3KC1A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 19a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 97
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc1A02
4O7IA 1NUWA 1FTAA 5J16A 3KC1A 5I3SA 4I40A 1FBGA 1FPLA 1CNQA 2WEFA 1KA0A 1G0IA 2WBDA 4GWUA 2VT5A 1EYJA 5ET6A 3B8BA 2FHYA 2P3VA 3BIGA 2QVUA 1BK4A 1NV0A 1FSAA 1FJ9A 3A29A 3RPLB 5A5LA 2CZKA 4KXPA 1NV6A 1XI6A 2Y5LA 1FPKA 4GWWA 1INPA 5ESYA 1D9QA 1IMAA 4QXDA 1FPIA 3T0JA 2JJKA 3KC0A 4H46A 5IZ3B 3IFCA 1SPIA 4GX3A 2QVRA 1IMEA 1LBZA 2F3BA 5FBPA 1NV2A 5ET7A 1NI9A 1K9ZA 2QFLA 1DK4A 4HE1A 1RDYA 5EYGA 1LBVA 2HHMA 3RYDA 1QGXA 4H45A 3ROJA 3FBPA 1Q9DA 2F3DA 1K9YA 1FPFA 1LBYA 2FVZA 4PTKA 3IFAA 4N81A 1NUYA 3LUZA 2P3NA 5ET5A 1IMCA 1FPJA 2GQ1A 3D1RA 3LV0A 1YZ0A 1FBPA 1NV4A 1G0HA 1FPGA 4MJOA 1LBXA 5DW8A 5F24A 1IMDA 5T3JA 1FPDA 1NUXA 5ET8A 4HXVA 2Q8MA 1NV3A 4HE2A 1IMFA 1FJ6A 1RDZA 4GX6A 2OX3A 4GX4A 2Y5KA 2QVVA 3KBZA 4GWSA 5EQ7A 5EQAA 1JP4A 5IZ1A 1DCUA 1YYZA 1NV7A 2BJIA 4GWZA 4FBPA 2FBPA 1FPBA 4I3EA 5EYHA 4AS5A 4GWYA 3QMFA 3RPLA 2WBBA 1FBHA 1FRPA 1DBZA 1EYIA 4GBWA 4HE0A 4I3YA 1AWBA 4GWXA 1IMBA 2Q74A 2FIXA 1NV5A 2FIEA 5IZ3A 1FBEA 1FBFA 1VDWA 1FPEA 2CZIA 1KZ8A 4G61A 1FBCA 2CZHA 4GBVA 2R8TA 5LDZA 2DDKA 1EYKA 1FBDA 1RDXA 3BIHA 4IR8A 5EQ8A 1KA1A 1NV1A 2PCRA 1YXIA 1NUZA 1LEVA 5EQ9A 4AS4A 2OWZA 1LBWA
chains in the Genus database with same CATH superfamily
3S9EA 2Y7IA 1FBGA 1R1NA 3LC8A 4ESXA 3KBRA 1Y4TA 2DXRA 1WDNA 3Q27A 4KYDA 3KG2A 3C31A 3QAXA 1UQWA 3M3KA 3LSXA 1INPA 3JZJA 3I6VA 2JJKA 5CBRA 1QUKA 4EDPA 1IMEA 5KDTA 4LUBA 3K2DA 3OSRA 1UTBA 4P1EA 2DYXA 3RT6B 4RY1A 2FNCA 1QJMA 1TXFA 2XXHA 3UN6A 3P7IA 4XXUA 1B05A 4PDDA 2FVZA 4OENA 1YZ0A 1IXHA 2GHBA 1FW0A 1DPPA 3MQ9A 4U1OA 3T66A 3SETA 2DVZA 1RDZA 2R6GE 1OLCA 5IZ1A 4X9TA 4MAGA 4RYAA 4FBPA 1H44A 2V84A 4C1UA 1D3KA 3SEXA 1SQYA 4GWYA 4MFIA 2PMSA 5I58B 1NH8A 2F36A 4P0GA 2ONRA 4TLLB 5CBSA 4TQUQ 3VDFA 2ZNTA 1VDWA 3UK4A 1H45A 3MVWA 2QS2A 2VGQA 1N76A 3TKDA 3IX1A 3I3VA 4PE3A 4MBPA 4OVRA 4OVJA 4OHNA 1AL3A 4RA1A 4Q5TA 2CEXA 3PMXA 5CRYA 1B3LA 3TMGA 3QUJA 2VT5A 1B3FA 1I6AA 2XWIA 3U72A 2F97A 3G3FA 3JYRA 1H3DA 2F6GA 1P99A 4N13A 2PT1A 3M8UA 4MHFA 3T0JA 1B7UA 2H98A 3T22A 5ET7A 3FVGA 1IITA 4PCDA 1NI9A 4DLDA 2F8DA 4YB5A 5EYGA 2V25A 1N7WA 3K6VA 2XXIA 4FE8A 5H8HB 1Y3NA 3LUZA 3RGYA 1DOTA 1LAHE 1XOCA 4EQ9A 1MXVA 3ILUB 4N07A 2Y84A 2RC9A 3IB2A 3VV5A 5F24A 3H03A 5I2KB 4E0WA 3PV0E 3OO7A 4HTGA 4QFNA 5DVJA 1MXUA 4NF5B 3MVZA 4NMYA 2OK2A 5LTCA 1VE4A 3VLVA 5L8DA 2YPNA 2HXWA 1DBZA 5I2NB 4GBWA 2A5TA 5IZ3A 1MDQA 3GYYA 1MM7A 1PBQA 3PUZE 4OVTA 3CIJA 3G7WA 3KSJA 2F7AA 4H8IA 4O94A 1XHYA 1US5A 2HQ0A 3WAFA 1NUZA 1LEVA 1B3GA 2WYKA 4DXBA 3IJXB 4JWOA 2MKZA 1MQGA 4QFKA 1Y4CA 2XX9A 3DELB 2P3VA 1PDAA 2O1MA 1VFEA 3TDJA 4C1TA 4G8NA 3RPLB 2P2AA 1B32A 4POXA 4GL8A 4P1LA 4NX1A 4H67A 1FPIA 1YCJA 1JW1A 5JK4A 4HCYA 4POWA 3ZS6A 4ELOA 1K9ZA 3IL1B 4ZEBA 3L6GA 1EZ9A 1QKAA 2F3DA 3ZSFA 2AYSA 4PBQA 1NNPA 1PEBA 1MXZA 4N6DA 4QRZA 4IGRA 1S7YA 2HZKA 2UXAA 4WEPA 2B65A 1LBXA 1NUXA 2X26A 4F19A 2DS9A 4PDHA 4N8GA 1NV3A 4ZE8A 4JB7A 4DDDA 2FYIA 2H99A 2O84X 4AB5A 1LFIA 1WVJA 1D9VA 5EYHA 3H6WA 3OMBA 2V4CA 5I57B 3E3KA 1FBHA 4PBHA 1AIVA 1QULA 3MPKA 4G8MA 4OFOA 4EF1A 3OO8A 4Q30B 3BFTA 3E79A 2M8CA 3IO6A 3O6HA 5B70A 4DCXA 4JVCA 4YKIA 4H8JA 1B5HA 4OANA 1FTKA 3BIHA 1SDXA 4JVDA 3G3HA 1YXIA 4ZS9A 1JW5A 1FPGA 5KDTB 3OEMA 1OVTA 4Q0CA 1UTBB 2ZYKA 3KSXA 3HSTA 1B51A 3SEUA 2PBWA 5F1QA 1XC1A 2O7UA 4MMPA 1ZU0A 3E4RA 1MQIA 4MCOA 3F11A 3KN3A 5IGAA 4ZZAA 4F2QA 1FPKA 3DP6A 5DVFA 3TPAA 5KZTA 2I0CA 3O6GA 3B6QA 5I59B 2REJA 2XXTA 2Q8JA 5HPQA 4G2ZA 2Q89A 1QKBA 4NN3A 3Q29A 4EXKA 3OEKA 1QGXA 4H45A 3FBPA 2QS4A 4OQOA 1KWHA 4QF9A 4U1ZA 1M5BA 1ZBMA 1LFGA 3CVGA 2QRYA 4GXAA 4EQ7A 4N81A 1MPCA 4NF0A 3DP8A 5K2YA 4HXVA 5ICTA 1SW4A 2Q9TA 3CHGA 2Q2AA 2NXOA 3O2AA 1B40A 3CSGA 4GWZA 3MZBA 4PC9A 2UVHA 1B0LA 1GGGA 1IMBA 4IO7A 2FIEA 1Y3QA 2O6AA 3TCGA 4OWDA 3FUZA 3DM0A 2CZIA 1LSTA 4YB6A 2NUVA 1FBCA 2P0SA 4LZ7A 4G68C 1O64A 2RCAA 4IO2A 3TZAA 1UTHA 5H8HA 1S9TA 4HCWA 3ILTB 3IAZA 4OVSA 1MRPA 3CFXA 4O7IA 3VXBA 4BDMA 4G8HA 1WODA 1DSNA 2OJTA 1MPDA 4NF4A 1YTVA 3FZVA 1LBBA 5TP9A 3MZ9A 1NV0A 1VSOA 4MH5A 2OPDA 2AIXA 2Y5LA 2W7YA 2F7CA 1MY0A 2ZYNA 3KGCA 3IFCA 1SPIA 4GX3A 4F29A 1LBZA 1MXXA 2DWHA 4KCCA 1A8FA 3VLWA 1DK4A 5HBCA 3T1BA 1US4A 3C34A 1DTGA 2Y7RA 1MH4A 3FVNA 3ROJA 4RNSA 2OPEA 1B9JA 2QMXA 1FTOA 2A5TB 3LV0A 1P1WA 1NV4A 3VE1B 4MJOA 1IMDA 4F18A 4GIZA 4PFUA 1FTMA 1Q35A 1SYIA 4HS7A 5TU0A 1BP5A 3QMFA 3TCHA 3RPLA 4PGPA 4U23A 2UVJA 4GWXA 1YPNA 1DTZA 3TCFA 4OESA 1FBFA 3FVKA 1ZJLA 3FVOA 3Q28A 2Y7WA 1EYKA 4LN5A 2DWIA 1D4NA 3FXQA 3U92A 2PCRA 3ZKLA 4ELQA 2R71A 1XVYA 4RJZA 4I40A 3H4ZA 3K1NA 4OMBA 4NE4A 4XF5A 3NOHA 3DLNA 4P8BA 1LCTA 3FXBA 4ELRA 1FJ9A 3CSBA 2CZKA 1NV6A 5FTHA 2NOOA 3LUYA 4LA9A 4F3BA 1BIYA 4MLQA 2ZZWA 4H65A 3TTNA 3UP9A 2DE2A 4H0WA 1N84A 4FIMA 1NNFA 3IOWA 3KOTA 3OELA 1OLAA 1RDYA 3SDFA 4E0XA 4DXUA 1USYE 1VFDA 4IB2A 4F39A 1MQHA 1PBPA 2WX9A 2HAUA 1B7ZA 3VFJA 4KHZE 3CG3A 1IEJA 1NKXA 4LVQA 5FTIA 3FIRA 3K6UA 1CE2A 1O7TA 4UA8A 3FXUA 4KYSA 5ET8A 1ELJA 2G93A 2XXPA 4FEBA 4PQJA 4XKQA 5H8QB 3D4CA 3HHGA 5EQAA 2PVUA 4H5FA 1MG1A 1SD3A 1LB9A 4AS5A 3B6WA 3EKIA 4BLAA 5JEIA 4ECFA 3FV2A 2HFBA 2G29A 2WBBA 3Q25A 2YLNA 2NVUB 4I3YA 4EF2A 5AA4A 3R7XA 2VOZA 1Y1ZA 5I59A 3SZPA 2Q88A 3V5AA 2ZNSA 3G3IA 3KOSA 3K1PA 4X04A 4OFLA 4LQ5A 4ISUA 5EQ8A 1F9BA 4I8CA 3PU5A 1FQCA 5EQ9A 2ZZXA 4ZECA 3T9VA 1O63A 3UIFA 1LAFE 2Z8DA 2V93A 3EHTA 2H4IA 3VVEA 5M2VA 1MY4A 3OO9A 4KXPA 2F78A 4U4XA 3G3KA 1B7HA 2ANJA 3U8QA 3MP8A 4FECA 4XEQA 2QFLA 1P1NA 4HE1A 3FV1A 4AB6A 5CMBA 3UGWA 3RYDA 1BTJA 5FHNA 4TOZA 4QSCA 2VD3A 4LP2B 1FPFA 1ZIUA 4EQBA 2THIA 3GZGA 4QFLA 3VLUA 4X1DA 2OWSA 3TFLA 3C36A 2I49A 1Q1KA 4I9DA 3KBZA 1YYZA 1UTHB 3JV9A 2I48A 4GWOA 5A5XA 1S50A 3KFMA 2RF1A 4OEUA 5AA3A 3UA8A 2AL4A 3HHFA 3LBSA 4KFQA 1FQDA 1NV5A 3U94A 1JVXA 4NF4B 1MXYA 3QSLA 1KZ8A 5TP9B 4NWCA 4EUOA 2ZYOA 2R8TA 2ZYMA 3K6WA 4F1YA 2R9JA 4R72A 4DI3D 3SEVA 1OIBA 4NAPA 1VR5A 4YB7A 3OO6A 3IB1A 2PFZA 5DTBA 3PPPA 2ZXTA 2OBGA 2OLBA 3UORA 1PB8A 2H5YA 3GBAA 2QSXA 4GQOA 3USDA 5ICQA 1Y3PA 1I69A 3EQ1A 4QBAA 3K00A 3C9HA 2QVUA 4PFIA 2V3UA 1ATGA 2BJJX 4L17A 3O6IA 3BKIB 1ZKBA 1GV8A 2XXKA 1ANFA 4QXDA 1GTKA 1OQHA 4GXSB 2F3BA 5FBPA 5FHMA 4H6DA 2D3IA 2IA4A 1LBVA 4P0IA 4PETA 4YU0A 1PC3A 2QL3A 4ND9A 3BFUA 3MP1A 3O9PA 4OEVA 3N5LA 2GQ1A 4N6PA 5IM2A 2GH9A 2HEUA 2V3QA 5ITOA 4YICA 1MPBA 5DW8A 4OA4A 3PUXE 4Q8RA 4HW8A 1FJ6A 3S9NC 4GF8A 3QK6A 2V3TA 2I0BA 5CMKA 2RCBA 4ZEDA 3GBBA 1NV7A 4KR5A 3IORA 2Z8FA 3PPRA 4QFOA 2ESNA 3IO4A 4X8RA 1MY3A 1SI1A 3IOVA 5DT6A 4DI4B 1IZ1A 4F22A 1SW2A 4HE0A 1JW4A 2Q74A 2E1SA 2XXYA 2F6PA 2O69A 3K0VA 4IY5A 3PUYE 3VVDA 1B0HA 4GBVA 5JTYA 2DDKA 4NGUA 1RKMA 4U21A 4AS4A 5AA2D 4DIGA 4PP0A 1QVSA 5H8FA 1B58A 1JETA 3T9UA 4PE5B 1B52A 1CNQA 3O97A 4LATA 2XD2A 2PYYA 3HV1A 2ZZVA 3H6UA 3HO7A 4R2BA 4WEDA 5AA2A 1M5DA 2DWAA 2RKMA 4Z0IA 1FQEA 5H8QA 3PPNA 3T93B 2CZLA 4PF6A 4M4GA 1GVCA 4NG7A 4PFYA 4BDQA 3B7DA 3OD7A 3L6HA 4RK9A 2XHDA 5KCJA 3MBPA 4YKKA 4QSDA 1B3HA 4DXCA 1DMBA 4GD5A 3CRBA 4F31B 1HSLA 1MQDA 4M1VA 4BDOA 5CMCA 1FQBA 5BWJA 3MUQA 2UYFA 5ET5A 3FJGA 5AA4B 1FPDA 5I84A 1USYH 1LGBC 4BDNA 2Y5KA 3IJOB 1JP4A 5IZZA 3MAMA 5DVIA 1FPBA 3QYTA 4IO5A 3PD9A 1I6BA 2GFEA 1LAGE 4FEDA 5H8SA 1D9YA 4G61A 1MDP1 4P47A 1LCFA 5I56A 3O66A 3MJNA 1NFTA 2KQZA 4BDLA 3THIA 4OTEA 1FTAA 2B3FA 2VP1A 3KC1A 4JDFA 4XTCQ 5DEXA 1G0IA 4U4SA 2F35A 3W9WA 2O1LA 2ALUA 1FSAA 3PMVA 2H9BA 4NF8A 3FJ7A 1N0TA 3BBRA 3LR1A 1L5TA 1M5FA 2I3WA 2XXWA 4KCDA 4IO6A 3K6XA 4PFRA 1AOVA 3ZKKA 1FQFA 1URGA 4PAKA 2XA5A 4QSEA 3U65A 4MLVA 4DZ1A 4UABA 4LZ8A 1TFAA 4R6HA 1JEVA 2LAOA 4K3FA 5A5XB 4PGNA 3RY3A 1K9YA 1TFDA 3KEIA 1SVXB 3A3UA 1T0KA 1NUYA 1BLFA 1IMCA 4XFEA 4N4UA 1TT1A 4IY6A 2UVGA 1JVYA 3EN3A 3C32A 1YAEA 4R73A 4WKMA 4JWXA 3G3JA 3TTMA 2OX3A 1B6HA 2XX7A 4JBZA 4F3SA 2XD3A 3KJ7A 5CM6A 4I3EA 3RQTA 1PB7A 4YAHX 1EYIA 3TTKA 1AWBA 4F3PA 2HXRA 3RTWB 2DWJA 3FGSA 5LOMA 4GL0A 3OENA 1M5EA 1RDXA 4F2OA 2NWJA 3QXMA 1SBPA 4OVPA 1P1UA 4MNIA 1B1HA 3TELA 1FTLA 1HSJA 1B3EA 5AE4A 1EYJA 4JSOA 2DE3A 2FHYA 2Y7KA 2UVIA 1MY2A 3TQWA 1D9QA 3MSTA 3SEYA 4N17A 3MYUA 3CG1A 5J1DA 2QS3A 3PTYA 3OOAA 5IKBA 3TTLA 4XIGQ 4O7MA 2Z23A 4OETA 2L5VA 3GXAA 1RYXA 2F7BA 3IFAA 2O51A 3TTRA 1G0HA 4KI0E 1B1XA 2RINA 3H7MA 1LFHA 4HE2A 5JTYB 3V83A 3M3LA 3KJTA 3PMWA 1B46A 2B4MA 3I5OA 4F1VA 1Y1MA 3N6TA 5H8FB 3TEPA 2QS1A 3KN8A 4OVQA 3CFZA 1UIUA 4OERA 4P3LA 3PUVE 5ISUA 5AA2B 3LSWA 3RTFB 5TPAA 3GLBA 1IXGA 2I6EA 4LQ2A 1FBDA 3MP6A 1SW1A 1NMUA 1IIWA 5IAIA 1KA1A 1NV1A 2H25A 2QVRA 3W15C 1LBCA 2REGA 2WKYA 1QUIA 1SI0A 5KCJB 3WAEA 4N91A 3EHUA 3E9XA 4DE8A 5ET6A 5H8NA 3A09A 4ELPA 5I7IA 3IR1A 4G68A 2ABHA 2HPGA 2I58A 3SESA 4BDRA 2KLFA 3KC0A 1JNFA 1B5JA 4QFPA 4R6KA 1NV2A 5K2XA 4C0RA 1R6ZA 3T9XB 2HHMA 4ONYA 4U22A 2DE4A 2DOJA 1P1OA 1QUJA 3HCQA 1LBYA 3FJMA 2P3NA 3D1RA 4NQ8A 4R75A 3T96B 3EHSA 4P9KA 2O68A 4Z7EA 5T3JA 2VPNA 3H6VA 2GHAA 5I56B 1Z7ME 3PD8A 2X7PA 2I4CA 1BKAA 4PFWA 1FRPA 4ZDMA 1EU8A 5DEXB 4MEVA 2HAVA 4YMAA 1UIVA 3A3CA 1M5CA 1JQFA 3OXNA 4NF8B 1LLSA 3R26A 2QJEA 1DPEA 3LSFB 4ZEFA 4H5GA 3MVXA 2P1SA 4MX6A 1NL5A 4XKPA 2I3VA 4X1BA 2OWZA 4GOTA 2PX1A 1EZPA 3V89B 4G4PA 3FASA 4ZE9A 1FQAA 4PF8A 5BUUA 1HSEA 1MM6A 5DYHA 3TQLA 4YMBA 1I6QA 3RNNA 1XI6A 1A54A 1MY1A 1Y20A 1PB9A 3DP4A 3TUSA 5ELVA 5CI5A 2IEEA 2E0SA 1NNKA 3MPLA 2VHAA 2Z8EA 3S4UA 1EZOA 4PTKA 3VVFA 1AH5A 3HFUA 1FPJA 4I62A 3MWBA 4P56A 3PPQA 1OQGA 4GX6A 2QVVA 4KYEA 3S9MC 2QPQA 4TLMB 1A55A 1B4HA 1URDA 3H6TA 4PAIA 4MIJA 3C33A 3H06B 3ODBA 3C4MA 4AQ4A 2DVCA 4RXLA 2YJPA 2CZHA 4G77A 3MW0A 3RUMA 4YZZA 4PFTA 3HN0A 4GVOA 5L9SA 1J1NA 4OFJA 4FORA 3TAJA 1MQJA 2DSFA 4LONB 3PPOA 3KN7A 1CB6A 5I3SA 2ZNUA 1QW0A 4XKRA 1KA0A 1B5IA 1H43A 2WBDA 4GWUA 3O28A 1POY1 4F3GA 3SEWA 3BIGA 4NF6A 1LB8A 4DCYA 1IMAA 3K02A 4NWDA 3C35A 2B4LA 2D21A 1POTA 1A7LA 2RC7A 4KPTA 4PFBA 2CEYA 4PAFA 1SYHA 1XS5A 2DP8A 3N94A 1H76A 3PUWE 1IXIA 5TPAB 3T9HB 2AL5A 2CMOA 2VD2A 3IOTA 3MVYA 3S2VA 1IMFA 1FCKA 3S9LC 4GWSA 5EQ7A 1DCUA 1IXCA 2B3BA 3G3GA 4ESWA 4NEDA 4GRKA 2X7QA 2HZLA 4JSDA 1Z7NE 1EH3A 1OVBA 1A8EA 3M3FA 1MS7A 2FIXA 1FTJA 2PT2A 1RYOA 3FXRA 2XXVA 4O3BA 1IQ7A 5H8NB 4QHQA 4G68B 3MC2A 2DQVA 4YKPA 4I1DA 3ONMA 4OXVA 4F1UA 3EPEA 4RPNA 5I5PA 5I58A 1NUWA 1ZTYA 1FPLA 3E13X 3SKPA 4NTLA 5EYFA 2DXYA 3Q26A 1N3WA 4MF3A 3PGFA 3V8XB 3K1MA 4R6YA 2UYEA 2XWKA 4KQPA 4O3AA 3VXCA 1MXWA 2VPOA 4FJPA 4N15A 3MZ1A 3EF7A 1NNTA 5L9OA 3ISPA 3U93A 1XVXA 2QMWA 3TYHA 4MNCA 2XWOA 3RPWA 1P1QA 3CFLA 4IO3A 4N8YA 3E78A 4OZ9A 4NHBA 4ZZEA 4O3CA 3K01A 5FHOA 5CC2A 2Q8MA 4GX4A 2D5WA 2F34A 1JEUA 3B6TA 4JXIA 3CI8A 1XT8A 2XXUA 1Y9UA 3W9VA 3SERA 1GR2A 5F7VA 4WXJA 4YKJA 3TODA 4IGTA 3D4GA 1MH3A 2F5XA 4IO4A 5I2KA 3IOUA 3IB0A 1LAXA 4R74A 4N6KA 3HPIA 4NF5A 1R9LA 2XXQA 5B7DA 1A99A 4KD5A 1URSA 2FA7A 2GRVA 2ONSA 1TWYA 5J16A 5I2NA 1ZLQA 4EXLA 2WEFA 4GLIA 2I4BA 4H1XA 2XX8A 2Y7PA 1A40A 3B8BA 4O8MA 2WYPA 1BK4A 3QUFA 4R9FA 3A29A 5A5LA 2HCAA 3O29A 4GWWA 5ESYA 1OMPA 3FD3A 3RT8A 4H46A 5IZ3B 4FAJA 4OYVA 1ZMGA 2Q2CA 2XWVA 4FATA 2ZMBA 2OZZA 4R9GA 1N04A 1B2HA 1SW5A 4RK2A 4ZEIA 4ZEKA 2PFYA 3QIMA 1Q9DA 3U1OA 4U2RA 1NH7A 3B50A 5ITPA 2A5SA 2ONKE 2OWTA 4P11A 1FBPA 4UACA 2XXXA 1IUDA 3RN8A 4R2FA 3CR9A 4JWYA 2XXRA 4RPOA 3RLFE 2Z22A 3N6UA 2BJIA 3IK6B 5EHSA 2FBPA 4GFRA 3OSQA 4XKNA 2RC8A 5HM4B 1B4ZA 3H3GA 1R9QA 3N26A 5AA1A 3AXFA 5CMMA 3R6UA 1N7XA 4X48A 4THIA 5EHMA 1FBEA 1FPEA 1N3XA 1AMFA 2OCUA 3FATA 4NF6B 3K4UA 5LDZA 5L9MA 2O7IA 4MNPA 4IR8A 1II5A 3ECRA 2KR0A 4LZ5A 3LSLA 3KZGA 4JVIA 1LBWA 5I57A
chains in the Genus database with same CATH topology
4O7IA 4PF8A 1FBGA 1CNQA 2ZZVA 1NV0A 1XI6A 2Y5LA 1INPA 4PF6A 2JJKA 4NG7A 3IFCA 1SPIA 4GX3A 1IMEA 1LBZA 4P1EA 1DK4A 3T1BA 3ROJA 4M1VA 4PDDA 2FVZA 4PTKA 3HFUA 5ET5A 1FPJA 3LV0A 1YZ0A 1NV4A 4MJOA 1IMDA 1FPDA 4P56A 4F18A 2DVZA 1RDZA 4GX6A 2Y5KA 2QVVA 5IZ1A 4X9TA 1JP4A 4MAGA 5IZZA 4FBPA 1FPBA 4GWYA 2QPQA 3QMFA 3RPLA 4PGPA 4GWXA 4PAIA 4MIJA 1FBFA 1VDWA 4G61A 4P47A 2CZHA 1EYKA 4LN5A 4PE3A 4OVRA 4YZZA 2PCRA 2KQZA 1FTAA 2CEXA 3KC1A 5I3SA 4I40A 1KA0A 1G0IA 2WBDA 4GWUA 4XF5A 3NOHA 2VT5A 2XWIA 4P8BA 3W9WA 3BIGA 1FSAA 3FXBA 1FJ9A 2CZKA 1NV6A 4MHFA 1IMAA 3T0JA 4PFRA 2ZZWA 4PAKA 2XA5A 2DE2A 2B4LA 5ET7A 3U65A 4PCDA 1NI9A 4UABA 1RDYA 5EYGA 4PFBA 2CEYA 4PAFA 2WX9A 4PGNA 1K9YA 1NUYA 3LUZA 1IMCA 4XFEA 4N4UA 5F24A 5ET8A 1IMFA 2OX3A 4GWSA 5EQ7A 5EQAA 1DCUA 5CM6A 4AS5A 4I3EA 5LTCA 3EKIA 2HZLA 2WBBA 1DBZA 1EYIA 4GBWA 4I3YA 1AWBA 2FIXA 2HXRA 5IZ3A 3GYYA 3SZPA 4OVTA 4X04A 4O94A 1RDXA 5EQ8A 4F1UA 4OVPA 1NUZA 1LEVA 5EQ9A 4MNIA 5I5PA 2ZZXA 2WYKA 1NUWA 2MKZA 1FPLA 1EYJA 2DE3A 2FHYA 2P3VA 3RPLB 4KXPA 4P1LA 1D9QA 2XWKA 4NX1A 1FPIA 3MSTA 5JK4A 4XEQA 4HCYA 4N17A 3MYUA 5J1DA 3PTYA 1K9ZA 2QFLA 2VPOA 4HE1A 4O7MA 4N15A 3RYDA 3ISPA 2L5VA 2F3DA 4MNCA 4PBQA 2XWOA 1FPFA 3IFAA 4N6DA 4N8YA 3E78A 2HZKA 1G0HA 4NHBA 1LBXA 1NUXA 4F19A 2Q8MA 4PDHA 4N8GA 1NV3A 4HE2A 4GX4A 3KBZA 2B4MA 1YYZA 4F1VA 5EYHA 2V4CA 3W9VA 1FBHA 4PBHA 4OVQA 1NV5A 4P3LA 2F5XA 3E79A 1KZ8A 4JVCA 2R8TA 1FBDA 4N6KA 4OANA 3BIHA 4DI3D 4JVDA 1KA1A 1NV1A 4NAPA 1YXIA 2PFZA 2QVRA 1FPGA 5J16A 4N91A 2WEFA 4QBAA 4MMPA 5ET6A 3B8BA 5I7IA 4O8MA 2WYPA 2QVUA 1BK4A 4PFIA 4MCOA 3A29A 5IGAA 5A5LA 1FPKA 2HPGA 2XXKA 4GWWA 5ESYA 4QXDA 4H46A 3KC0A 5IZ3B 2XWVA 2F3BA 5FBPA 1NV2A 1LBVA 2HHMA 4NN3A 2DE4A 2PFYA 4PETA 1QGXA 4H45A 3FBPA 1Q9DA 3B50A 1LBYA 4N81A 2P3NA 4NQ8A 3D1RA 2GQ1A 4NF0A 5IM2A 1FBPA 4P9KA 2V3QA 4YICA 5DW8A 5T3JA 4OA4A 2VPNA 4HXVA 1FJ6A 2Q9TA 3CHGA 1NV7A 2BJIA 4GWZA 2FBPA 4X8RA 4PC9A 1FRPA 4DI4B 4HE0A 1IMBA 2Q74A 4MEVA 2FIEA 1FBEA 1FPEA 2CZIA 1FBCA 4GBVA 5LDZA 2DDKA 4NGUA 4MNPA 4IR8A 2KR0A 4MX6A 4HCWA 4JVIA 4AS4A 2OWZA 4OVSA 1LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O7I A;  1NUW A;  1FTA A;  5J16 A;  3KC1 A;  5I3S A;  4I40 A;  1FBG A;  1FPL A;  1CNQ A;  2WEF A;  1KA0 A;  1G0I A;  2WBD A;  4GWU A;  2VT5 A;  1EYJ A;  5ET6 A;  3B8B A;  2FHY A;  2P3V A;  3BIG A;  2QVU A;  1BK4 A;  1NV0 A;  1FSA A;  1FJ9 A;  3A29 A;  3RPL B;  5A5L A;  2CZK A;  4KXP A;  1NV6 A;  1XI6 A;  2Y5L A;  1FPK A;  4GWW A;  1INP A;  5ESY A;  1D9Q A;  1IMA A;  4QXD A;  1FPI A;  3T0J A;  2JJK A;  3KC0 A;  4H46 A;  5IZ3 B;  3IFC A;  1SPI A;  4GX3 A;  2QVR A;  1IME A;  1LBZ A;  2F3B A;  5FBP A;  1NV2 A;  5ET7 A;  1NI9 A;  1K9Z A;  2QFL A;  1DK4 A;  4HE1 A;  1RDY A;  5EYG A;  1LBV A;  2HHM A;  3RYD A;  1QGX A;  4H45 A;  3ROJ A;  3FBP A;  1Q9D A;  2F3D A;  1K9Y A;  1FPF A;  1LBY A;  2FVZ A;  4PTK A;  3IFA A;  4N81 A;  1NUY A;  3LUZ A;  2P3N A;  5ET5 A;  1IMC A;  1FPJ A;  2GQ1 A;  3D1R A;  3LV0 A;  1YZ0 A;  1FBP A;  1NV4 A;  1G0H A;  1FPG A;  4MJO A;  1LBX A;  5DW8 A;  5F24 A;  1IMD A;  5T3J A;  1FPD A;  1NUX A;  5ET8 A;  4HXV A;  2Q8M A;  1NV3 A;  4HE2 A;  1IMF A;  1FJ6 A;  1RDZ A;  4GX6 A;  2OX3 A;  4GX4 A;  2Y5K A;  2QVV A;  3KBZ A;  4GWS A;  5EQ7 A;  5EQA A;  1JP4 A;  5IZ1 A;  1DCU A;  1YYZ A;  1NV7 A;  2BJI A;  4GWZ A;  4FBP A;  2FBP A;  1FPB A;  4I3E A;  5EYH A;  4AS5 A;  4GWY A;  3QMF A;  3RPL A;  2WBB A;  1FBH A;  1FRP A;  1DBZ A;  1EYI A;  4GBW A;  4HE0 A;  4I3Y A;  1AWB A;  4GWX A;  1IMB A;  2Q74 A;  2FIX A;  1NV5 A;  2FIE A;  5IZ3 A;  1FBE A;  1FBF A;  1VDW A;  1FPE A;  2CZI A;  1KZ8 A;  4G61 A;  1FBC A;  2CZH A;  4GBV A;  2R8T A;  5LDZ A;  2DDK A;  1EYK A;  1FBD A;  1RDX A;  3BIH A;  4IR8 A;  5EQ8 A;  1KA1 A;  1NV1 A;  2PCR A;  1YXI A;  1NUZ A;  1LEV A;  5EQ9 A;  4AS4 A;  2OWZ A;  1LBW A; 
#chains in the Genus database with same CATH topology
 3S9E A;  2Y7I A;  1FBG A;  1R1N A;  3LC8 A;  4ESX A;  3KBR A;  1Y4T A;  2DXR A;  1WDN A;  3Q27 A;  4KYD A;  3KG2 A;  3C31 A;  3QAX A;  1UQW A;  3M3K A;  3LSX A;  1INP A;  3JZJ A;  3I6V A;  2JJK A;  5CBR A;  1QUK A;  4EDP A;  1IME A;  5KDT A;  4LUB A;  3K2D A;  3OSR A;  1UTB A;  4P1E A;  2DYX A;  3RT6 B;  4RY1 A;  2FNC A;  1QJM A;  1TXF A;  2XXH A;  3UN6 A;  3P7I A;  4XXU A;  1B05 A;  4PDD A;  2FVZ A;  4OEN A;  1YZ0 A;  1IXH A;  2GHB A;  1FW0 A;  1DPP A;  3MQ9 A;  4U1O A;  3T66 A;  3SET A;  2DVZ A;  1RDZ A;  2R6G E;  1OLC A;  5IZ1 A;  4X9T A;  4MAG A;  4RYA A;  4FBP A;  1H44 A;  2V84 A;  4C1U A;  1D3K A;  3SEX A;  1SQY A;  4GWY A;  4MFI A;  2PMS A;  5I58 B;  1NH8 A;  2F36 A;  4P0G A;  2ONR A;  4TLL B;  5CBS A;  4TQU Q;  3VDF A;  2ZNT A;  1VDW A;  3UK4 A;  1H45 A;  3MVW A;  2QS2 A;  2VGQ A;  1N76 A;  3TKD A;  3IX1 A;  3I3V A;  4PE3 A;  4MBP A;  4OVR A;  4OVJ A;  4OHN A;  1AL3 A;  4RA1 A;  4Q5T A;  2CEX A;  3PMX A;  5CRY A;  1B3L A;  3TMG A;  3QUJ A;  2VT5 A;  1B3F A;  1I6A A;  2XWI A;  3U72 A;  2F97 A;  3G3F A;  3JYR A;  1H3D A;  2F6G A;  1P99 A;  4N13 A;  2PT1 A;  3M8U A;  4MHF A;  3T0J A;  1B7U A;  2H98 A;  3T22 A;  5ET7 A;  3FVG A;  1IIT A;  4PCD A;  1NI9 A;  4DLD A;  2F8D A;  4YB5 A;  5EYG A;  2V25 A;  1N7W A;  3K6V A;  2XXI A;  4FE8 A;  5H8H B;  1Y3N A;  3LUZ A;  3RGY A;  1DOT A;  1LAH E;  1XOC A;  4EQ9 A;  1MXV A;  3ILU B;  4N07 A;  2Y84 A;  2RC9 A;  3IB2 A;  3VV5 A;  5F24 A;  3H03 A;  5I2K B;  4E0W A;  3PV0 E;  3OO7 A;  4HTG A;  4QFN A;  5DVJ A;  1MXU A;  4NF5 B;  3MVZ A;  4NMY A;  2OK2 A;  5LTC A;  1VE4 A;  3VLV A;  5L8D A;  2YPN A;  2HXW A;  1DBZ A;  5I2N B;  4GBW A;  2A5T A;  5IZ3 A;  1MDQ A;  3GYY A;  1MM7 A;  1PBQ A;  3PUZ E;  4OVT A;  3CIJ A;  3G7W A;  3KSJ A;  2F7A A;  4H8I A;  4O94 A;  1XHY A;  1US5 A;  2HQ0 A;  3WAF A;  1NUZ A;  1LEV A;  1B3G A;  2WYK A;  4DXB A;  3IJX B;  4JWO A;  2MKZ A;  1MQG A;  4QFK A;  1Y4C A;  2XX9 A;  3DEL B;  2P3V A;  1PDA A;  2O1M A;  1VFE A;  3TDJ A;  4C1T A;  4G8N A;  3RPL B;  2P2A A;  1B32 A;  4POX A;  4GL8 A;  4P1L A;  4NX1 A;  4H67 A;  1FPI A;  1YCJ A;  1JW1 A;  5JK4 A;  4HCY A;  4POW A;  3ZS6 A;  4ELO A;  1K9Z A;  3IL1 B;  4ZEB A;  3L6G A;  1EZ9 A;  1QKA A;  2F3D A;  3ZSF A;  2AYS A;  4PBQ A;  1NNP A;  1PEB A;  1MXZ A;  4N6D A;  4QRZ A;  4IGR A;  1S7Y A;  2HZK A;  2UXA A;  4WEP A;  2B65 A;  1LBX A;  1NUX A;  2X26 A;  4F19 A;  2DS9 A;  4PDH A;  4N8G A;  1NV3 A;  4ZE8 A;  4JB7 A;  4DDD A;  2FYI A;  2H99 A;  2O84 X;  4AB5 A;  1LFI A;  1WVJ A;  1D9V A;  5EYH A;  3H6W A;  3OMB A;  2V4C A;  5I57 B;  3E3K A;  1FBH A;  4PBH A;  1AIV A;  1QUL A;  3MPK A;  4G8M A;  4OFO A;  4EF1 A;  3OO8 A;  4Q30 B;  3BFT A;  3E79 A;  2M8C A;  3IO6 A;  3O6H A;  5B70 A;  4DCX A;  4JVC A;  4YKI A;  4H8J A;  1B5H A;  4OAN A;  1FTK A;  3BIH A;  1SDX A;  4JVD A;  3G3H A;  1YXI A;  4ZS9 A;  1JW5 A;  1FPG A;  5KDT B;  3OEM A;  1OVT A;  4Q0C A;  1UTB B;  2ZYK A;  3KSX A;  3HST A;  1B51 A;  3SEU A;  2PBW A;  5F1Q A;  1XC1 A;  2O7U A;  4MMP A;  1ZU0 A;  3E4R A;  1MQI A;  4MCO A;  3F11 A;  3KN3 A;  5IGA A;  4ZZA A;  4F2Q A;  1FPK A;  3DP6 A;  5DVF A;  3TPA A;  5KZT A;  2I0C A;  3O6G A;  3B6Q A;  5I59 B;  2REJ A;  2XXT A;  2Q8J A;  5HPQ A;  4G2Z A;  2Q89 A;  1QKB A;  4NN3 A;  3Q29 A;  4EXK A;  3OEK A;  1QGX A;  4H45 A;  3FBP A;  2QS4 A;  4OQO A;  1KWH A;  4QF9 A;  4U1Z A;  1M5B A;  1ZBM A;  1LFG A;  3CVG A;  2QRY A;  4GXA A;  4EQ7 A;  4N81 A;  1MPC A;  4NF0 A;  3DP8 A;  5K2Y A;  4HXV A;  5ICT A;  1SW4 A;  2Q9T A;  3CHG A;  2Q2A A;  2NXO A;  3O2A A;  1B40 A;  3CSG A;  4GWZ A;  3MZB A;  4PC9 A;  2UVH A;  1B0L A;  1GGG A;  1IMB A;  4IO7 A;  2FIE A;  1Y3Q A;  2O6A A;  3TCG A;  4OWD A;  3FUZ A;  3DM0 A;  2CZI A;  1LST A;  4YB6 A;  2NUV A;  1FBC A;  2P0S A;  4LZ7 A;  4G68 C;  1O64 A;  2RCA A;  4IO2 A;  3TZA A;  1UTH A;  5H8H A;  1S9T A;  4HCW A;  3ILT B;  3IAZ A;  4OVS A;  1MRP A;  3CFX A;  4O7I A;  3VXB A;  4BDM A;  4G8H A;  1WOD A;  1DSN A;  2OJT A;  1MPD A;  4NF4 A;  1YTV A;  3FZV A;  1LBB A;  5TP9 A;  3MZ9 A;  1NV0 A;  1VSO A;  4MH5 A;  2OPD A;  2AIX A;  2Y5L A;  2W7Y A;  2F7C A;  1MY0 A;  2ZYN A;  3KGC A;  3IFC A;  1SPI A;  4GX3 A;  4F29 A;  1LBZ A;  1MXX A;  2DWH A;  4KCC A;  1A8F A;  3VLW A;  1DK4 A;  5HBC A;  3T1B A;  1US4 A;  3C34 A;  1DTG A;  2Y7R A;  1MH4 A;  3FVN A;  3ROJ A;  4RNS A;  2OPE A;  1B9J A;  2QMX A;  1FTO A;  2A5T B;  3LV0 A;  1P1W A;  1NV4 A;  3VE1 B;  4MJO A;  1IMD A;  4F18 A;  4GIZ A;  4PFU A;  1FTM A;  1Q35 A;  1SYI A;  4HS7 A;  5TU0 A;  1BP5 A;  3QMF A;  3TCH A;  3RPL A;  4PGP A;  4U23 A;  2UVJ A;  4GWX A;  1YPN A;  1DTZ A;  3TCF A;  4OES A;  1FBF A;  3FVK A;  1ZJL A;  3FVO A;  3Q28 A;  2Y7W A;  1EYK A;  4LN5 A;  2DWI A;  1D4N A;  3FXQ A;  3U92 A;  2PCR A;  3ZKL A;  4ELQ A;  2R71 A;  1XVY A;  4RJZ A;  4I40 A;  3H4Z A;  3K1N A;  4OMB A;  4NE4 A;  4XF5 A;  3NOH A;  3DLN A;  4P8B A;  1LCT A;  3FXB A;  4ELR A;  1FJ9 A;  3CSB A;  2CZK A;  1NV6 A;  5FTH A;  2NOO A;  3LUY A;  4LA9 A;  4F3B A;  1BIY A;  4MLQ A;  2ZZW A;  4H65 A;  3TTN A;  3UP9 A;  2DE2 A;  4H0W A;  1N84 A;  4FIM A;  1NNF A;  3IOW A;  3KOT A;  3OEL A;  1OLA A;  1RDY A;  3SDF A;  4E0X A;  4DXU A;  1USY E;  1VFD A;  4IB2 A;  4F39 A;  1MQH A;  1PBP A;  2WX9 A;  2HAU A;  1B7Z A;  3VFJ A;  4KHZ E;  3CG3 A;  1IEJ A;  1NKX A;  4LVQ A;  5FTI A;  3FIR A;  3K6U A;  1CE2 A;  1O7T A;  4UA8 A;  3FXU A;  4KYS A;  5ET8 A;  1ELJ A;  2G93 A;  2XXP A;  4FEB A;  4PQJ A;  4XKQ A;  5H8Q B;  3D4C A;  3HHG A;  5EQA A;  2PVU A;  4H5F A;  1MG1 A;  1SD3 A;  1LB9 A;  4AS5 A;  3B6W A;  3EKI A;  4BLA A;  5JEI A;  4ECF A;  3FV2 A;  2HFB A;  2G29 A;  2WBB A;  3Q25 A;  2YLN A;  2NVU B;  4I3Y A;  4EF2 A;  5AA4 A;  3R7X A;  2VOZ A;  1Y1Z A;  5I59 A;  3SZP A;  2Q88 A;  3V5A A;  2ZNS A;  3G3I A;  3KOS A;  3K1P A;  4X04 A;  4OFL A;  4LQ5 A;  4ISU A;  5EQ8 A;  1F9B A;  4I8C A;  3PU5 A;  1FQC A;  5EQ9 A;  2ZZX A;  4ZEC A;  3T9V A;  1O63 A;  3UIF A;  1LAF E;  2Z8D A;  2V93 A;  3EHT A;  2H4I A;  3VVE A;  5M2V A;  1MY4 A;  3OO9 A;  4KXP A;  2F78 A;  4U4X A;  3G3K A;  1B7H A;  2ANJ A;  3U8Q A;  3MP8 A;  4FEC A;  4XEQ A;  2QFL A;  1P1N A;  4HE1 A;  3FV1 A;  4AB6 A;  5CMB A;  3UGW A;  3RYD A;  1BTJ A;  5FHN A;  4TOZ A;  4QSC A;  2VD3 A;  4LP2 B;  1FPF A;  1ZIU A;  4EQB A;  2THI A;  3GZG A;  4QFL A;  3VLU A;  4X1D A;  2OWS A;  3TFL A;  3C36 A;  2I49 A;  1Q1K A;  4I9D A;  3KBZ A;  1YYZ A;  1UTH B;  3JV9 A;  2I48 A;  4GWO A;  5A5X A;  1S50 A;  3KFM A;  2RF1 A;  4OEU A;  5AA3 A;  3UA8 A;  2AL4 A;  3HHF A;  3LBS A;  4KFQ A;  1FQD A;  1NV5 A;  3U94 A;  1JVX A;  4NF4 B;  1MXY A;  3QSL A;  1KZ8 A;  5TP9 B;  4NWC A;  4EUO A;  2ZYO A;  2R8T A;  2ZYM A;  3K6W A;  4F1Y A;  2R9J A;  4R72 A;  4DI3 D;  3SEV A;  1OIB A;  4NAP A;  1VR5 A;  4YB7 A;  3OO6 A;  3IB1 A;  2PFZ A;  5DTB A;  3PPP A;  2ZXT A;  2OBG A;  2OLB A;  3UOR A;  1PB8 A;  2H5Y A;  3GBA A;  2QSX A;  4GQO A;  3USD A;  5ICQ A;  1Y3P A;  1I69 A;  3EQ1 A;  4QBA A;  3K00 A;  3C9H A;  2QVU A;  4PFI A;  2V3U A;  1ATG A;  2BJJ X;  4L17 A;  3O6I A;  3BKI B;  1ZKB A;  1GV8 A;  2XXK A;  1ANF A;  4QXD A;  1GTK A;  1OQH A;  4GXS B;  2F3B A;  5FBP A;  5FHM A;  4H6D A;  2D3I A;  2IA4 A;  1LBV A;  4P0I A;  4PET A;  4YU0 A;  1PC3 A;  2QL3 A;  4ND9 A;  3BFU A;  3MP1 A;  3O9P A;  4OEV A;  3N5L A;  2GQ1 A;  4N6P A;  5IM2 A;  2GH9 A;  2HEU A;  2V3Q A;  5ITO A;  4YIC A;  1MPB A;  5DW8 A;  4OA4 A;  3PUX E;  4Q8R A;  4HW8 A;  1FJ6 A;  3S9N C;  4GF8 A;  3QK6 A;  2V3T A;  2I0B A;  5CMK A;  2RCB A;  4ZED A;  3GBB A;  1NV7 A;  4KR5 A;  3IOR A;  2Z8F A;  3PPR A;  4QFO A;  2ESN A;  3IO4 A;  4X8R A;  1MY3 A;  1SI1 A;  3IOV A;  5DT6 A;  4DI4 B;  1IZ1 A;  4F22 A;  1SW2 A;  4HE0 A;  1JW4 A;  2Q74 A;  2E1S A;  2XXY A;  2F6P A;  2O69 A;  3K0V A;  4IY5 A;  3PUY E;  3VVD A;  1B0H A;  4GBV A;  5JTY A;  2DDK A;  4NGU A;  1RKM A;  4U21 A;  4AS4 A;  5AA2 D;  4DIG A;  4PP0 A;  1QVS A;  5H8F A;  1B58 A;  1JET A;  3T9U A;  4PE5 B;  1B52 A;  1CNQ A;  3O97 A;  4LAT A;  2XD2 A;  2PYY A;  3HV1 A;  2ZZV A;  3H6U A;  3HO7 A;  4R2B A;  4WED A;  5AA2 A;  1M5D A;  2DWA A;  2RKM A;  4Z0I A;  1FQE A;  5H8Q A;  3PPN A;  3T93 B;  2CZL A;  4PF6 A;  4M4G A;  1GVC A;  4NG7 A;  4PFY A;  4BDQ A;  3B7D A;  3OD7 A;  3L6H A;  4RK9 A;  2XHD A;  5KCJ A;  3MBP A;  4YKK A;  4QSD A;  1B3H A;  4DXC A;  1DMB A;  4GD5 A;  3CRB A;  4F31 B;  1HSL A;  1MQD A;  4M1V A;  4BDO A;  5CMC A;  1FQB A;  5BWJ A;  3MUQ A;  2UYF A;  5ET5 A;  3FJG A;  5AA4 B;  1FPD A;  5I84 A;  1USY H;  1LGB C;  4BDN A;  2Y5K A;  3IJO B;  1JP4 A;  5IZZ A;  3MAM A;  5DVI A;  1FPB A;  3QYT A;  4IO5 A;  3PD9 A;  1I6B A;  2GFE A;  1LAG E;  4FED A;  5H8S A;  1D9Y A;  4G61 A;  1MDP 1;  4P47 A;  1LCF A;  5I56 A;  3O66 A;  3MJN A;  1NFT A;  2KQZ A;  4BDL A;  3THI A;  4OTE A;  1FTA A;  2B3F A;  2VP1 A;  3KC1 A;  4JDF A;  4XTC Q;  5DEX A;  1G0I A;  4U4S A;  2F35 A;  3W9W A;  2O1L A;  2ALU A;  1FSA A;  3PMV A;  2H9B A;  4NF8 A;  3FJ7 A;  1N0T A;  3BBR A;  3LR1 A;  1L5T A;  1M5F A;  2I3W A;  2XXW A;  4KCD A;  4IO6 A;  3K6X A;  4PFR A;  1AOV A;  3ZKK A;  1FQF A;  1URG A;  4PAK A;  2XA5 A;  4QSE A;  3U65 A;  4MLV A;  4DZ1 A;  4UAB A;  4LZ8 A;  1TFA A;  4R6H A;  1JEV A;  2LAO A;  4K3F A;  5A5X B;  4PGN A;  3RY3 A;  1K9Y A;  1TFD A;  3KEI A;  1SVX B;  3A3U A;  1T0K A;  1NUY A;  1BLF A;  1IMC A;  4XFE A;  4N4U A;  1TT1 A;  4IY6 A;  2UVG A;  1JVY A;  3EN3 A;  3C32 A;  1YAE A;  4R73 A;  4WKM A;  4JWX A;  3G3J A;  3TTM A;  2OX3 A;  1B6H A;  2XX7 A;  4JBZ A;  4F3S A;  2XD3 A;  3KJ7 A;  5CM6 A;  4I3E A;  3RQT A;  1PB7 A;  4YAH X;  1EYI A;  3TTK A;  1AWB A;  4F3P A;  2HXR A;  3RTW B;  2DWJ A;  3FGS A;  5LOM A;  4GL0 A;  3OEN A;  1M5E A;  1RDX A;  4F2O A;  2NWJ A;  3QXM A;  1SBP A;  4OVP A;  1P1U A;  4MNI A;  1B1H A;  3TEL A;  1FTL A;  1HSJ A;  1B3E A;  5AE4 A;  1EYJ A;  4JSO A;  2DE3 A;  2FHY A;  2Y7K A;  2UVI A;  1MY2 A;  3TQW A;  1D9Q A;  3MST A;  3SEY A;  4N17 A;  3MYU A;  3CG1 A;  5J1D A;  2QS3 A;  3PTY A;  3OOA A;  5IKB A;  3TTL A;  4XIG Q;  4O7M A;  2Z23 A;  4OET A;  2L5V A;  3GXA A;  1RYX A;  2F7B A;  3IFA A;  2O51 A;  3TTR A;  1G0H A;  4KI0 E;  1B1X A;  2RIN A;  3H7M A;  1LFH A;  4HE2 A;  5JTY B;  3V83 A;  3M3L A;  3KJT A;  3PMW A;  1B46 A;  2B4M A;  3I5O A;  4F1V A;  1Y1M A;  3N6T A;  5H8F B;  3TEP A;  2QS1 A;  3KN8 A;  4OVQ A;  3CFZ A;  1UIU A;  4OER A;  4P3L A;  3PUV E;  5ISU A;  5AA2 B;  3LSW A;  3RTF B;  5TPA A;  3GLB A;  1IXG A;  2I6E A;  4LQ2 A;  1FBD A;  3MP6 A;  1SW1 A;  1NMU A;  1IIW A;  5IAI A;  1KA1 A;  1NV1 A;  2H25 A;  2QVR A;  3W15 C;  1LBC A;  2REG A;  2WKY A;  1QUI A;  1SI0 A;  5KCJ B;  3WAE A;  4N91 A;  3EHU A;  3E9X A;  4DE8 A;  5ET6 A;  5H8N A;  3A09 A;  4ELP A;  5I7I A;  3IR1 A;  4G68 A;  2ABH A;  2HPG A;  2I58 A;  3SES A;  4BDR A;  2KLF A;  3KC0 A;  1JNF A;  1B5J A;  4QFP A;  4R6K A;  1NV2 A;  5K2X A;  4C0R A;  1R6Z A;  3T9X B;  2HHM A;  4ONY A;  4U22 A;  2DE4 A;  2DOJ A;  1P1O A;  1QUJ A;  3HCQ A;  1LBY A;  3FJM A;  2P3N A;  3D1R A;  4NQ8 A;  4R75 A;  3T96 B;  3EHS A;  4P9K A;  2O68 A;  4Z7E A;  5T3J A;  2VPN A;  3H6V A;  2GHA A;  5I56 B;  1Z7M E;  3PD8 A;  2X7P A;  2I4C A;  1BKA A;  4PFW A;  1FRP A;  4ZDM A;  1EU8 A;  5DEX B;  4MEV A;  2HAV A;  4YMA A;  1UIV A;  3A3C A;  1M5C A;  1JQF A;  3OXN A;  4NF8 B;  1LLS A;  3R26 A;  2QJE A;  1DPE A;  3LSF B;  4ZEF A;  4H5G A;  3MVX A;  2P1S A;  4MX6 A;  1NL5 A;  4XKP A;  2I3V A;  4X1B A;  2OWZ A;  4GOT A;  2PX1 A;  1EZP A;  3V89 B;  4G4P A;  3FAS A;  4ZE9 A;  1FQA A;  4PF8 A;  5BUU A;  1HSE A;  1MM6 A;  5DYH A;  3TQL A;  4YMB A;  1I6Q A;  3RNN A;  1XI6 A;  1A54 A;  1MY1 A;  1Y20 A;  1PB9 A;  3DP4 A;  3TUS A;  5ELV A;  5CI5 A;  2IEE A;  2E0S A;  1NNK A;  3MPL A;  2VHA A;  2Z8E A;  3S4U A;  1EZO A;  4PTK A;  3VVF A;  1AH5 A;  3HFU A;  1FPJ A;  4I62 A;  3MWB A;  4P56 A;  3PPQ A;  1OQG A;  4GX6 A;  2QVV A;  4KYE A;  3S9M C;  2QPQ A;  4TLM B;  1A55 A;  1B4H A;  1URD A;  3H6T A;  4PAI A;  4MIJ A;  3C33 A;  3H06 B;  3ODB A;  3C4M A;  4AQ4 A;  2DVC A;  4RXL A;  2YJP A;  2CZH A;  4G77 A;  3MW0 A;  3RUM A;  4YZZ A;  4PFT A;  3HN0 A;  4GVO A;  5L9S A;  1J1N A;  4OFJ A;  4FOR A;  3TAJ A;  1MQJ A;  2DSF A;  4LON B;  3PPO A;  3KN7 A;  1CB6 A;  5I3S A;  2ZNU A;  1QW0 A;  4XKR A;  1KA0 A;  1B5I A;  1H43 A;  2WBD A;  4GWU A;  3O28 A;  1POY 1;  4F3G A;  3SEW A;  3BIG A;  4NF6 A;  1LB8 A;  4DCY A;  1IMA A;  3K02 A;  4NWD A;  3C35 A;  2B4L A;  2D21 A;  1POT A;  1A7L A;  2RC7 A;  4KPT A;  4PFB A;  2CEY A;  4PAF A;  1SYH A;  1XS5 A;  2DP8 A;  3N94 A;  1H76 A;  3PUW E;  1IXI A;  5TPA B;  3T9H B;  2AL5 A;  2CMO A;  2VD2 A;  3IOT A;  3MVY A;  3S2V A;  1IMF A;  1FCK A;  3S9L C;  4GWS A;  5EQ7 A;  1DCU A;  1IXC A;  2B3B A;  3G3G A;  4ESW A;  4NED A;  4GRK A;  2X7Q A;  2HZL A;  4JSD A;  1Z7N E;  1EH3 A;  1OVB A;  1A8E A;  3M3F A;  1MS7 A;  2FIX A;  1FTJ A;  2PT2 A;  1RYO A;  3FXR A;  2XXV A;  4O3B A;  1IQ7 A;  5H8N B;  4QHQ A;  4G68 B;  3MC2 A;  2DQV A;  4YKP A;  4I1D A;  3ONM A;  4OXV A;  4F1U A;  3EPE A;  4RPN A;  5I5P A;  5I58 A;  1NUW A;  1ZTY A;  1FPL A;  3E13 X;  3SKP A;  4NTL A;  5EYF A;  2DXY A;  3Q26 A;  1N3W A;  4MF3 A;  3PGF A;  3V8X B;  3K1M A;  4R6Y A;  2UYE A;  2XWK A;  4KQP A;  4O3A A;  3VXC A;  1MXW A;  2VPO A;  4FJP A;  4N15 A;  3MZ1 A;  3EF7 A;  1NNT A;  5L9O A;  3ISP A;  3U93 A;  1XVX A;  2QMW A;  3TYH A;  4MNC A;  2XWO A;  3RPW A;  1P1Q A;  3CFL A;  4IO3 A;  4N8Y A;  3E78 A;  4OZ9 A;  4NHB A;  4ZZE A;  4O3C A;  3K01 A;  5FHO A;  5CC2 A;  2Q8M A;  4GX4 A;  2D5W A;  2F34 A;  1JEU A;  3B6T A;  4JXI A;  3CI8 A;  1XT8 A;  2XXU A;  1Y9U A;  3W9V A;  3SER A;  1GR2 A;  5F7V A;  4WXJ A;  4YKJ A;  3TOD A;  4IGT A;  3D4G A;  1MH3 A;  2F5X A;  4IO4 A;  5I2K A;  3IOU A;  3IB0 A;  1LAX A;  4R74 A;  4N6K A;  3HPI A;  4NF5 A;  1R9L A;  2XXQ A;  5B7D A;  1A99 A;  4KD5 A;  1URS A;  2FA7 A;  2GRV A;  2ONS A;  1TWY A;  5J16 A;  5I2N A;  1ZLQ A;  4EXL A;  2WEF A;  4GLI A;  2I4B A;  4H1X A;  2XX8 A;  2Y7P A;  1A40 A;  3B8B A;  4O8M A;  2WYP A;  1BK4 A;  3QUF A;  4R9F A;  3A29 A;  5A5L A;  2HCA A;  3O29 A;  4GWW A;  5ESY A;  1OMP A;  3FD3 A;  3RT8 A;  4H46 A;  5IZ3 B;  4FAJ A;  4OYV A;  1ZMG A;  2Q2C A;  2XWV A;  4FAT A;  2ZMB A;  2OZZ A;  4R9G A;  1N04 A;  1B2H A;  1SW5 A;  4RK2 A;  4ZEI A;  4ZEK A;  2PFY A;  3QIM A;  1Q9D A;  3U1O A;  4U2R A;  1NH7 A;  3B50 A;  5ITP A;  2A5S A;  2ONK E;  2OWT A;  4P11 A;  1FBP A;  4UAC A;  2XXX A;  1IUD A;  3RN8 A;  4R2F A;  3CR9 A;  4JWY A;  2XXR A;  4RPO A;  3RLF E;  2Z22 A;  3N6U A;  2BJI A;  3IK6 B;  5EHS A;  2FBP A;  4GFR A;  3OSQ A;  4XKN A;  2RC8 A;  5HM4 B;  1B4Z A;  3H3G A;  1R9Q A;  3N26 A;  5AA1 A;  3AXF A;  5CMM A;  3R6U A;  1N7X A;  4X48 A;  4THI A;  5EHM A;  1FBE A;  1FPE A;  1N3X A;  1AMF A;  2OCU A;  3FAT A;  4NF6 B;  3K4U A;  5LDZ A;  5L9M A;  2O7I A;  4MNP A;  4IR8 A;  1II5 A;  3ECR A;  2KR0 A;  4LZ5 A;  3LSL A;  3KZG A;  4JVI A;  1LBW A;  5I57 A; 
#chains in the Genus database with same CATH homology
 4O7I A;  4PF8 A;  1FBG A;  1CNQ A;  2ZZV A;  1NV0 A;  1XI6 A;  2Y5L A;  1INP A;  4PF6 A;  2JJK A;  4NG7 A;  3IFC A;  1SPI A;  4GX3 A;  1IME A;  1LBZ A;  4P1E A;  1DK4 A;  3T1B A;  3ROJ A;  4M1V A;  4PDD A;  2FVZ A;  4PTK A;  3HFU A;  5ET5 A;  1FPJ A;  3LV0 A;  1YZ0 A;  1NV4 A;  4MJO A;  1IMD A;  1FPD A;  4P56 A;  4F18 A;  2DVZ A;  1RDZ A;  4GX6 A;  2Y5K A;  2QVV A;  5IZ1 A;  4X9T A;  1JP4 A;  4MAG A;  5IZZ A;  4FBP A;  1FPB A;  4GWY A;  2QPQ A;  3QMF A;  3RPL A;  4PGP A;  4GWX A;  4PAI A;  4MIJ A;  1FBF A;  1VDW A;  4G61 A;  4P47 A;  2CZH A;  1EYK A;  4LN5 A;  4PE3 A;  4OVR A;  4YZZ A;  2PCR A;  2KQZ A;  1FTA A;  2CEX A;  3KC1 A;  5I3S A;  4I40 A;  1KA0 A;  1G0I A;  2WBD A;  4GWU A;  4XF5 A;  3NOH A;  2VT5 A;  2XWI A;  4P8B A;  3W9W A;  3BIG A;  1FSA A;  3FXB A;  1FJ9 A;  2CZK A;  1NV6 A;  4MHF A;  1IMA A;  3T0J A;  4PFR A;  2ZZW A;  4PAK A;  2XA5 A;  2DE2 A;  2B4L A;  5ET7 A;  3U65 A;  4PCD A;  1NI9 A;  4UAB A;  1RDY A;  5EYG A;  4PFB A;  2CEY A;  4PAF A;  2WX9 A;  4PGN A;  1K9Y A;  1NUY A;  3LUZ A;  1IMC A;  4XFE A;  4N4U A;  5F24 A;  5ET8 A;  1IMF A;  2OX3 A;  4GWS A;  5EQ7 A;  5EQA A;  1DCU A;  5CM6 A;  4AS5 A;  4I3E A;  5LTC A;  3EKI A;  2HZL A;  2WBB A;  1DBZ A;  1EYI A;  4GBW A;  4I3Y A;  1AWB A;  2FIX A;  2HXR A;  5IZ3 A;  3GYY A;  3SZP A;  4OVT A;  4X04 A;  4O94 A;  1RDX A;  5EQ8 A;  4F1U A;  4OVP A;  1NUZ A;  1LEV A;  5EQ9 A;  4MNI A;  5I5P A;  2ZZX A;  2WYK A;  1NUW A;  2MKZ A;  1FPL A;  1EYJ A;  2DE3 A;  2FHY A;  2P3V A;  3RPL B;  4KXP A;  4P1L A;  1D9Q A;  2XWK A;  4NX1 A;  1FPI A;  3MST A;  5JK4 A;  4XEQ A;  4HCY A;  4N17 A;  3MYU A;  5J1D A;  3PTY A;  1K9Z A;  2QFL A;  2VPO A;  4HE1 A;  4O7M A;  4N15 A;  3RYD A;  3ISP A;  2L5V A;  2F3D A;  4MNC A;  4PBQ A;  2XWO A;  1FPF A;  3IFA A;  4N6D A;  4N8Y A;  3E78 A;  2HZK A;  1G0H A;  4NHB A;  1LBX A;  1NUX A;  4F19 A;  2Q8M A;  4PDH A;  4N8G A;  1NV3 A;  4HE2 A;  4GX4 A;  3KBZ A;  2B4M A;  1YYZ A;  4F1V A;  5EYH A;  2V4C A;  3W9V A;  1FBH A;  4PBH A;  4OVQ A;  1NV5 A;  4P3L A;  2F5X A;  3E79 A;  1KZ8 A;  4JVC A;  2R8T A;  1FBD A;  4N6K A;  4OAN A;  3BIH A;  4DI3 D;  4JVD A;  1KA1 A;  1NV1 A;  4NAP A;  1YXI A;  2PFZ A;  2QVR A;  1FPG A;  5J16 A;  4N91 A;  2WEF A;  4QBA A;  4MMP A;  5ET6 A;  3B8B A;  5I7I A;  4O8M A;  2WYP A;  2QVU A;  1BK4 A;  4PFI A;  4MCO A;  3A29 A;  5IGA A;  5A5L A;  1FPK A;  2HPG A;  2XXK A;  4GWW A;  5ESY A;  4QXD A;  4H46 A;  3KC0 A;  5IZ3 B;  2XWV A;  2F3B A;  5FBP A;  1NV2 A;  1LBV A;  2HHM A;  4NN3 A;  2DE4 A;  2PFY A;  4PET A;  1QGX A;  4H45 A;  3FBP A;  1Q9D A;  3B50 A;  1LBY A;  4N81 A;  2P3N A;  4NQ8 A;  3D1R A;  2GQ1 A;  4NF0 A;  5IM2 A;  1FBP A;  4P9K A;  2V3Q A;  4YIC A;  5DW8 A;  5T3J A;  4OA4 A;  2VPN A;  4HXV A;  1FJ6 A;  2Q9T A;  3CHG A;  1NV7 A;  2BJI A;  4GWZ A;  2FBP A;  4X8R A;  4PC9 A;  1FRP A;  4DI4 B;  4HE0 A;  1IMB A;  2Q74 A;  4MEV A;  2FIE A;  1FBE A;  1FPE A;  2CZI A;  1FBC A;  4GBV A;  5LDZ A;  2DDK A;  4NGU A;  4MNP A;  4IR8 A;  2KR0 A;  4MX6 A;  4HCW A;  4JVI A;  4AS4 A;  2OWZ A;  4OVS A;  1LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...