3KC1A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 19a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc1A02
1EYKA 1FPJA 5IZ3B 1NV1A 1NUYA 5ET7A 1KZ8A 3ROJA 1FBGA 1LBWA 1SPIA 1K9YA 3B8BA 1FJ9A 1NV6A 3LUZA 4GBVA 5EYHA 4GWZA 3A29A 2GQ1A 1FTAA 2QVUA 1LBVA 4MJOA 4PTKA 3BIHA 2VT5A 5EQ8A 1LBXA 4AS5A 5ET5A 1Q9DA 2P3VA 1IMEA 1VDWA 5T3JA 5EQ9A 1FPDA 3KC0A 3IFCA 4GX6A 3D1RA 5EQAA 1FPKA 1DCUA 1RDYA 1FBEA 2OWZA 1XI6A 1INPA 4HE2A 3BIGA 4AS4A 1FSAA 1RDXA 1FPFA 1BK4A 1G0HA 4GX3A 4GWWA 1NUXA 1K9ZA 1NV0A 1IMCA 1FBDA 1FRPA 1EYIA 4G61A 5FBPA 2FIXA 3FBPA 2BJIA 5F24A 5IZ1A 1G0IA 1FPLA 1DBZA 3IFAA 1NI9A 3T0JA 2OX3A 4O7IA 5LDZA 1NUWA 2CZKA 2Y5LA 2R8TA 4HE1A 2P3NA 4I3EA 1NV3A 1LBZA 2WEFA 2Q8MA 1FBCA 2Q74A 5EYGA 1IMFA 1FBPA 5ET6A 1DK4A 5ET8A 1IMDA 1KA0A 1IMBA 2JJKA 1FPIA 1LBYA 2QVVA 4GWUA 4I40A 3RYDA 2PCRA 1NV4A 1FPEA 1YZ0A 5DW8A 4IR8A 1AWBA 2FIEA 1JP4A 1NV2A 4GWYA 2FBPA 3KBZA 2WBDA 2FHYA 1FJ6A 3QMFA 2HHMA 2F3BA 1FBHA 1LEVA 1NV5A 5EQ7A 1YXIA 2WBBA 4KXPA 1FPGA 1FPBA 1NV7A 1IMAA 4H45A 2QFLA 1D9QA 1QGXA 4GWSA 5ESYA 2F3DA 4QXDA 4GX4A 1NUZA 4I3YA 5J16A 4GWXA 1YYZA 5A5LA 5I3SA 4FBPA 4HXVA 1KA1A 2CZHA 2CZIA 2QVRA 4GBWA 1RDZA 4HE0A 3RPLA 2FVZA 5IZ3A 3KC1A 2Y5KA 1EYJA 1CNQA 3LV0A 1FBFA 2DDKA 4N81A 4H46A 3RPLB
chains in the Genus database with same CATH superfamily
1KZ8A 1LBWA 5B7DA 2THIA 1OQGA 3MPKA 5IGAA 1FJ9A 1B0HA 3GBAA 3MAMA 1CB6A 3KN7A 4H65A 4EXKA 5H8HA 3VLWA 2Q2CA 1BKAA 5T3JA 1FPDA 3IO6A 2ZZVA 4TOZA 1SW2A 1GVCA 3KSJA 1FTOA 3OXNA 4FEBA 2XWIA 1NH7A 3LBSA 4BDOA 4TLMB 3TTMA 3FD3A 2XHDA 4OVRA 3SERA 1DBZA 3T0JA 5KDTB 3MVYA 4PQJA 2VHAA 3KJ7A 2I49A 2P2AA 1KA0A 4LVQA 5BWJA 4OA4A 4U21A 1M5EA 2ONRA 4ZECA 3RYDA 1J1NA 5H8FB 2OWTA 4MF3A 2DWJA 3G3JA 2I0CA 5LTCA 4NF4A 1B05A 2P1SA 2I3VA 4ND9A 3IO4A 2G29A 3OO9A 1BP5A 4FAJA 1N76A 1USYE 3FJMA 4YB6A 4BDRA 2AL4A 4NHBA 4JXIA 4PETA 4P47A 4ELOA 3EHSA 2Y7PA 2B4MA 3TTNA 4QFKA 5A5XB 3WAFA 2F8DA 5TP9A 1FBFA 3S9LC 1OLAA 1Y3QA 1Y1MA 5IZ3B 1XVXA 4DXCA 1SPIA 1K9YA 4KYSA 2O1MA 4MJOA 3PD9A 4P56A 5FTHA 3VFJA 4WEPA 3GZGA 3V8XB 4OESA 2Y84A 1RDYA 3B6QA 3MUQA 2H4IA 3PGFA 1NFTA 2XXTA 1IMCA 1JVXA 3N6UA 4OVQA 4QFPA 1IIWA 2DVCA 4WKMA 3IFAA 5IKBA 1OQHA 2F6GA 1EZ9A 4MNPA 4OFOA 3O29A 4MMPA 4THIA 3SKPA 4H6DA 3G7WA 1CE2A 2Q2AA 4LONB 3M8UA 4PAIA 3MQ9A 3OEMA 3IB2A 3RNNA 2OPEA 1LB9A 5AA4A 3K01A 4JWYA 2HXWA 2D5WA 2F5XA 1NV7A 4GWSA 1S50A 1MY4A 2QS2A 4GX4A 3AXFA 4NF4B 4R73A 1SBPA 4F2OA 1YYZA 1H44A 4F19A 2Z8DA 4HW8A 3EQ1A 3PPOA 4F3PA 3PPQA 1JNFA 1Y20A 3C34A 3EHTA 2DOJA 1B40A 3LV0A 4OENA 2I48A 2OZZA 2QJEA 1NV1A 5TP9B 3HN0A 2B3BA 3H6VA 4DDDA 2VPOA 4MFIA 4GBVA 4K3FA 5H8NA 4LZ8A 1MXYA 1FTAA 3DP6A 4R75A 1WODA 3OELA 1QW0A 1URGA 3O2AA 5EQ9A 2DWAA 4MEVA 2AYSA 2NUVA 2ZYMA 5CMCA 1RYXA 1FPKA 1DCUA 4DE8A 2DXYA 5B70A 1GGGA 1N3XA 4DI3D 4OEVA 4OVJA 4NE4A 4BDLA 3U93A 2O7UA 2QPQA 2QSXA 2R9JA 3TTLA 1I6QA 4P11A 4U2RA 2F6PA 4GFRA 3GBBA 4GVOA 5EQ7A 1A8FA 2XXHA 2Y7KA 3QUJA 2OCUA 4IGRA 1RKMA 4LZ5A 3KJTA 4JBZA 3FXQA 2ZZWA 4RK2A 3F11A 3THIA 5F7VA 2DP8A 3FV2A 1B3FA 2VOZA 2XXWA 1Y9UA 4GBWA 2QVRA 5FHNA 4MNIA 5I7IA 4O3CA 1P1NA 3MP6A 4YMBA 3O6IA 1MRPA 4OERA 4FECA 3PMXA 4C0RA 4QSEA 4PTKA 4FJPA 3VDFA 2AIXA 4HTGA 1FQEA 3H3GA 3K6UA 5H8NB 4BLAA 1B3GA 1OMPA 5CRYA 2QS1A 2ABHA 5TPAA 3RT6B 1DPPA 1GV8A 1RDXA 4GX3A 4G4PA 2REGA 1A54A 1D9VA 4IB2A 4Q5TA 4R9FA 4F31B 2Y5LA 5ITOA 1NV3A 4EQBA 1FQCA 3VVFA 2PT1A 5ET8A 3Q28A 4ESWA 3ZS6A 4PFTA 3DM0A 2X26A 3L6GA 1B0LA 4NWCA 1NV4A 2GFEA 4IR8A 1JVYA 4RA1A 3KBZA 3H6UA 1NH8A 3FJGA 2HHMA 2OWSA 2BJJX 2FA7A 3MWBA 4RXLA 4H45A 1DTZA 2VP1A 2F3DA 3MP8A 4YKIA 1US4A 1B1XA 4RPNA 5JEIA 2X7QA 3G3HA 1MXVA 5AA3A 5I3SA 4HXVA 3R7XA 4GL8A 3O66A 3T9VA 2LAOA 4AB5A 2ZNUA 1EYKA 4MBPA 3ILTB 5CMKA 4AS5A 5ISUA 4KPTA 4PDDA 4PAFA 4JB7A 4Z0IA 4L17A 1NKXA 4HE2A 1B4HA 3T93B 4F3BA 4RJZA 5TPAB 3SEWA 4F1YA 3ODBA 1PC3A 4N07A 4KCDA 3G3KA 4DXUA 1NNPA 3FXUA 2Q88A 4MIJA 5KZTA 3RTFB 4HE1A 1Z7NE 3CR9A 4PAKA 2WEFA 4XIGQ 3HCQA 1JW5A 2OLBA 3Q29A 2ONKE 3S9MC 1Z7ME 5DT6A 1QUJA 3IOUA 3CRBA 4YICA 5KDTA 2WYPA 1B1HA 4QFOA 2V4CA 3K2DA 1O63A 5L9MA 1MY0A 2XD3A 3S4UA 3UN6A 1NV2A 1HSLA 2FBPA 3UP9A 1VR5A 1MXUA 4PFYA 3VVEA 1LCFA 3K02A 4E0WA 2VD3A 1EU8A 3TDJA 5CBSA 4F29A 3PU5A 4I3YA 1IITA 1IZ1A 4FATA 3N6TA 4OTEA 1RDZA 1P1QA 3KC1A 1RYOA 2F7CA 2V25A 3T9XB 1VFEA 2RKMA 2NOOA 3HV1A 3MZ9A 1B5JA 1A8EA 1TWYA 1B2HA 1LFHA 4BDQA 3CIJA 3A29A 4IO2A 5JTYA 2D3IA 4YMAA 1B7UA 1HSEA 4PCDA 3R6UA 3VXBA 2P3VA 2XWVA 3FGSA 4Q30B 3N94A 4U22A 1JEUA 1IUDA 3N26A 2XXUA 2Z22A 4N17A 4GWWA 4G61A 1UTBA 2YLNA 1DPEA 4N4UA 5LDZA 4O7IA 4YZZA 1PB9A 4GD5A 4LZ7A 3IJXB 3MSTA 4DXBA 2RF1A 4Q8RA 1SYIA 3TEPA 1MQGA 4NTLA 3MZ1A 4PFIA 4XKNA 2Z23A 5AA2B 2V3TA 4P1EA 3SZPA 3VV5A 1R9LA 3S9NC 3MVXA 1ZU0A 1A7LA 1NMUA 1FTMA 3PUYE 3IOVA 3TPAA 2ONSA 3RT8A 1DTGA 2P0SA 3USDA 5HPQA 2PFYA 4P8BA 1NV5A 2I6EA 2HZLA 2NXOA 2Y7WA 4I9DA 3B6WA 4R6YA 1B3HA 1MDQA 1B52A 4ELRA 5A5LA 5H8QA 3RPLA 1P1UA 2UVHA 1EYJA 3WAEA 2UVIA 4XKRA 2XXQA 2OPDA 4JSDA 1B6HA 1ZJLA 5ITPA 4LATA 2HFBA 3IOTA 2XX7A 3LR1A 3HHFA 1FQFA 2ZYOA 3T9UA 1XVYA 1B3LA 1JEVA 3B6TA 5EQ8A 3IAZA 1Q9DA 1Y4TA 3IFCA 5F1QA 5JTYB 2F7BA 3DELB 3H7MA 4ONYA 1INPA 2A5TA 2XXXA 2XXRA 2ZZXA 1BK4A 2O69A 3S2VA 1B5IA 1MPDA 4ZZEA 5I5PA 1YAEA 4G68A 2FIXA 5IZ1A 3KGCA 3U8QA 3T22A 3D4GA 4JVCA 4KD5A 2CZKA 4R6HA 1Q35A 1UTBB 3T1BA 4ELQA 1NNFA 1US5A 3PTYA 4R6KA 5ET6A 4G2ZA 4PC9A 4IO4A 4OZ9A 5I2KA 1B58A 3IK6B 2JJKA 4XKPA 2Z8EA 4YKPA 4O3BA 3QSLA 4N13A 3E3KA 3LSFB 1FJ6A 3NOHA 3UK4A 1POTA 3PUVE 1FQDA 1D4NA 4DIGA 4RY1A 3PUXE 1I6BA 4QBAA 3IB0A 3KSXA 2REJA 5J16A 3P7IA 1IXIA 2V93A 3ECRA 3A3CA 4ELPA 2DWIA 2D21A 4FE8A 2V3UA 1QKAA 3ISPA 3RPWA 2ZXTA 4GXSB 5H8QB 4U4XA 4DLDA 4H46A 4F3SA 3RPLB 5AA2D 3JYRA 3OD7A 3ROJA 3OO8A 5KCJA 4IO6A 1ELJA 4Q0CA 1A99A 1FTJA 1A40A 5DEXA 4NEDA 4GF8A 4DCYA 4PF6A 2DXRA 4ISUA 4G8MA 4N6PA 2UYFA 1FBEA 3E78A 4KYEA 1GTKA 3BIGA 2F35A 1B3EA 4E0XA 3TUSA 4TQUQ 3Q27A 1USYH 2XA5A 1FRPA 1SD3A 2A5TB 2BJIA 3FVOA 3K4UA 2OX3A 4KYDA 2H9BA 3K1PA 4OMBA 2H25A 2R8TA 1ATGA 4G68B 3MJNA 5M2VA 3U72A 2X7PA 1IMFA 1URDA 5FHMA 1H76A 4OFLA 4GQOA 5I57A 4UACA 1LAFE 1MY2A 1QVSA 1XHYA 3U1OA 4C1UA 2QS3A 5I2KB 3B50A 3CSBA 2O7IA 1JP4A 1NNTA 1N04A 3FASA 4EF1A 3MC2A 2F78A 3PPRA 4KHZE 2O6AA 2QFLA 2NWJA 1MM7A 5ESYA 1MQHA 3BFTA 3FVGA 1UIVA 4ESXA 3S9EA 4OYVA 3U92A 4R9GA 4ZEIA 4I8CA 5TU0A 4O8MA 4OVPA 4KQPA 1N3WA 1HSJA 2H99A 3KFMA 1XS5A 1SW4A 4NMYA 3MZBA 2MKZA 4BDMA 3TTRA 1DMBA 2OK2A 4X04A 5EYFA 3HSTA 2GHAA 3H06B 2OJTA 2UYEA 2GQ1A 4IGTA 3BIHA 1QJMA 5DVIA 1PDAA 3KN8A 5KCJB 1YPNA 2Z8FA 1VE4A 5ET5A 5CI5A 3BFUA 3G3FA 4OETA 2ZYNA 3QUFA 5DEXB 5HBCA 4PBQA 1XI6A 3L6HA 4UABA 3UGWA 2HPGA 2AL5A 1FSAA 4PFBA 1FBDA 1SW5A 3IOWA 4MLQA 3OMBA 1M5CA 3A09A 3M3LA 2O84X 2Q8MA 1FBCA 1Y3NA 4BDNA 1POY1 1B4ZA 1LFIA 1QUIA 4LA9A 5JK4A 3JV9A 3QYTA 2PCRA 3PUZE 5I57B 1R1NA 4QF9A 4XTCQ 5FHOA 4F39A 2WBBA 4KXPA 5LOMA 1FPBA 1M5FA 2E0SA 4QSDA 3RUMA 1LGBC 3E13X 3VXCA 2Q9TA 1BTJA 4ZS9A 1B51A 1MPCA 1XC1A 1VSOA 4Z7EA 3HFUA 1D3KA 2HXRA 1QKBA 4M4GA 5K2YA 4GWOA 3OOAA 1NUYA 4OXVA 5ELVA 3FUZA 4FIMA 5DTBA 1QULA 2R6GE 4YKKA 3MW0A 1LBVA 2QL3A 3FVKA 4IO5A 3H4ZA 1O7TA 1LAXA 1EZOA 3DLNA 2YJPA 4MAGA 2HEUA 3E9XA 4ZZAA 1K9ZA 1H3DA 2HAVA 3SEYA 4QRZA 5L8DA 3SEUA 3W15C 3U94A 3IJOB 4MLVA 4EF2A 1ZIUA 4MNCA 2P3NA 4I3EA 2F34A 1LBZA 3OENA 2XXIA 1LBBA 5J1DA 3DP4A 1OVBA 4P1LA 3TCGA 5EYGA 3OSRA 4F22A 3MVWA 1IQ7A 2VPNA 3CHGA 1B7HA 4HS7A 2XXVA 4H5FA 3MP1A 1A55A 1TXFA 3C33A 1R6ZA 1WDNA 3PMWA 2WX9A 3M3KA 2O1LA 2ZMBA 1UQWA 1YZ0A 2W7YA 2CEXA 5AA2A 1YXIA 2VGQA 2Y7RA 4PP0A 1DOTA 4PGNA 1N7XA 2DQVA 3DP8A 2V3QA 3SDFA 3Q26A 4QSCA 3T9HB 2CZIA 1PBQA 2QS4A 4U4SA 2RC7A 3K1NA 4YKJA 4G77A 4EQ9A 3OO6A 2RINA 1TFDA 3E4RA 1IXCA 2NVUB 4M1VA 1I6AA 3A3UA 4WXJA 1NV6A 4IY6A 3TAJA 2VT5A 3KOTA 1O64A 2I4BA 3C35A 4P0GA 1LBXA 4X48A 4ZEBA 1IMEA 1VDWA 4FEDA 3TFLA 2ZNSA 2L5VA 3FXRA 4H1XA 4MHFA 1URSA 1NUXA 1FQAA 4PE3A 3FBPA 1H45A 1NNKA 4NWDA 1B7ZA 4AB6A 3EN3A 2UXAA 1FW0A 3BBRA 3GYYA 2Q74A 1S9TA 3K6XA 1FBPA 1LSTA 4AQ4A 3ZKKA 3VVDA 4F18A 4PE5B 4I62A 1IMBA 4F1VA 1FPIA 1IXHA 3C32A 4H8JA 5EHSA 3I5OA 3FATA 3SEVA 1MPBA 5BUUA 1FPEA 4PFWA 5EHMA 1LFGA 3HO7A 1AWBA 2FIEA 4OANA 2PMSA 3MVZA 3LC8A 5K2XA 3V5AA 3SEXA 2Y7IA 3T96B 3RN8A 4OQOA 4F3GA 1MH3A 1SI1A 4LUBA 3GLBA 4C1TA 4QHQA 4NG7A 3TMGA 4I1DA 1P1OA 2ALUA 3CVGA 4TLLB 1KA1A 4NX1A 3U65A 1CNQA 5AE4A 1MS7A 1JQFA 2DDKA 2XX9A 4KFQA 4LN5A 4EDPA 4LP2B 1JW1A 2B65A 4XFEA 1TFAA 3B8BA 3OSQA 2I58A 1PB7A 3KEIA 2F7AA 4PFRA 2GH9A 4IO7A 1FTKA 3D1RA 1OIBA 4EXLA 1PBPA 3RQTA 4LQ2A 3TKDA 3FVNA 1Y3PA 4IO3A 4YU0A 3TYHA 5CC2A 3RLFE 1B9JA 3H6TA 3QAXA 4O7MA 3TCHA 1MQDA 3C4MA 1EYIA 2DE4A 1ANFA 1MY1A 3HHGA 3D4CA 1NL5A 2FNCA 3CFLA 3O9PA 3UA8A 2DSFA 4ZDMA 2O68A 5FTIA 4U1OA 2QVVA 2KQZA 4GWUA 4MX6A 3I6VA 1M5DA 3FIRA 2VD2A 5IAIA 5DW8A 1F9BA 4GWYA 3Q25A 2H5YA 1FPGA 3UORA 3ZSFA 4H8IA 3CG3A 4NF0A 1ZTYA 3EHUA 4HCWA 4MH5A 1T0KA 1N84A 5DVFA 4OEUA 4PFUA 2CZHA 5AA1A 2PVUA 4N6DA 2QMWA 5IM2A 3QXMA 3PMVA 4XXUA 2G93A 5H8HB 2UVJA 2CMOA 1FCKA 4R72A 1MG1A 2O51A 3OEKA 2QVUA 2HZKA 5CMMA 1Q1KA 3FV1A 3ZKLA 3K6WA 4QFNA 3CFXA 4GLIA 1MXWA 3PPNA 2RC8A 1MDP1 4RYAA 1TT1A 5HM4B 1NV0A 1LBCA 2WYKA 2PFZA 3MPLA 5F24A 5I56A 2XWOA 1NI9A 2DS9A 2B4LA 4X8RA 2PYYA 4F2QA 1FQBA 3QK6A 4KI0E 4XKQA 4XEQA 2QRYA 1IMDA 5I58A 3G3GA 3PD8A 1JETA 3IL1B 1IXGA 2GHBA 1SDXA 1LLSA 3KBRA 4PGPA 2OBGA 1LEVA 4GOTA 2RC9A 1IMAA 2E1SA 4DZ1A 3G3IA 1SVXB 4POWA 4RNSA 3LUYA 1P1WA 5CBRA 3TQLA 4GL0A 1AOVA 4OFJA 1MH4A 3CSGA 2M8CA 2FVZA 3R26A 3KOSA 4RK9A 3OO7A 1SI0A 3H03A 3MBPA 4UA8A 3FJ7A 1B5HA 4GXAA 5ICQA 3ILUB 1KWHA 3K0VA 1N7WA 4ZE9A 4GWZA 2IEEA 4LQ5A 3SETA 1UIUA 1ZBMA 4OVSA 1FTLA 1LAHE 4JSOA 3VE1B 3KC0A 4JWOA 2YPNA 3VLVA 4ZE8A 2XXKA 2OWZA 4AS4A 1UTHA 2DWHA 5I84A 4JDFA 2DYXA 3TZAA 3IORA 3QIMA 4P9KA 1G0IA 1AL3A 1YTVA 3JZJA 4NN3A 2DE2A 3K00A 2QMXA 4P0IA 1PB8A 5I56B 3RY3A 2DVZA 3TCFA 5DYHA 4HCYA 4KR5A 1DK4A 4NQ8A 5AA4B 1DSNA 4ZEDA 1AMFA 5L9SA 1MY3A 3O28A 1S7YA 3BKIB 4X1BA 3UIFA 5I58B 1BLFA 2IA4A 1II5A 4PDHA 2WKYA 3QMFA 4O3AA 1R9QA 3ONMA 4EUOA 3SESA 5I59A 4PBHA 1D9QA 2I4CA 1H43A 3LSLA 3FZVA 2ZYKA 4YAHX 1NUZA 1LB8A 4FBPA 5CMBA 4HE0A 4P3LA 4DI4B 3V83A 4GIZA 4KCCA 2Y5KA 4N81A 3W9WA 4U1ZA 2F97A 1FPJA 4NF8A 4N15A 3IR1A 3M3FA 1FBGA 5H8SA 2KLFA 5IZZA 2ANJA 3LUZA 4F1UA 1B46A 5ICTA 2PT2A 2HQ0A 2ESNA 3PV0E 4EQ7A 4POXA 2KR0A 3RTWB 3TQWA 4PF8A 4GX6A 3H6WA 4YB5A 1BIYA 1SYHA 2R71A 1B32A 1G0HA 3EKIA 3K6VA 1MXZA 1Y4CA 5DVJA 5I2NA 3IX1A 1UTHB 4O94A 2DE3A 4OWDA 1NUWA 2Q89A 3I3VA 3KN3A 3GXAA 4N91A 1YCJA 2RCBA 4NF5A 4OVTA 2PX1A 1I69A 1LAGE 4IY5A 4I40A 3LSXA 3PPPA 1MXXA 1JW4A 4JVDA 4ZEKA 3PUWE 1Y1ZA 1QUKA 1ZKBA 4DCXA 1EZPA 1FBHA 1XOCA 4NF6A 1QGXA 2CZLA 3FXBA 3O97A 1XT8A 4NAPA 3KZGA 5I59B 3V89B 1OVTA 2RCAA 3CI8A 3O6HA 3LSWA 3KG2A 1P99A 1WVJA 1MQIA 1LCTA 4GRKA 3HPIA 4ECFA 1ZLQA 3VLUA 4H5GA 4X9TA 4YB7A 2XX8A 4JWXA 5ET7A 1MM6A 3EF7A 1OLCA 2XWKA 3K1MA 4XF5A 3C31A 4QFLA 2B3FA 5EYHA 2GRVA 2I3WA 4NF8B 1AH5A 4OHNA 3RGYA 2HCAA 4R74A 1AIVA 2H98A 3E79A 5EQAA 4FORA 3T66A 1FPFA 4N8YA 3TODA 3C9HA 5FBPA 1GR2A 1FPLA 1ZMGA 1MQJA 2XD2A 5I2NB 4N6KA 4NGUA 4WEDA 2ZNTA 4N8GA 1SQYA 5H8FA 4R2FA 2Q8JA 3B7DA 4G8HA 1LBYA 5CM6A 1SW1A 2V84A 3CG1A 1L5TA 2F36A 2XXYA 4NF5B 1PEBA 3TTKA 1IEJA 4U23A 2WBDA 2FHYA 2I0BA 4JVIA 3CFZA 2CEYA 2HAUA 3C36A 4RPOA 2F3BA 4R2BA 3O6GA 1M5BA 4H0WA 2FYIA 4X1DA 2XXPA 4QXDA 3TELA 3W9VA 5L9OA 2UVGA 3EPEA 3MYUA 5A5XA 2PBWA 1N0TA 3N5LA 4NF6B 4G8NA 4GWXA 4H67A 4MCOA 5IZ3A 4ZEFA 1D9YA 1EH3A 1VFDA 3IB1A 2A5SA 4G68C
chains in the Genus database with same CATH topology
1EYKA 2MKZA 1KZ8A 1LBWA 5IGAA 4X04A 1FJ9A 2GQ1A 2QVUA 2HZKA 3BIHA 4AS5A 5ET5A 4PDDA 4PAFA 5T3JA 1FPDA 2ZZVA 4PBQA 1XI6A 4HE2A 4UABA 2HPGA 1FSAA 2XWIA 1NV0A 4PFBA 1FBDA 2WYKA 2PFZA 5F24A 4OVRA 2XWOA 1DBZA 3T0JA 1NI9A 2B4LA 4MIJA 4X8RA 4HE1A 4PAKA 2WEFA 2Q8MA 1FBCA 4XEQA 1IMDA 1KA0A 4OA4A 4YICA 2WYPA 5JK4A 3RYDA 2V4CA 2PCRA 1NV2A 2FBPA 4PGPA 5LTCA 1LEVA 2WBBA 4KXPA 1FPBA 1IMAA 2Q9TA 4I3YA 4NHBA 4PETA 4P47A 1RDZA 2B4MA 3HFUA 2FVZA 3KC1A 2HXRA 1FBFA 5IZ3B 1NUYA 1SPIA 1K9YA 4GWZA 3A29A 4MJOA 1LBVA 4P56A 4OVSA 4PCDA 2P3VA 2XWVA 3KC0A 2XXKA 1RDYA 2OWZA 4AS4A 4MAGA 4N17A 4GWWA 1K9ZA 1IMCA 4OVQA 4G61A 4P9KA 1G0IA 3IFAA 4N4UA 5LDZA 4O7IA 4NN3A 4YZZA 2DE2A 4MNCA 2P3NA 4I3EA 3MSTA 1LBZA 4MNPA 5J1DA 2DVZA 4P1LA 4PFIA 4HCYA 5EYGA 1DK4A 4NQ8A 2VPNA 4P1EA 3SZPA 4MMPA 3CHGA 2WX9A 4PAIA 1YZ0A 4PDHA 2CEXA 3QMFA 2PFYA 4P8BA 1NV5A 1YXIA 2HZLA 2F5XA 1NV7A 4PBHA 4GWSA 1D9QA 4PGNA 4GX4A 2V3QA 1NUZA 1YYZA 4F19A 5A5LA 4FBPA 2CZIA 4HE0A 4P3LA 4DI4B 3RPLA 2Y5KA 1EYJA 3LV0A 4N81A 3W9WA 1FPJA 4N15A 1NV1A 4M1VA 1FBGA 5IZZA 2VPOA 1NV6A 3LUZA 4GBVA 4F1UA 1FTAA 2VT5A 5EQ8A 1LBXA 2KR0A 1Q9DA 1IMEA 1VDWA 5EQ9A 4MEVA 3IFCA 4PF8A 4GX6A 2L5VA 1FPKA 1DCUA 1INPA 4MHFA 2ZZXA 1BK4A 1G0HA 3EKIA 1NUXA 5I5PA 4PE3A 2FIXA 4DI3D 3FBPA 5IZ1A 4O94A 2DE3A 4JVCA 1NUWA 2CZKA 3T1BA 3GYYA 2Q74A 4N91A 3PTYA 1FBPA 5ET6A 2QPQA 4F18A 4PC9A 4OVTA 1IMBA 2JJKA 4F1VA 1FPIA 4I40A 4JVDA 1FPEA 1AWBA 2FIEA 4OANA 1FJ6A 3NOHA 1FBHA 5EQ7A 1QGXA 4QBAA 3FXBA 2ZZWA 4NG7A 4NAPA 5J16A 1KA1A 4GBWA 2QVRA 4MNIA 4NX1A 3U65A 5I7IA 3ISPA 1CNQA 2DDKA 4LN5A 4X9TA 4H46A 3RPLB 5ET7A 4XFEA 3ROJA 2XWKA 3B8BA 4XF5A 5EYHA 4PTKA 4PFRA 4PF6A 3E79A 3D1RA 5EQAA 1FBEA 3E78A 3BIGA 1RDXA 1FPFA 4N8YA 4GX3A 4O7MA 2XA5A 1FRPA 1EYIA 5FBPA 2BJIA 2DE4A 1FPLA 2OX3A 2Y5LA 2R8TA 1NV3A 4N6KA 4NGUA 1IMFA 5ET8A 4N8GA 1LBYA 2QVVA 5CM6A 2KQZA 4GWUA 4MX6A 1NV4A 5DW8A 3B50A 4IR8A 4GWYA 1JP4A 3KBZA 2WBDA 2FHYA 4JVIA 2CEYA 2HHMA 2F3BA 1FPGA 4H45A 2QFLA 4NF0A 5ESYA 2F3DA 4QXDA 3W9VA 4HCWA 3MYUA 4GWXA 5I3SA 4HXVA 2CZHA 4MCOA 5IZ3A 4N6DA 5IM2A 4O8MA 4OVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYK A;  1FPJ A;  5IZ3 B;  1NV1 A;  1NUY A;  5ET7 A;  1KZ8 A;  3ROJ A;  1FBG A;  1LBW A;  1SPI A;  1K9Y A;  3B8B A;  1FJ9 A;  1NV6 A;  3LUZ A;  4GBV A;  5EYH A;  4GWZ A;  3A29 A;  2GQ1 A;  1FTA A;  2QVU A;  1LBV A;  4MJO A;  4PTK A;  3BIH A;  2VT5 A;  5EQ8 A;  1LBX A;  4AS5 A;  5ET5 A;  1Q9D A;  2P3V A;  1IME A;  1VDW A;  5T3J A;  5EQ9 A;  1FPD A;  3KC0 A;  3IFC A;  4GX6 A;  3D1R A;  5EQA A;  1FPK A;  1DCU A;  1RDY A;  1FBE A;  2OWZ A;  1XI6 A;  1INP A;  4HE2 A;  3BIG A;  4AS4 A;  1FSA A;  1RDX A;  1FPF A;  1BK4 A;  1G0H A;  4GX3 A;  4GWW A;  1NUX A;  1K9Z A;  1NV0 A;  1IMC A;  1FBD A;  1FRP A;  1EYI A;  4G61 A;  5FBP A;  2FIX A;  3FBP A;  2BJI A;  5F24 A;  5IZ1 A;  1G0I A;  1FPL A;  1DBZ A;  3IFA A;  1NI9 A;  3T0J A;  2OX3 A;  4O7I A;  5LDZ A;  1NUW A;  2CZK A;  2Y5L A;  2R8T A;  4HE1 A;  2P3N A;  4I3E A;  1NV3 A;  1LBZ A;  2WEF A;  2Q8M A;  1FBC A;  2Q74 A;  5EYG A;  1IMF A;  1FBP A;  5ET6 A;  1DK4 A;  5ET8 A;  1IMD A;  1KA0 A;  1IMB A;  2JJK A;  1FPI A;  1LBY A;  2QVV A;  4GWU A;  4I40 A;  3RYD A;  2PCR A;  1NV4 A;  1FPE A;  1YZ0 A;  5DW8 A;  4IR8 A;  1AWB A;  2FIE A;  1JP4 A;  1NV2 A;  4GWY A;  2FBP A;  3KBZ A;  2WBD A;  2FHY A;  1FJ6 A;  3QMF A;  2HHM A;  2F3B A;  1FBH A;  1LEV A;  1NV5 A;  5EQ7 A;  1YXI A;  2WBB A;  4KXP A;  1FPG A;  1FPB A;  1NV7 A;  1IMA A;  4H45 A;  2QFL A;  1D9Q A;  1QGX A;  4GWS A;  5ESY A;  2F3D A;  4QXD A;  4GX4 A;  1NUZ A;  4I3Y A;  5J16 A;  4GWX A;  1YYZ A;  5A5L A;  5I3S A;  4FBP A;  4HXV A;  1KA1 A;  2CZH A;  2CZI A;  2QVR A;  4GBW A;  1RDZ A;  4HE0 A;  3RPL A;  2FVZ A;  5IZ3 A;  3KC1 A;  2Y5K A;  1EYJ A;  1CNQ A;  3LV0 A;  1FBF A;  2DDK A;  4N81 A;  4H46 A;  3RPL B; 
#chains in the Genus database with same CATH topology
 1KZ8 A;  1LBW A;  5B7D A;  2THI A;  1OQG A;  3MPK A;  5IGA A;  1FJ9 A;  1B0H A;  3GBA A;  3MAM A;  1CB6 A;  3KN7 A;  4H65 A;  4EXK A;  5H8H A;  3VLW A;  2Q2C A;  1BKA A;  5T3J A;  1FPD A;  3IO6 A;  2ZZV A;  4TOZ A;  1SW2 A;  1GVC A;  3KSJ A;  1FTO A;  3OXN A;  4FEB A;  2XWI A;  1NH7 A;  3LBS A;  4BDO A;  4TLM B;  3TTM A;  3FD3 A;  2XHD A;  4OVR A;  3SER A;  1DBZ A;  3T0J A;  5KDT B;  3MVY A;  4PQJ A;  2VHA A;  3KJ7 A;  2I49 A;  2P2A A;  1KA0 A;  4LVQ A;  5BWJ A;  4OA4 A;  4U21 A;  1M5E A;  2ONR A;  4ZEC A;  3RYD A;  1J1N A;  5H8F B;  2OWT A;  4MF3 A;  2DWJ A;  3G3J A;  2I0C A;  5LTC A;  4NF4 A;  1B05 A;  2P1S A;  2I3V A;  4ND9 A;  3IO4 A;  2G29 A;  3OO9 A;  1BP5 A;  4FAJ A;  1N76 A;  1USY E;  3FJM A;  4YB6 A;  4BDR A;  2AL4 A;  4NHB A;  4JXI A;  4PET A;  4P47 A;  4ELO A;  3EHS A;  2Y7P A;  2B4M A;  3TTN A;  4QFK A;  5A5X B;  3WAF A;  2F8D A;  5TP9 A;  1FBF A;  3S9L C;  1OLA A;  1Y3Q A;  1Y1M A;  5IZ3 B;  1XVX A;  4DXC A;  1SPI A;  1K9Y A;  4KYS A;  2O1M A;  4MJO A;  3PD9 A;  4P56 A;  5FTH A;  3VFJ A;  4WEP A;  3GZG A;  3V8X B;  4OES A;  2Y84 A;  1RDY A;  3B6Q A;  3MUQ A;  2H4I A;  3PGF A;  1NFT A;  2XXT A;  1IMC A;  1JVX A;  3N6U A;  4OVQ A;  4QFP A;  1IIW A;  2DVC A;  4WKM A;  3IFA A;  5IKB A;  1OQH A;  2F6G A;  1EZ9 A;  4MNP A;  4OFO A;  3O29 A;  4MMP A;  4THI A;  3SKP A;  4H6D A;  3G7W A;  1CE2 A;  2Q2A A;  4LON B;  3M8U A;  4PAI A;  3MQ9 A;  3OEM A;  3IB2 A;  3RNN A;  2OPE A;  1LB9 A;  5AA4 A;  3K01 A;  4JWY A;  2HXW A;  2D5W A;  2F5X A;  1NV7 A;  4GWS A;  1S50 A;  1MY4 A;  2QS2 A;  4GX4 A;  3AXF A;  4NF4 B;  4R73 A;  1SBP A;  4F2O A;  1YYZ A;  1H44 A;  4F19 A;  2Z8D A;  4HW8 A;  3EQ1 A;  3PPO A;  4F3P A;  3PPQ A;  1JNF A;  1Y20 A;  3C34 A;  3EHT A;  2DOJ A;  1B40 A;  3LV0 A;  4OEN A;  2I48 A;  2OZZ A;  2QJE A;  1NV1 A;  5TP9 B;  3HN0 A;  2B3B A;  3H6V A;  4DDD A;  2VPO A;  4MFI A;  4GBV A;  4K3F A;  5H8N A;  4LZ8 A;  1MXY A;  1FTA A;  3DP6 A;  4R75 A;  1WOD A;  3OEL A;  1QW0 A;  1URG A;  3O2A A;  5EQ9 A;  2DWA A;  4MEV A;  2AYS A;  2NUV A;  2ZYM A;  5CMC A;  1RYX A;  1FPK A;  1DCU A;  4DE8 A;  2DXY A;  5B70 A;  1GGG A;  1N3X A;  4DI3 D;  4OEV A;  4OVJ A;  4NE4 A;  4BDL A;  3U93 A;  2O7U A;  2QPQ A;  2QSX A;  2R9J A;  3TTL A;  1I6Q A;  4P11 A;  4U2R A;  2F6P A;  4GFR A;  3GBB A;  4GVO A;  5EQ7 A;  1A8F A;  2XXH A;  2Y7K A;  3QUJ A;  2OCU A;  4IGR A;  1RKM A;  4LZ5 A;  3KJT A;  4JBZ A;  3FXQ A;  2ZZW A;  4RK2 A;  3F11 A;  3THI A;  5F7V A;  2DP8 A;  3FV2 A;  1B3F A;  2VOZ A;  2XXW A;  1Y9U A;  4GBW A;  2QVR A;  5FHN A;  4MNI A;  5I7I A;  4O3C A;  1P1N A;  3MP6 A;  4YMB A;  3O6I A;  1MRP A;  4OER A;  4FEC A;  3PMX A;  4C0R A;  4QSE A;  4PTK A;  4FJP A;  3VDF A;  2AIX A;  4HTG A;  1FQE A;  3H3G A;  3K6U A;  5H8N B;  4BLA A;  1B3G A;  1OMP A;  5CRY A;  2QS1 A;  2ABH A;  5TPA A;  3RT6 B;  1DPP A;  1GV8 A;  1RDX A;  4GX3 A;  4G4P A;  2REG A;  1A54 A;  1D9V A;  4IB2 A;  4Q5T A;  4R9F A;  4F31 B;  2Y5L A;  5ITO A;  1NV3 A;  4EQB A;  1FQC A;  3VVF A;  2PT1 A;  5ET8 A;  3Q28 A;  4ESW A;  3ZS6 A;  4PFT A;  3DM0 A;  2X26 A;  3L6G A;  1B0L A;  4NWC A;  1NV4 A;  2GFE A;  4IR8 A;  1JVY A;  4RA1 A;  3KBZ A;  3H6U A;  1NH8 A;  3FJG A;  2HHM A;  2OWS A;  2BJJ X;  2FA7 A;  3MWB A;  4RXL A;  4H45 A;  1DTZ A;  2VP1 A;  2F3D A;  3MP8 A;  4YKI A;  1US4 A;  1B1X A;  4RPN A;  5JEI A;  2X7Q A;  3G3H A;  1MXV A;  5AA3 A;  5I3S A;  4HXV A;  3R7X A;  4GL8 A;  3O66 A;  3T9V A;  2LAO A;  4AB5 A;  2ZNU A;  1EYK A;  4MBP A;  3ILT B;  5CMK A;  4AS5 A;  5ISU A;  4KPT A;  4PDD A;  4PAF A;  4JB7 A;  4Z0I A;  4L17 A;  1NKX A;  4HE2 A;  1B4H A;  3T93 B;  4F3B A;  4RJZ A;  5TPA B;  3SEW A;  4F1Y A;  3ODB A;  1PC3 A;  4N07 A;  4KCD A;  3G3K A;  4DXU A;  1NNP A;  3FXU A;  2Q88 A;  4MIJ A;  5KZT A;  3RTF B;  4HE1 A;  1Z7N E;  3CR9 A;  4PAK A;  2WEF A;  4XIG Q;  3HCQ A;  1JW5 A;  2OLB A;  3Q29 A;  2ONK E;  3S9M C;  1Z7M E;  5DT6 A;  1QUJ A;  3IOU A;  3CRB A;  4YIC A;  5KDT A;  2WYP A;  1B1H A;  4QFO A;  2V4C A;  3K2D A;  1O63 A;  5L9M A;  1MY0 A;  2XD3 A;  3S4U A;  3UN6 A;  1NV2 A;  1HSL A;  2FBP A;  3UP9 A;  1VR5 A;  1MXU A;  4PFY A;  3VVE A;  1LCF A;  3K02 A;  4E0W A;  2VD3 A;  1EU8 A;  3TDJ A;  5CBS A;  4F29 A;  3PU5 A;  4I3Y A;  1IIT A;  1IZ1 A;  4FAT A;  3N6T A;  4OTE A;  1RDZ A;  1P1Q A;  3KC1 A;  1RYO A;  2F7C A;  2V25 A;  3T9X B;  1VFE A;  2RKM A;  2NOO A;  3HV1 A;  3MZ9 A;  1B5J A;  1A8E A;  1TWY A;  1B2H A;  1LFH A;  4BDQ A;  3CIJ A;  3A29 A;  4IO2 A;  5JTY A;  2D3I A;  4YMA A;  1B7U A;  1HSE A;  4PCD A;  3R6U A;  3VXB A;  2P3V A;  2XWV A;  3FGS A;  4Q30 B;  3N94 A;  4U22 A;  1JEU A;  1IUD A;  3N26 A;  2XXU A;  2Z22 A;  4N17 A;  4GWW A;  4G61 A;  1UTB A;  2YLN A;  1DPE A;  4N4U A;  5LDZ A;  4O7I A;  4YZZ A;  1PB9 A;  4GD5 A;  4LZ7 A;  3IJX B;  3MST A;  4DXB A;  2RF1 A;  4Q8R A;  1SYI A;  3TEP A;  1MQG A;  4NTL A;  3MZ1 A;  4PFI A;  4XKN A;  2Z23 A;  5AA2 B;  2V3T A;  4P1E A;  3SZP A;  3VV5 A;  1R9L A;  3S9N C;  3MVX A;  1ZU0 A;  1A7L A;  1NMU A;  1FTM A;  3PUY E;  3IOV A;  3TPA A;  2ONS A;  3RT8 A;  1DTG A;  2P0S A;  3USD A;  5HPQ A;  2PFY A;  4P8B A;  1NV5 A;  2I6E A;  2HZL A;  2NXO A;  2Y7W A;  4I9D A;  3B6W A;  4R6Y A;  1B3H A;  1MDQ A;  1B52 A;  4ELR A;  5A5L A;  5H8Q A;  3RPL A;  1P1U A;  2UVH A;  1EYJ A;  3WAE A;  2UVI A;  4XKR A;  2XXQ A;  2OPD A;  4JSD A;  1B6H A;  1ZJL A;  5ITP A;  4LAT A;  2HFB A;  3IOT A;  2XX7 A;  3LR1 A;  3HHF A;  1FQF A;  2ZYO A;  3T9U A;  1XVY A;  1B3L A;  1JEV A;  3B6T A;  5EQ8 A;  3IAZ A;  1Q9D A;  1Y4T A;  3IFC A;  5F1Q A;  5JTY B;  2F7B A;  3DEL B;  3H7M A;  4ONY A;  1INP A;  2A5T A;  2XXX A;  2XXR A;  2ZZX A;  1BK4 A;  2O69 A;  3S2V A;  1B5I A;  1MPD A;  4ZZE A;  5I5P A;  1YAE A;  4G68 A;  2FIX A;  5IZ1 A;  3KGC A;  3U8Q A;  3T22 A;  3D4G A;  4JVC A;  4KD5 A;  2CZK A;  4R6H A;  1Q35 A;  1UTB B;  3T1B A;  4ELQ A;  1NNF A;  1US5 A;  3PTY A;  4R6K A;  5ET6 A;  4G2Z A;  4PC9 A;  4IO4 A;  4OZ9 A;  5I2K A;  1B58 A;  3IK6 B;  2JJK A;  4XKP A;  2Z8E A;  4YKP A;  4O3B A;  3QSL A;  4N13 A;  3E3K A;  3LSF B;  1FJ6 A;  3NOH A;  3UK4 A;  1POT A;  3PUV E;  1FQD A;  1D4N A;  4DIG A;  4RY1 A;  3PUX E;  1I6B A;  4QBA A;  3IB0 A;  3KSX A;  2REJ A;  5J16 A;  3P7I A;  1IXI A;  2V93 A;  3ECR A;  3A3C A;  4ELP A;  2DWI A;  2D21 A;  4FE8 A;  2V3U A;  1QKA A;  3ISP A;  3RPW A;  2ZXT A;  4GXS B;  5H8Q B;  4U4X A;  4DLD A;  4H46 A;  4F3S A;  3RPL B;  5AA2 D;  3JYR A;  3OD7 A;  3ROJ A;  3OO8 A;  5KCJ A;  4IO6 A;  1ELJ A;  4Q0C A;  1A99 A;  1FTJ A;  1A40 A;  5DEX A;  4NED A;  4GF8 A;  4DCY A;  4PF6 A;  2DXR A;  4ISU A;  4G8M A;  4N6P A;  2UYF A;  1FBE A;  3E78 A;  4KYE A;  1GTK A;  3BIG A;  2F35 A;  1B3E A;  4E0X A;  3TUS A;  4TQU Q;  3Q27 A;  1USY H;  2XA5 A;  1FRP A;  1SD3 A;  2A5T B;  2BJI A;  3FVO A;  3K4U A;  2OX3 A;  4KYD A;  2H9B A;  3K1P A;  4OMB A;  2H25 A;  2R8T A;  1ATG A;  4G68 B;  3MJN A;  5M2V A;  3U72 A;  2X7P A;  1IMF A;  1URD A;  5FHM A;  1H76 A;  4OFL A;  4GQO A;  5I57 A;  4UAC A;  1LAF E;  1MY2 A;  1QVS A;  1XHY A;  3U1O A;  4C1U A;  2QS3 A;  5I2K B;  3B50 A;  3CSB A;  2O7I A;  1JP4 A;  1NNT A;  1N04 A;  3FAS A;  4EF1 A;  3MC2 A;  2F78 A;  3PPR A;  4KHZ E;  2O6A A;  2QFL A;  2NWJ A;  1MM7 A;  5ESY A;  1MQH A;  3BFT A;  3FVG A;  1UIV A;  4ESX A;  3S9E A;  4OYV A;  3U92 A;  4R9G A;  4ZEI A;  4I8C A;  5TU0 A;  4O8M A;  4OVP A;  4KQP A;  1N3W A;  1HSJ A;  2H99 A;  3KFM A;  1XS5 A;  1SW4 A;  4NMY A;  3MZB A;  2MKZ A;  4BDM A;  3TTR A;  1DMB A;  2OK2 A;  4X04 A;  5EYF A;  3HST A;  2GHA A;  3H06 B;  2OJT A;  2UYE A;  2GQ1 A;  4IGT A;  3BIH A;  1QJM A;  5DVI A;  1PDA A;  3KN8 A;  5KCJ B;  1YPN A;  2Z8F A;  1VE4 A;  5ET5 A;  5CI5 A;  3BFU A;  3G3F A;  4OET A;  2ZYN A;  3QUF A;  5DEX B;  5HBC A;  4PBQ A;  1XI6 A;  3L6H A;  4UAB A;  3UGW A;  2HPG A;  2AL5 A;  1FSA A;  4PFB A;  1FBD A;  1SW5 A;  3IOW A;  4MLQ A;  3OMB A;  1M5C A;  3A09 A;  3M3L A;  2O84 X;  2Q8M A;  1FBC A;  1Y3N A;  4BDN A;  1POY 1;  1B4Z A;  1LFI A;  1QUI A;  4LA9 A;  5JK4 A;  3JV9 A;  3QYT A;  2PCR A;  3PUZ E;  5I57 B;  1R1N A;  4QF9 A;  4XTC Q;  5FHO A;  4F39 A;  2WBB A;  4KXP A;  5LOM A;  1FPB A;  1M5F A;  2E0S A;  4QSD A;  3RUM A;  1LGB C;  3E13 X;  3VXC A;  2Q9T A;  1BTJ A;  4ZS9 A;  1B51 A;  1MPC A;  1XC1 A;  1VSO A;  4Z7E A;  3HFU A;  1D3K A;  2HXR A;  1QKB A;  4M4G A;  5K2Y A;  4GWO A;  3OOA A;  1NUY A;  4OXV A;  5ELV A;  3FUZ A;  4FIM A;  5DTB A;  1QUL A;  2R6G E;  4YKK A;  3MW0 A;  1LBV A;  2QL3 A;  3FVK A;  4IO5 A;  3H4Z A;  1O7T A;  1LAX A;  1EZO A;  3DLN A;  2YJP A;  4MAG A;  2HEU A;  3E9X A;  4ZZA A;  1K9Z A;  1H3D A;  2HAV A;  3SEY A;  4QRZ A;  5L8D A;  3SEU A;  3W15 C;  3U94 A;  3IJO B;  4MLV A;  4EF2 A;  1ZIU A;  4MNC A;  2P3N A;  4I3E A;  2F34 A;  1LBZ A;  3OEN A;  2XXI A;  1LBB A;  5J1D A;  3DP4 A;  1OVB A;  4P1L A;  3TCG A;  5EYG A;  3OSR A;  4F22 A;  3MVW A;  1IQ7 A;  2VPN A;  3CHG A;  1B7H A;  4HS7 A;  2XXV A;  4H5F A;  3MP1 A;  1A55 A;  1TXF A;  3C33 A;  1R6Z A;  1WDN A;  3PMW A;  2WX9 A;  3M3K A;  2O1L A;  2ZMB A;  1UQW A;  1YZ0 A;  2W7Y A;  2CEX A;  5AA2 A;  1YXI A;  2VGQ A;  2Y7R A;  4PP0 A;  1DOT A;  4PGN A;  1N7X A;  2DQV A;  3DP8 A;  2V3Q A;  3SDF A;  3Q26 A;  4QSC A;  3T9H B;  2CZI A;  1PBQ A;  2QS4 A;  4U4S A;  2RC7 A;  3K1N A;  4YKJ A;  4G77 A;  4EQ9 A;  3OO6 A;  2RIN A;  1TFD A;  3E4R A;  1IXC A;  2NVU B;  4M1V A;  1I6A A;  3A3U A;  4WXJ A;  1NV6 A;  4IY6 A;  3TAJ A;  2VT5 A;  3KOT A;  1O64 A;  2I4B A;  3C35 A;  4P0G A;  1LBX A;  4X48 A;  4ZEB A;  1IME A;  1VDW A;  4FED A;  3TFL A;  2ZNS A;  2L5V A;  3FXR A;  4H1X A;  4MHF A;  1URS A;  1NUX A;  1FQA A;  4PE3 A;  3FBP A;  1H45 A;  1NNK A;  4NWD A;  1B7Z A;  4AB6 A;  3EN3 A;  2UXA A;  1FW0 A;  3BBR A;  3GYY A;  2Q74 A;  1S9T A;  3K6X A;  1FBP A;  1LST A;  4AQ4 A;  3ZKK A;  3VVD A;  4F18 A;  4PE5 B;  4I62 A;  1IMB A;  4F1V A;  1FPI A;  1IXH A;  3C32 A;  4H8J A;  5EHS A;  3I5O A;  3FAT A;  3SEV A;  1MPB A;  5BUU A;  1FPE A;  4PFW A;  5EHM A;  1LFG A;  3HO7 A;  1AWB A;  2FIE A;  4OAN A;  2PMS A;  3MVZ A;  3LC8 A;  5K2X A;  3V5A A;  3SEX A;  2Y7I A;  3T96 B;  3RN8 A;  4OQO A;  4F3G A;  1MH3 A;  1SI1 A;  4LUB A;  3GLB A;  4C1T A;  4QHQ A;  4NG7 A;  3TMG A;  4I1D A;  1P1O A;  2ALU A;  3CVG A;  4TLL B;  1KA1 A;  4NX1 A;  3U65 A;  1CNQ A;  5AE4 A;  1MS7 A;  1JQF A;  2DDK A;  2XX9 A;  4KFQ A;  4LN5 A;  4EDP A;  4LP2 B;  1JW1 A;  2B65 A;  4XFE A;  1TFA A;  3B8B A;  3OSQ A;  2I58 A;  1PB7 A;  3KEI A;  2F7A A;  4PFR A;  2GH9 A;  4IO7 A;  1FTK A;  3D1R A;  1OIB A;  4EXL A;  1PBP A;  3RQT A;  4LQ2 A;  3TKD A;  3FVN A;  1Y3P A;  4IO3 A;  4YU0 A;  3TYH A;  5CC2 A;  3RLF E;  1B9J A;  3H6T A;  3QAX A;  4O7M A;  3TCH A;  1MQD A;  3C4M A;  1EYI A;  2DE4 A;  1ANF A;  1MY1 A;  3HHG A;  3D4C A;  1NL5 A;  2FNC A;  3CFL A;  3O9P A;  3UA8 A;  2DSF A;  4ZDM A;  2O68 A;  5FTI A;  4U1O A;  2QVV A;  2KQZ A;  4GWU A;  4MX6 A;  3I6V A;  1M5D A;  3FIR A;  2VD2 A;  5IAI A;  5DW8 A;  1F9B A;  4GWY A;  3Q25 A;  2H5Y A;  1FPG A;  3UOR A;  3ZSF A;  4H8I A;  3CG3 A;  4NF0 A;  1ZTY A;  3EHU A;  4HCW A;  4MH5 A;  1T0K A;  1N84 A;  5DVF A;  4OEU A;  4PFU A;  2CZH A;  5AA1 A;  2PVU A;  4N6D A;  2QMW A;  5IM2 A;  3QXM A;  3PMV A;  4XXU A;  2G93 A;  5H8H B;  2UVJ A;  2CMO A;  1FCK A;  4R72 A;  1MG1 A;  2O51 A;  3OEK A;  2QVU A;  2HZK A;  5CMM A;  1Q1K A;  3FV1 A;  3ZKL A;  3K6W A;  4QFN A;  3CFX A;  4GLI A;  1MXW A;  3PPN A;  2RC8 A;  1MDP 1;  4RYA A;  1TT1 A;  5HM4 B;  1NV0 A;  1LBC A;  2WYK A;  2PFZ A;  3MPL A;  5F24 A;  5I56 A;  2XWO A;  1NI9 A;  2DS9 A;  2B4L A;  4X8R A;  2PYY A;  4F2Q A;  1FQB A;  3QK6 A;  4KI0 E;  4XKQ A;  4XEQ A;  2QRY A;  1IMD A;  5I58 A;  3G3G A;  3PD8 A;  1JET A;  3IL1 B;  1IXG A;  2GHB A;  1SDX A;  1LLS A;  3KBR A;  4PGP A;  2OBG A;  1LEV A;  4GOT A;  2RC9 A;  1IMA A;  2E1S A;  4DZ1 A;  3G3I A;  1SVX B;  4POW A;  4RNS A;  3LUY A;  1P1W A;  5CBR A;  3TQL A;  4GL0 A;  1AOV A;  4OFJ A;  1MH4 A;  3CSG A;  2M8C A;  2FVZ A;  3R26 A;  3KOS A;  4RK9 A;  3OO7 A;  1SI0 A;  3H03 A;  3MBP A;  4UA8 A;  3FJ7 A;  1B5H A;  4GXA A;  5ICQ A;  3ILU B;  1KWH A;  3K0V A;  1N7W A;  4ZE9 A;  4GWZ A;  2IEE A;  4LQ5 A;  3SET A;  1UIU A;  1ZBM A;  4OVS A;  1FTL A;  1LAH E;  4JSO A;  3VE1 B;  3KC0 A;  4JWO A;  2YPN A;  3VLV A;  4ZE8 A;  2XXK A;  2OWZ A;  4AS4 A;  1UTH A;  2DWH A;  5I84 A;  4JDF A;  2DYX A;  3TZA A;  3IOR A;  3QIM A;  4P9K A;  1G0I A;  1AL3 A;  1YTV A;  3JZJ A;  4NN3 A;  2DE2 A;  3K00 A;  2QMX A;  4P0I A;  1PB8 A;  5I56 B;  3RY3 A;  2DVZ A;  3TCF A;  5DYH A;  4HCY A;  4KR5 A;  1DK4 A;  4NQ8 A;  5AA4 B;  1DSN A;  4ZED A;  1AMF A;  5L9S A;  1MY3 A;  3O28 A;  1S7Y A;  3BKI B;  4X1B A;  3UIF A;  5I58 B;  1BLF A;  2IA4 A;  1II5 A;  4PDH A;  2WKY A;  3QMF A;  4O3A A;  1R9Q A;  3ONM A;  4EUO A;  3SES A;  5I59 A;  4PBH A;  1D9Q A;  2I4C A;  1H43 A;  3LSL A;  3FZV A;  2ZYK A;  4YAH X;  1NUZ A;  1LB8 A;  4FBP A;  5CMB A;  4HE0 A;  4P3L A;  4DI4 B;  3V83 A;  4GIZ A;  4KCC A;  2Y5K A;  4N81 A;  3W9W A;  4U1Z A;  2F97 A;  1FPJ A;  4NF8 A;  4N15 A;  3IR1 A;  3M3F A;  1FBG A;  5H8S A;  2KLF A;  5IZZ A;  2ANJ A;  3LUZ A;  4F1U A;  1B46 A;  5ICT A;  2PT2 A;  2HQ0 A;  2ESN A;  3PV0 E;  4EQ7 A;  4POX A;  2KR0 A;  3RTW B;  3TQW A;  4PF8 A;  4GX6 A;  3H6W A;  4YB5 A;  1BIY A;  1SYH A;  2R71 A;  1B32 A;  1G0H A;  3EKI A;  3K6V A;  1MXZ A;  1Y4C A;  5DVJ A;  5I2N A;  3IX1 A;  1UTH B;  4O94 A;  2DE3 A;  4OWD A;  1NUW A;  2Q89 A;  3I3V A;  3KN3 A;  3GXA A;  4N91 A;  1YCJ A;  2RCB A;  4NF5 A;  4OVT A;  2PX1 A;  1I69 A;  1LAG E;  4IY5 A;  4I40 A;  3LSX A;  3PPP A;  1MXX A;  1JW4 A;  4JVD A;  4ZEK A;  3PUW E;  1Y1Z A;  1QUK A;  1ZKB A;  4DCX A;  1EZP A;  1FBH A;  1XOC A;  4NF6 A;  1QGX A;  2CZL A;  3FXB A;  3O97 A;  1XT8 A;  4NAP A;  3KZG A;  5I59 B;  3V89 B;  1OVT A;  2RCA A;  3CI8 A;  3O6H A;  3LSW A;  3KG2 A;  1P99 A;  1WVJ A;  1MQI A;  1LCT A;  4GRK A;  3HPI A;  4ECF A;  1ZLQ A;  3VLU A;  4H5G A;  4X9T A;  4YB7 A;  2XX8 A;  4JWX A;  5ET7 A;  1MM6 A;  3EF7 A;  1OLC A;  2XWK A;  3K1M A;  4XF5 A;  3C31 A;  4QFL A;  2B3F A;  5EYH A;  2GRV A;  2I3W A;  4NF8 B;  1AH5 A;  4OHN A;  3RGY A;  2HCA A;  4R74 A;  1AIV A;  2H98 A;  3E79 A;  5EQA A;  4FOR A;  3T66 A;  1FPF A;  4N8Y A;  3TOD A;  3C9H A;  5FBP A;  1GR2 A;  1FPL A;  1ZMG A;  1MQJ A;  2XD2 A;  5I2N B;  4N6K A;  4NGU A;  4WED A;  2ZNT A;  4N8G A;  1SQY A;  5H8F A;  4R2F A;  2Q8J A;  3B7D A;  4G8H A;  1LBY A;  5CM6 A;  1SW1 A;  2V84 A;  3CG1 A;  1L5T A;  2F36 A;  2XXY A;  4NF5 B;  1PEB A;  3TTK A;  1IEJ A;  4U23 A;  2WBD A;  2FHY A;  2I0B A;  4JVI A;  3CFZ A;  2CEY A;  2HAU A;  3C36 A;  4RPO A;  2F3B A;  4R2B A;  3O6G A;  1M5B A;  4H0W A;  2FYI A;  4X1D A;  2XXP A;  4QXD A;  3TEL A;  3W9V A;  5L9O A;  2UVG A;  3EPE A;  3MYU A;  5A5X A;  2PBW A;  1N0T A;  3N5L A;  4NF6 B;  4G8N A;  4GWX A;  4H67 A;  4MCO A;  5IZ3 A;  4ZEF A;  1D9Y A;  1EH3 A;  1VFD A;  3IB1 A;  2A5S A;  4G68 C; 
#chains in the Genus database with same CATH homology
 1EYK A;  2MKZ A;  1KZ8 A;  1LBW A;  5IGA A;  4X04 A;  1FJ9 A;  2GQ1 A;  2QVU A;  2HZK A;  3BIH A;  4AS5 A;  5ET5 A;  4PDD A;  4PAF A;  5T3J A;  1FPD A;  2ZZV A;  4PBQ A;  1XI6 A;  4HE2 A;  4UAB A;  2HPG A;  1FSA A;  2XWI A;  1NV0 A;  4PFB A;  1FBD A;  2WYK A;  2PFZ A;  5F24 A;  4OVR A;  2XWO A;  1DBZ A;  3T0J A;  1NI9 A;  2B4L A;  4MIJ A;  4X8R A;  4HE1 A;  4PAK A;  2WEF A;  2Q8M A;  1FBC A;  4XEQ A;  1IMD A;  1KA0 A;  4OA4 A;  4YIC A;  2WYP A;  5JK4 A;  3RYD A;  2V4C A;  2PCR A;  1NV2 A;  2FBP A;  4PGP A;  5LTC A;  1LEV A;  2WBB A;  4KXP A;  1FPB A;  1IMA A;  2Q9T A;  4I3Y A;  4NHB A;  4PET A;  4P47 A;  1RDZ A;  2B4M A;  3HFU A;  2FVZ A;  3KC1 A;  2HXR A;  1FBF A;  5IZ3 B;  1NUY A;  1SPI A;  1K9Y A;  4GWZ A;  3A29 A;  4MJO A;  1LBV A;  4P56 A;  4OVS A;  4PCD A;  2P3V A;  2XWV A;  3KC0 A;  2XXK A;  1RDY A;  2OWZ A;  4AS4 A;  4MAG A;  4N17 A;  4GWW A;  1K9Z A;  1IMC A;  4OVQ A;  4G61 A;  4P9K A;  1G0I A;  3IFA A;  4N4U A;  5LDZ A;  4O7I A;  4NN3 A;  4YZZ A;  2DE2 A;  4MNC A;  2P3N A;  4I3E A;  3MST A;  1LBZ A;  4MNP A;  5J1D A;  2DVZ A;  4P1L A;  4PFI A;  4HCY A;  5EYG A;  1DK4 A;  4NQ8 A;  2VPN A;  4P1E A;  3SZP A;  4MMP A;  3CHG A;  2WX9 A;  4PAI A;  1YZ0 A;  4PDH A;  2CEX A;  3QMF A;  2PFY A;  4P8B A;  1NV5 A;  1YXI A;  2HZL A;  2F5X A;  1NV7 A;  4PBH A;  4GWS A;  1D9Q A;  4PGN A;  4GX4 A;  2V3Q A;  1NUZ A;  1YYZ A;  4F19 A;  5A5L A;  4FBP A;  2CZI A;  4HE0 A;  4P3L A;  4DI4 B;  3RPL A;  2Y5K A;  1EYJ A;  3LV0 A;  4N81 A;  3W9W A;  1FPJ A;  4N15 A;  1NV1 A;  4M1V A;  1FBG A;  5IZZ A;  2VPO A;  1NV6 A;  3LUZ A;  4GBV A;  4F1U A;  1FTA A;  2VT5 A;  5EQ8 A;  1LBX A;  2KR0 A;  1Q9D A;  1IME A;  1VDW A;  5EQ9 A;  4MEV A;  3IFC A;  4PF8 A;  4GX6 A;  2L5V A;  1FPK A;  1DCU A;  1INP A;  4MHF A;  2ZZX A;  1BK4 A;  1G0H A;  3EKI A;  1NUX A;  5I5P A;  4PE3 A;  2FIX A;  4DI3 D;  3FBP A;  5IZ1 A;  4O94 A;  2DE3 A;  4JVC A;  1NUW A;  2CZK A;  3T1B A;  3GYY A;  2Q74 A;  4N91 A;  3PTY A;  1FBP A;  5ET6 A;  2QPQ A;  4F18 A;  4PC9 A;  4OVT A;  1IMB A;  2JJK A;  4F1V A;  1FPI A;  4I40 A;  4JVD A;  1FPE A;  1AWB A;  2FIE A;  4OAN A;  1FJ6 A;  3NOH A;  1FBH A;  5EQ7 A;  1QGX A;  4QBA A;  3FXB A;  2ZZW A;  4NG7 A;  4NAP A;  5J16 A;  1KA1 A;  4GBW A;  2QVR A;  4MNI A;  4NX1 A;  3U65 A;  5I7I A;  3ISP A;  1CNQ A;  2DDK A;  4LN5 A;  4X9T A;  4H46 A;  3RPL B;  5ET7 A;  4XFE A;  3ROJ A;  2XWK A;  3B8B A;  4XF5 A;  5EYH A;  4PTK A;  4PFR A;  4PF6 A;  3E79 A;  3D1R A;  5EQA A;  1FBE A;  3E78 A;  3BIG A;  1RDX A;  1FPF A;  4N8Y A;  4GX3 A;  4O7M A;  2XA5 A;  1FRP A;  1EYI A;  5FBP A;  2BJI A;  2DE4 A;  1FPL A;  2OX3 A;  2Y5L A;  2R8T A;  1NV3 A;  4N6K A;  4NGU A;  1IMF A;  5ET8 A;  4N8G A;  1LBY A;  2QVV A;  5CM6 A;  2KQZ A;  4GWU A;  4MX6 A;  1NV4 A;  5DW8 A;  3B50 A;  4IR8 A;  4GWY A;  1JP4 A;  3KBZ A;  2WBD A;  2FHY A;  4JVI A;  2CEY A;  2HHM A;  2F3B A;  1FPG A;  4H45 A;  2QFL A;  4NF0 A;  5ESY A;  2F3D A;  4QXD A;  3W9V A;  4HCW A;  3MYU A;  4GWX A;  5I3S A;  4HXV A;  2CZH A;  4MCO A;  5IZ3 A;  4N6D A;  5IM2 A;  4O8M A;  4OVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...