI4 B;  1FPD A;  2V4C A;  1G0I A;  4GWX A;  5LDZ A;  1DBZ A;  4NQ8 A;  2QVV A;  1YYZ A;  3CHG A;  2WYK A;  4I3Y A;  2XXK A;  1LEV A;  1NV2 A;  5ET5 A;  5FBP A;  4NHB A;  2QPQ A;  4GX3 A;  4IR8 A;  3T1B A;  4YIC A;  2CZH A;  4JVC A;  2GQ1 A;  4GWS A;  4F19 A;  4NF0 A;  1FBE A;  2HZL A;  2CEY A;  5J16 A;  3FXB A;  4MX6 A;  1FPK A;  1AWB A;  3RYD A;  5EQ8 A;  1FTA A;  4XFE A;  1KZ8 A;  2FIX A;  3MST A;  1EYJ A;  3IFA A;  4HXV A;  4PAK A;  4MMP A;  3MYU A;  1FPJ A;  1FPG A;  5IGA A;  4PF6 A;  1FBF A;  3QMF A;  5I3S A;  4GWZ A;  1IMB A;  1RDZ A;  2WYP A;  3FBP A;  2CZI A;  4OVT A;  2WX9 A;  4PDD A;  4GX4 A;  2WEF A;  3U65 A;  1IMD A;  3D1R A;  1NI9 A;  1FBP A;  2F3D A;  2WBD A;  1NUY A;  5EQ9 A;  4GWU A;  4KXP A;  2FIE A;  4G61 A;  1NV6 A;  4YZZ A;  4FBP A;  4MNC A;  1NV1 A;  4N91 A;  2XWO A;  2FVZ A;  3NOH A;  5ET7 A;  5IZ1 A;  3RPL A;  5IZZ A;  1LBZ A;  3BIH A;  4MHF A;  2Y5L A;  3ISP A;  4NX1 A;  4X9T A;  3LUZ A;  2FBP A;  4LN5 A;  2DDK A;  2ZZX A;  4GWW A;  1CNQ A;  4O94 A;  4MIJ A;  3T0J A;  3KC0 A;  4PC9 A;  4JVI A;  2P3N A;  4PE3 A;  4N81 A;  2CEX A;  2CZK A;  4PGP A;  4HE0 A;  3B8B A;  4GWY A;  4NN3 A;  2VT5 A;  4UAB A;  1NUZ A;  4XEQ A;  4PCD A;  1FPF A;  4O7I A;  2DE2 A;  2PCR A;  4PDH A;  4PFI A;  4OVP A;  1XI6 A;  4HE2 A;  4HCY A;  2XA5 A;  3GYY A;  1LBX A;  4N17 A;  4PAF A;  4PAI A;  1K9Y A;  4MEV A;  5ET6 A;  2B4M A;  4NGU A;  1NV4 A;  4N15 A;  4QBA A;  3KBZ A;  4OVR A;  1FBD A;  4I3E A;  3KC1 A;  1EYI A;  5J1D A;  2F3B A;  4MJO A;  3B50 A;  2F5X A;  4X8R A;  1FPI A;  3RPL B;  4OA4 A;  1KA0 A;  2R8T A;  3E79 A;  2ZZV A;  4GX6 A;  4QXD A;  1FBG A;  2QVR A;  2JJK A;  2B4L A;  4N8Y A;  4N6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...