3KC1A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 19a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 97
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc1A02
1YYZA 3BIHA 4KXPA 1IMFA 4GBVA 1FBEA 2BJIA 1FJ6A 2WBDA 1FBGA 4G61A 5EQAA 2P3VA 3RPLB 5FBPA 5DW8A 1VDWA 2Y5LA 5ET5A 4AS4A 1XI6A 4HE2A 1LBZA 1NV6A 1IMBA 5F24A 1KA1A 5A5LA 1NUYA 3FBPA 1SPIA 5EYHA 4GX6A 2F3BA 5J16A 1FPKA 1D9QA 2GQ1A 1Q9DA 1G0HA 2R8TA 4GBWA 1G0IA 1IMEA 5IZ3B 2WBBA 1FTAA 2WEFA 1INPA 1NV4A 4FBPA 3RPLA 2QVRA 3BIGA 2HHMA 1DK4A 1EYKA 1LBYA 4H45A 1K9YA 1BK4A 1RDXA 1EYIA 2FIEA 2DDKA 4AS5A 3KBZA 4GWYA 3B8BA 5LDZA 2FBPA 4GWUA 4HXVA 2CZKA 5ET6A 5EYGA 1LBVA 4I3YA 4H46A 1NV3A 1FBCA 1NUZA 1IMDA 2F3DA 5ET7A 1RDYA 1YZ0A 1FBFA 1FSAA 1FBDA 4GWXA 1FPFA 2QVUA 4I3EA 1QGXA 3RYDA 4HE0A 1IMAA 1FPLA 1FPDA 4I40A 1CNQA 4MJOA 4N81A 1FRPA 1KZ8A 1YXIA 1NV1A 1RDZA 5I3SA 1LBXA 2FHYA 2VT5A 4GX4A 3ROJA 2FVZA 3KC0A 1FPJA 1NV7A 1NV5A 4QXDA 3IFCA 1NV2A 1K9ZA 2QFLA 1FJ9A 4GWZA 5EQ8A 1LBWA 2Q8MA 1IMCA 1FPBA 1NV0A 1JP4A 1DCUA 5ESYA 4HE1A 5IZ3A 5EQ9A 3D1RA 2Q74A 5ET8A 1FBHA 4O7IA 3KC1A 3LV0A 1NUWA 3QMFA 2OWZA 2OX3A 3IFAA 3A29A 2FIXA 1NI9A 1FPGA 2P3NA 4GWWA 2PCRA 3LUZA 1NUXA 4GX3A 2Y5KA 1EYJA 1FPEA 2CZHA 5EQ7A 2QVVA 1FBPA 1FPIA 4IR8A 1AWBA 4GWSA 1DBZA 1LEVA 1KA0A 3T0JA 5T3JA 2JJKA 4PTKA 2CZIA 5IZ1A
chains in the Genus database with same CATH superfamily
1MH3A 1NNKA 1FJ6A 2I3VA 1IQ7A 4XKPA 4XKRA 2Y5LA 2UYFA 2B3BA 3OELA 3CFZA 2QS4A 1CE2A 3PTYA 3ZKKA 2CEXA 2QVRA 1JW1A 1DK4A 2XA5A 1EYKA 5I2NB 1VFEA 3KOSA 4JB7A 1URSA 4GOTA 4GWYA 1XS5A 2ONKE 3PUWE 1DOTA 4NF4A 4FAJA 2WYPA 4X9TA 3FXRA 2I49A 5H8QB 4PP0A 2GFEA 2WX9A 4C1UA 2D5WA 3TAJA 1UTHA 2XHDA 1Y3NA 4YKKA 3CIJA 3JZJA 4NWCA 1MG1A 1B58A 4PFBA 2FHYA 2P1SA 4DZ1A 1Z7ME 2HEUA 4EXLA 2UYEA 2ZYOA 1NV0A 1QKAA 1JP4A 4FEDA 5IZ3A 2Y84A 4EQ9A 4LONB 1LFGA 2H5YA 1EZPA 4AB5A 2OWZA 3W9WA 1AH5A 4ONYA 1P1NA 4OERA 1TFAA 4OETA 1FPGA 3EQ1A 3O97A 1P1WA 1WDNA 4FORA 1YPNA 4OHNA 4G2ZA 2QVVA 5H8FA 5IZ1A 4KXPA 3KOTA 3PPOA 2Y7WA 1I6AA 1SQYA 2I4BA 4QFLA 4O8MA 4QBAA 5H8QA 4IY6A 4G68B 4JSDA 4C1TA 1VE4A 4TQUQ 5A5LA 4DXUA 1NUYA 2XXTA 3OEKA 4DLDA 1D9QA 4NAPA 4KI0E 2PT1A 3KJ7A 1PDAA 3QXMA 4RK9A 1OLAA 1LSTA 3SZPA 5I56A 1FQBA 1OQGA 1M5CA 2OZZA 4H67A 2CZKA 1LBVA 1PB8A 4ZEKA 3DLNA 2F35A 4OFOA 1D9YA 1OVTA 4U22A 4P0GA 3U93A 1SVXB 5KDTA 3Q25A 3GBAA 3TTKA 2X26A 3UA8A 4MJOA 4PFTA 3HCQA 3K1PA 4XIGQ 2ANJA 1RDZA 5I3SA 2F6PA 4QFPA 3FXUA 2I48A 4JWYA 3FJGA 1IEJA 1IXHA 4POWA 3U65A 3KEIA 3SDFA 4YB6A 3T9XB 1A54A 4PF6A 2XXQA 1N3WA 4NF8B 3G3GA 5TPAA 3O28A 1JVXA 3IFAA 2XX9A 4H8JA 3SEWA 3MP6A 3UK4A 2I0BA 3GXAA 3QSLA 3Q29A 1FTOA 3N94A 4GWSA 2Z23A 4R2FA 3E3KA 4H0WA 1HSJA 3C4MA 5I2NA 4DXBA 4FATA 5I57A 3IB0A 5F7VA 2I4CA 2XXPA 3FVNA 4RY1A 5EYHA 4FJPA 1ELJA 2OBGA 1AIVA 4YB5A 3H06B 1EH3A 1BIYA 4N91A 3MQ9A 1USYE 2HCAA 4GQOA 3K6UA 4AB6A 4X1DA 1QKBA 4ECFA 5AA2D 3BBRA 3FVKA 3LR1A 1A7LA 1N7XA 1MY2A 5EYGA 4R6HA 3FXQA 1FQCA 3GZGA 1IMDA 3T9HB 3EHUA 2OPEA 3R26A 3OMBA 1QGXA 3T93B 4IO6A 3G3FA 5H8SA 1ZTYA 3H4ZA 1Y4CA 3M3LA 2ZZWA 4N81A 4RNSA 4GVOA 2VGQA 1MQDA 5I7IA 3VXBA 4M4GA 4C0RA 3MVYA 3ROJA 2IA4A 1NV7A 1K9ZA 4GL8A 4OMBA 4LZ5A 1MDP1 2HZKA 1BTJA 1DPPA 4R9FA 3FVGA 4ELRA 2I3WA 4ZE9A 1YCJA 4OFLA 1P1QA 3H7MA 3V8XB 4F18A 4OZ9A 3TELA 4H65A 5HBCA 5AA1A 1B7ZA 1JW4A 4DCYA 1QULA 3AXFA 3VVDA 2L5VA 5TP9A 4PTKA 2GH9A 3T1BA 2CZIA 3TCGA 4QHQA 1FBEA 1MQGA 2BJIA 1D4NA 2AYSA 3C33A 1EZ9A 4IB2A 3LC8A 1LBZA 1QUKA 3K6VA 1NH8A 4MX6A 3PPQA 5LTCA 1YTVA 4P8BA 2QS1A 4OESA 2WBBA 3D4CA 3W15C 3TUSA 3KBRA 2OJTA 2PFYA 3U8QA 1B7UA 5IKBA 3MVZA 3OOAA 2F7AA 1B3FA 3FD3A 2XXRA 2HFBA 3K00A 1USYH 1FBFA 3PMWA 4NTLA 3E78A 3R6UA 5CM6A 1OIBA 2DWHA 1A99A 2B4MA 3G3IA 2XWKA 1FQAA 1FRPA 1YXIA 5KZTA 3Q27A 3IK6B 1NV5A 5ICQA 2QFLA 3KGCA 4F29A 4NF6A 3LUYA 3MJNA 4N17A 4ZEFA 4TOZA 2KLFA 2DVZA 3ZSFA 1EYJA 2PMSA 4JWXA 4L17A 1LFIA 4GXSB 2O7UA 3IJOB 3DP6A 4NHBA 4YB7A 4WEPA 1SW5A 1H3DA 4XFEA 2ESNA 2Q8JA 5I59B 5DVJA 2FYIA 3TQLA 5A5XB 3TDJA 1S7YA 3FZVA 3TTMA 5J16A 1FPKA 5DT6A 2R8TA 1LCTA 2CMOA 4GBWA 1G0IA 1UIVA 1LLSA 5FHOA 4XXUA 3RPLA 4ZZEA 3SEYA 4HCWA 4GRKA 3N6TA 1Y1MA 1LBYA 5EHSA 1BK4A 1RDXA 4PBHA 2XXUA 4MNCA 4N8YA 3IL1B 4H1XA 2WYKA 4R9GA 3WAFA 4MCOA 3H03A 4YMBA 4MFIA 4G8NA 4MEVA 3TTLA 1RDYA 3C32A 3BFUA 4ZEBA 4I3EA 4WXJA 1LAXA 2E1SA 4I40A 3S9EA 4THIA 1NNPA 3MBPA 5AA4A 1LBXA 4GF8A 3CHGA 3KJTA 4YMAA 1ZU0A 1FPBA 3SEVA 1XVYA 2OCUA 1IXGA 4JBZA 2Z8DA 2OWSA 3IO4A 1IIWA 5H8HB 3QMFA 3VLWA 2FIXA 4NF0A 1MXWA 2QRYA 5ICTA 2RC8A 4GX3A 4PE3A 3VLVA 4P9KA 5IGAA 1R6ZA 1DBZA 3MC2A 3V89B 3OO9A 1YYZA 4FIMA 3EHTA 2F7BA 4E0XA 2W7YA 3TCHA 1B3EA 4P0IA 1R9LA 1NNFA 4X1BA 2B3FA 3OO8A 3KFMA 3MVWA 3HO7A 1JW5A 2F5XA 2XXVA 2HHMA 4KPTA 4NN3A 1MPBA 2XXYA 1DPEA 2ZZVA 2ZYMA 3PD8A 4R72A 4MNIA 3TEPA 4KD5A 4KHZE 3PPPA 1P1OA 3PUVE 4I3YA 4PE5B 1YZ0A 4GWXA 3HFUA 5I5PA 4X48A 3T9UA 1B6HA 1LAFE 5H8HA 1B3LA 2B65A 3KN8A 3UN6A 1KZ8A 4U2RA 4OVTA 4GX4A 3HHGA 1B3HA 4RJZA 4U21A 3JYRA 2NXOA 4QXDA 3GLBA 1NV2A 3MZ1A 4GIZA 1S9TA 4N07A 4JWOA 1Y20A 3LSFB 4F3GA 2F34A 3MVXA 4WKMA 3M3KA 4O7IA 4KYSA 1H76A 4QRZA 2DQVA 1VFDA 2QJEA 3IOTA 2QL3A 1N3XA 4XF5A 1BKAA 3QUFA 4GXAA 5DYHA 4OENA 4ND9A 5T3JA 2JJKA 4MMPA 4NGUA 4GWOA 4PAKA 4PGPA 4I1DA 1H44A 3M3FA 4K3FA 1L5TA 1NNTA 5CI5A 5B7DA 3FBPA 5HPQA 3IR1A 3RT6B 4PAIA 1Q9DA 1O63A 2DE2A 3HV1A 4OXVA 4FE8A 3I6VA 1O64A 1NL5A 4Z0IA 4LZ7A 3KBZA 5I57B 3B8BA 1MXVA 1B7HA 4QSEA 3TCFA 4BDRA 2FA7A 4R6KA 4ZDMA 4R6YA 5JTYB 3RYDA 3B50A 3M8UA 3Q26A 4JSOA 4POXA 4QSDA 1P1UA 3PV0E 3ONMA 3EHSA 2XWIA 1B9JA 4DXCA 2R9JA 2XXKA 4XKNA 1ZLQA 2DXRA 4JVCA 5EQ8A 4GLIA 1LBWA 2QSXA 3UORA 5H8FB 1MM7A 2VHAA 2XWOA 3EF7A 1B1HA 1T0KA 2I0CA 4F3BA 3E13X 1NH7A 1Q35A 4JXIA 4LQ2A 3MYUA 2A5TB 3OSQA 3T96B 1UTBA 2O69A 2YLNA 5A5XA 1AWBA 4DI4B 4U1OA 3HN0A 1RKMA 4F31B 1Q1KA 2V3UA 3PU5A 2XD2A 4WEDA 1POY1 2P3VA 1FQEA 1WODA 1Y3PA 1XI6A 1IMBA 2CZLA 1KA1A 3EPEA 5M2VA 4ESWA 4PFWA 3WAEA 5DVIA 4KQPA 1FQDA 2PT2A 2RCAA 4P3LA 2QMWA 1TXFA 2DE4A 1UQWA 3CG3A 4HS7A 2O68A 3CVGA 4O7MA 1EYIA 4G68A 1XVXA 2O1LA 2ALUA 1I6BA 5I58A 1URGA 3S9NC 3OENA 2KR0A 3RQTA 4R75A 2AL5A 1XT8A 4ELPA 4KCDA 4YICA 1P99A 5HM4B 1JEUA 1URDA 3FATA 2ZYNA 2HAVA 3O2AA 1B1XA 4BDLA 5CMBA 4F3SA 1FTJA 3FJMA 1I69A 3H6WA 3MUQA 3HPIA 2BJJX 4GWZA 1YAEA 2R71A 3BFTA 3K6XA 2ZNSA 3MW0A 5ET8A 3KC1A 1NUWA 3IB1A 1M5FA 3I5OA 3C35A 1NI9A 3V83A 2RC7A 4MF3A 1FTLA 3K01A 3H3GA 4N6DA 1SI0A 1DMBA 5H8NB 2NUVA 3N6UA 4YU0A 3OEMA 2H9BA 3BIHA 2HQ0A 3LSLA 3IJXB 3IAZA 4Z7EA 2Z22A 4MBPA 3E9XA 3S9LC 4AS4A 2DWIA 5CMKA 4IO5A 4ISUA 2F8DA 2YPNA 4NE4A 3RPWA 5CBSA 4ELOA 4G4PA 4LP2B 1IMEA 1FTAA 3ISPA 2MKZA 1MH4A 3OSRA 1RYOA 4NMYA 3B7DA 4GWUA 1ANFA 5TU0A 1LBCA 2ZXTA 2Q2AA 2PVUA 5I2KA 4DI3D 1NFTA 1FSAA 1J1NA 2Q9TA 3VVFA 2E0SA 5IAIA 3K1NA 4PDDA 2GRVA 1MY3A 4F39A 3CI8A 1MS7A 3FV1A 3CFXA 3TYHA 4O94A 2Q8MA 2HXRA 3MAMA 3TFLA 4ESXA 4PDHA 5FHMA 1JNFA 4LA9A 3VDFA 4PGNA 1PBQA 1SW2A 3MZBA 4GWWA 2O51A 3FASA 4PFUA 5DVFA 3G3JA 1FBPA 4IR8A 1LAHE 4JVDA 3FUZA 3K2DA 3N5LA 2LAOA 5L8DA 1DTGA 3CFLA 1IXIA 1TWYA 3OO7A 4G61A 3SEXA 1MPDA 5AA4B 1A8FA 4O3BA 4IGRA 4YAHX 4QFOA 3FXBA 1B5IA 4RA1A 3RGYA 5LOMA 2H4IA 3PUYE 5CBRA 2DVCA 2G93A 2P2AA 3VE1B 2HXWA 4P1LA 3RY3A 3DP8A 4IY5A 2ZYKA 1MXZA 2CEYA 3K02A 4HW8A 5K2YA 1B05A 5I84A 4NEDA 3LBSA 2QS2A 3IOUA 1NUZA 4G8MA 3K4UA 3UP9A 3UGWA 5F1QA 3OXNA 1MQIA 3VXCA 4DIGA 1MPCA 1US4A 4I9DA 4PFYA 2FVZA 5CC2A 2PFZA 3CR9A 4N8GA 4F22A 1GV8A 5JTYA 1H45A 1DCUA 4HE1A 1SI1A 1PEBA 3CSGA 3MPLA 2RKMA 3RT8A 4BLAA 2OX3A 3E4RA 4N13A 3ZS6A 2FNCA 1FTMA 2P3NA 2PCRA 5I59A 2F7CA 2UXAA 4LATA 1JQFA 1UIUA 2Q89A 2ONSA 2Y7KA 4P1EA 1AOVA 4ZZAA 4LVQA 1SYHA 5AE4A 4KYEA 1JEVA 2F36A 1VDWA 3IORA 2F6GA 4H6DA 1B40A 2O1MA 1SPIA 4Q8RA 1BP5A 3MZ9A 3QIMA 4PBQA 2GHBA 2THIA 4RXLA 1LB8A 2WEFA 3GBBA 4PFRA 4BDQA 1SBPA 3DM0A 4MH5A 3TODA 4AS5A 4N15A 2ZNTA 1GGGA 1N7WA 2ZZXA 4R74A 1B52A 5KCJB 5KCJA 2Z8EA 3HSTA 1NV3A 1MY0A 1PC3A 2YJPA 5EHMA 4PAFA 4EXKA 1JETA 5DEXB 1PBPA 1B4ZA 1CB6A 3SESA 4PF8A 1B2HA 5L9MA 3SETA 3C34A 5CMCA 4P47A 1D3KA 3P7IA 1A8EA 4EDPA 4JDFA 3KC0A 1VR5A 3PPNA 4XTCQ 3QUJA 1B5JA 5ESYA 3D1RA 1Y4TA 1Z7NE 2ONRA 4IO7A 4DDDA 4RK2A 1MXXA 2V93A 5L9SA 1FQFA 4MLVA 3OO6A 4KCCA 2QS3A 4N6KA 4QFNA 1FPEA 1XHYA 1B0HA 1B51A 4PETA 2ABHA 4F3PA 3VVEA 1PB9A 1LEVA 3K0VA 4P56A 3LSWA 3RTFB 3VV5A 4Q5TA 4IO4A 4MAGA 1MDQA 4ZS9A 3C31A 5EQAA 4U23A 3E79A 2KQZA 5FBPA 3QK6A 1US5A 4OVRA 5ITPA 2F3BA 5DTBA 3ZKLA 5FTHA 1G0HA 1MXUA 2REGA 4ZE8A 1N84A 5K2XA 3USDA 4LN5A 4YKIA 2XXHA 2H98A 4NG7A 4F2QA 5AA3A 4EQBA 1K9YA 2DOJA 1M5BA 2HZLA 1IITA 1MQHA 2UVHA 2FBPA 5IM2A 1SW4A 1MY1A 3CSBA 3KSXA 2F3DA 4OVSA 3A09A 4HTGA 3N26A 3UIFA 2VD2A 1FBDA 3EKIA 5JEIA 4HE0A 2VPOA 2Q2CA 3DELB 3PUXE 1TT1A 1FPLA 2DXYA 3PUZE 2OK2A 2UVGA 4Q30B 3D4GA 1IXCA 4EF2A 3G3HA 2RINA 5AA2B 5JK4A 3MP1A 3IFCA 3RUMA 4OVJA 1A40A 5EQ9A 5BUUA 4EF1A 2Q74A 3PPRA 3Q28A 5EYFA 3A29A 3IO6A 3C36A 4NF6B 3LUZA 2DWAA 2AL4A 1KWHA 4PC9A 1A55A 1QW0A 4R2BA 4MHFA 3L6HA 3T22A 1WVJA 4NF8A 4F1YA 2WKYA 1MM6A 3B6TA 3SERA 1GR2A 3MP8A 4RPNA 1FBGA 3TPAA 2XX7A 5F24A 3TZAA 1EU8A 1IUDA 1SD3A 4HCYA 4UA8A 4GX6A 2RCBA 2A5TA 3ILUB 5KDTB 2X7QA 5ELVA 5IZ3B 5FHNA 1INPA 4FBPA 5BWJA 1ZIUA 2FIEA 3FGSA 3G7WA 1RYXA 2DS9A 1R9QA 1AL3A 3ODBA 2F78A 1GTKA 1FBCA 2OPDA 1ZMGA 4H8IA 2UVIA 4OEUA 1DTZA 2QVUA 3H6VA 2D21A 1ZBMA 1DSNA 1CNQA 4JVIA 4YKJA 4N4UA 2D3IA 3S9MC 3O29A 2VP1A 2XXWA 1F9BA 2F97A 2VT5A 2OWTA 3PGFA 5I56B 4G8HA 1POTA 1OQHA 4AQ4A 4YZZA 1QUJA 3RTWB 3NOHA 3TKDA 1ATGA 3MSTA 4NF4B 4XKQA 5FTIA 3O9PA 1UTBB 3IOWA 5DEXA 5AA2A 3TQWA 3B6QA 1KA0A 4OANA 4DE8A 3GYYA 1II5A 3PD9A 1SYIA 5CRYA 5J1DA 4U1ZA 4DCXA 3V5AA 4KFQA 1I6QA 5ET5A 1OLCA 3T9VA 1LBBA 2H25A 1HSLA 1QVSA 1LFHA 3I3VA 1QJMA 5TP9B 3IB2A 2Y7IA 3TTNA 1AMFA 4IO2A 1NV4A 3BIGA 4OEVA 3MWBA 4PFIA 2VOZA 2DDKA 2X7PA 3KSJA 4NX1A 3T66A 3LSXA 1PB7A 4IGTA 2OLBA 2Z8FA 4KYDA 4H46A 3O6IA 4RPOA 4R73A 3A3UA 5ET7A 3PMXA 2B4LA 4NF5A 3TMGA 3KN3A 3K6WA 1FPFA 3G3KA 1ZJLA 2A5SA 1HSEA 5ITOA 3RLFE 1B5HA 3FIRA 3CRBA 3KZGA 5I58B 4OQOA 3S2VA 4NF5B 2VPNA 2V3TA 4P11A 1FPJA 1NMUA 3H6UA 1B3GA 1N0TA 4OWDA 1OMPA 2IEEA 3S4UA 2PX1A 1B46A 4OFJA 2XD3A 3RNNA 1FBHA 4PCDA 4U4XA 3DP4A 3MPKA 2R6GE 4OA4A 4I62A 1M5EA 1FTKA 3A3CA 1IZ1A 4Q0CA 1FPIA 1LAGE 2QPQA 4E0WA 4GD5A 4GFRA 1LCFA 3W9VA 1IMFA 1O7TA 1B32A 3EN3A 2WBDA 3RPLB 1JVYA 3OD7A 3BKIB 5DW8A 5CMMA 4IO3A 1FCKA 1NV6A 3FVOA 3U1OA 1ZKBA 2GHAA 1LGBC 4UABA 4KR5A 1N04A 1SW1A 4O3AA 1XC1A 3FV2A 2NWJA 4H45A 4H5FA 3VLUA 4F2OA 2REJA 5LDZA 4OYVA 5ISUA 4FECA 4BDOA 1MXYA 4I8CA 5ET6A 2I6EA 4EQ7A 4X04A 3SEUA 2VD3A 3PMVA 4RYAA 2QMXA 5IZZA 4X8RA 2RC9A 1IMAA 3K1MA 4ZEIA 4F19A 1FPDA 2V4CA 4YKPA 1EZOA 2PBWA 2V84A 2O7IA 2UVJA 1MQJA 2XXIA 4BDMA 2Q88A 1GVCA 4GL0A 1XOCA 1FJ9A 2H99A 1M5DA 2PYYA 3KG2A 3LV0A 5TPAB 3IOVA 2DE3A 2NVUB 1NUXA 2Y5KA 1Y9UA 2M8CA 2XXXA 3VFJA 2CZHA 2I58A 1VSOA 3C9HA 1TFDA 3RN8A 2DP8A 4QFKA 5I2KB 1LB9A 1Y1ZA 4GBVA 3H6TA 2V25A 4G68C 2XX8A 3THIA 3JV9A 2DYXA 4HE2A 2O6AA 3L6GA 4OTEA 1S50A 1OVBA 3O66A 2GQ1A 2DSFA 1R1NA 3U94A 3SKPA 4EUOA 2V3QA 4LUBA 4G77A 3IX1A 2Y7PA 3O6HA 4NQ8A 1N76A 4QF9A 4NWDA 2XWVA 4TLLB 4TLMB 5L9OA 1BLFA 4OVPA 4HXVA 3ILTB 2O84X 1H43A 4F1VA 1MY4A 1B0LA 1NKXA 4MNPA 2HAUA 3B6WA 3QAXA 1QUIA 3R7XA 2HPGA 3O6GA 2P0SA 1MRPA 3U92A 1FW0A 4MLQA 1B4HA 4FEBA 4MIJA 4ZECA 2AIXA 4M1VA 2DWJA 4XEQA 4UACA 1NV1A 3TTRA 3ECRA 4F1UA 2RF1A 1SDXA 4PQJA 4BDNA 2NOOA 5H8NA 4LZ8A 1IMCA 3QYTA 4U4SA 3CG1A 3FJ7A 4N6PA 3U72A 3F11A 1D9VA 1Y3QA 4O3CA 4OVQA 5B70A 4ELQA 3HHFA 2ZMBA 4LQ5A 5EQ7A 2Y7RA 4ZEDA 3T0JA 2G29A 4H5GA 4QSCA 2ZNUA 3KN7A 1UTHB
chains in the Genus database with same CATH topology
3W9VA 1YYZA 4MAGA 3BIHA 4KXPA 1IMFA 4GBVA 1FBEA 5J1DA 2BJIA 4XFEA 1FJ6A 2WBDA 4NGUA 1FBGA 4P1LA 4PAKA 4PGPA 4G61A 5EQAA 2P3VA 3RPLB 3E79A 2KQZA 5FBPA 4O8MA 5DW8A 4QBAA 1VDWA 2Y5LA 5ET5A 4AS4A 1XI6A 4HE2A 1LBZA 1NV6A 1IMBA 5F24A 1KA1A 4OVRA 5A5LA 1NUYA 3FBPA 1SPIA 4HCYA 5EYHA 4GX6A 3FXBA 2F3BA 4MX6A 4PFRA 5J16A 1FPKA 5LTCA 1D9QA 2GQ1A 4P3LA 4PAIA 4NAPA 1Q9DA 1G0HA 4UABA 2R8TA 4GBWA 4PBQA 1G0IA 4P8BA 1IMEA 2DE4A 5IZ3B 3PTYA 2WBBA 1FTAA 2DE2A 2WEFA 2F5XA 4N91A 2CEXA 1INPA 1NV4A 4FBPA 3RPLA 3ISPA 2QVRA 4LN5A 3BIGA 2V3QA 2HHMA 2MKZA 2XA5A 1DK4A 4HCWA 4NG7A 2PFYA 4PFIA 3SZPA 1EYKA 4NQ8A 1LBYA 4H45A 1K9YA 1BK4A 1RDXA 1EYIA 2CEYA 2FIEA 4NN3A 2XWVA 4MNCA 4PBHA 2DDKA 4AS5A 2HZLA 4N8YA 3KBZA 4N15A 2ZZVA 4GWYA 4NX1A 2WYKA 3B8BA 4MNIA 4OVPA 5LDZA 2ZZXA 2FBPA 5IM2A 4GWUA 4HXVA 2CZKA 5ET6A 4MCOA 5EYGA 1LBVA 4I3YA 4H46A 4X04A 1NV3A 1FBCA 1NUZA 1IMDA 2F3DA 4MEVA 5ET7A 4OVSA 4DI3D 1RDYA 2B4LA 4MNPA 1YZ0A 1FBFA 2KR0A 2WYPA 1FSAA 1FBDA 4GWXA 1FPFA 2QVUA 3HFUA 4X9TA 3E78A 3EKIA 4I3EA 4PAFA 1QGXA 3RYDA 4HE0A 5I5PA 3B50A 5IZZA 2VPOA 2Q9TA 4X8RA 2HPGA 1IMAA 1FPLA 5CM6A 4YICA 4F19A 1FPDA 4I40A 2V4CA 2WX9A 4PF8A 2B4MA 2ZZWA 1CNQA 4JVIA 4MIJA 4N4UA 2XWKA 4PDDA 4MJOA 4N81A 4M1VA 4XEQA 1FRPA 4P47A 1KZ8A 1YXIA 1NV1A 1RDZA 5I3SA 5I7IA 4OVTA 1LBXA 4PFBA 2FHYA 2VT5A 4GX4A 2VPNA 3ROJA 2FVZA 2XWIA 4F1UA 3CHGA 2PFZA 3KC0A 1FPJA 4N8GA 5JK4A 1NV7A 2XXKA 1NV5A 4QXDA 3IFCA 3U65A 1NV2A 1K9ZA 2QFLA 1FJ9A 4GWZA 5EQ8A 4JVCA 4O94A 1LBWA 2Q8MA 1IMCA 2HXRA 1FPBA 1NV0A 4PF6A 1JP4A 4YZZA 1DCUA 5ESYA 4HE1A 4O7MA 5IZ3A 4PDHA 5EQ9A 2HZKA 2XWOA 3NOHA 3D1RA 2Q74A 5ET8A 1FBHA 4O7IA 3KC1A 3LV0A 4PCDA 1NUWA 3QMFA 4N17A 2OWZA 3MSTA 2OX3A 3IFAA 3W9WA 3A29A 2FIXA 4F18A 4PGNA 4XF5A 1NI9A 1FPGA 2DVZA 3MYUA 2P3NA 4GWWA 4NF0A 2DE3A 4N6KA 2PCRA 3LUZA 4OA4A 4PE3A 1NUXA 4GX3A 4OVQA 2Y5KA 1EYJA 1FPEA 4PC9A 2CZHA 4P9KA 5IGAA 4MHFA 5EQ7A 4PETA 2QVVA 1FBPA 1FPIA 4IR8A 4N6DA 1AWBA 4GWSA 1DBZA 4JVDA 1LEVA 4DI4B 1KA0A 4OANA 4P1EA 4P56A 4NHBA 3T0JA 2QPQA 5T3JA 2JJKA 2L5VA 4MMPA 3GYYA 4PTKA 4F1VA 3T1BA 2CZIA 5IZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYZ A;  3BIH A;  4KXP A;  1IMF A;  4GBV A;  1FBE A;  2BJI A;  1FJ6 A;  2WBD A;  1FBG A;  4G61 A;  5EQA A;  2P3V A;  3RPL B;  5FBP A;  5DW8 A;  1VDW A;  2Y5L A;  5ET5 A;  4AS4 A;  1XI6 A;  4HE2 A;  1LBZ A;  1NV6 A;  1IMB A;  5F24 A;  1KA1 A;  5A5L A;  1NUY A;  3FBP A;  1SPI A;  5EYH A;  4GX6 A;  2F3B A;  5J16 A;  1FPK A;  1D9Q A;  2GQ1 A;  1Q9D A;  1G0H A;  2R8T A;  4GBW A;  1G0I A;  1IME A;  5IZ3 B;  2WBB A;  1FTA A;  2WEF A;  1INP A;  1NV4 A;  4FBP A;  3RPL A;  2QVR A;  3BIG A;  2HHM A;  1DK4 A;  1EYK A;  1LBY A;  4H45 A;  1K9Y A;  1BK4 A;  1RDX A;  1EYI A;  2FIE A;  2DDK A;  4AS5 A;  3KBZ A;  4GWY A;  3B8B A;  5LDZ A;  2FBP A;  4GWU A;  4HXV A;  2CZK A;  5ET6 A;  5EYG A;  1LBV A;  4I3Y A;  4H46 A;  1NV3 A;  1FBC A;  1NUZ A;  1IMD A;  2F3D A;  5ET7 A;  1RDY A;  1YZ0 A;  1FBF A;  1FSA A;  1FBD A;  4GWX A;  1FPF A;  2QVU A;  4I3E A;  1QGX A;  3RYD A;  4HE0 A;  1IMA A;  1FPL A;  1FPD A;  4I40 A;  1CNQ A;  4MJO A;  4N81 A;  1FRP A;  1KZ8 A;  1YXI A;  1NV1 A;  1RDZ A;  5I3S A;  1LBX A;  2FHY A;  2VT5 A;  4GX4 A;  3ROJ A;  2FVZ A;  3KC0 A;  1FPJ A;  1NV7 A;  1NV5 A;  4QXD A;  3IFC A;  1NV2 A;  1K9Z A;  2QFL A;  1FJ9 A;  4GWZ A;  5EQ8 A;  1LBW A;  2Q8M A;  1IMC A;  1FPB A;  1NV0 A;  1JP4 A;  1DCU A;  5ESY A;  4HE1 A;  5IZ3 A;  5EQ9 A;  3D1R A;  2Q74 A;  5ET8 A;  1FBH A;  4O7I A;  3KC1 A;  3LV0 A;  1NUW A;  3QMF A;  2OWZ A;  2OX3 A;  3IFA A;  3A29 A;  2FIX A;  1NI9 A;  1FPG A;  2P3N A;  4GWW A;  2PCR A;  3LUZ A;  1NUX A;  4GX3 A;  2Y5K A;  1EYJ A;  1FPE A;  2CZH A;  5EQ7 A;  2QVV A;  1FBP A;  1FPI A;  4IR8 A;  1AWB A;  4GWS A;  1DBZ A;  1LEV A;  1KA0 A;  3T0J A;  5T3J A;  2JJK A;  4PTK A;  2CZI A;  5IZ1 A; 
#chains in the Genus database with same CATH topology
 1MH3 A;  1NNK A;  1FJ6 A;  2I3V A;  1IQ7 A;  4XKP A;  4XKR A;  2Y5L A;  2UYF A;  2B3B A;  3OEL A;  3CFZ A;  2QS4 A;  1CE2 A;  3PTY A;  3ZKK A;  2CEX A;  2QVR A;  1JW1 A;  1DK4 A;  2XA5 A;  1EYK A;  5I2N B;  1VFE A;  3KOS A;  4JB7 A;  1URS A;  4GOT A;  4GWY A;  1XS5 A;  2ONK E;  3PUW E;  1DOT A;  4NF4 A;  4FAJ A;  2WYP A;  4X9T A;  3FXR A;  2I49 A;  5H8Q B;  4PP0 A;  2GFE A;  2WX9 A;  4C1U A;  2D5W A;  3TAJ A;  1UTH A;  2XHD A;  1Y3N A;  4YKK A;  3CIJ A;  3JZJ A;  4NWC A;  1MG1 A;  1B58 A;  4PFB A;  2FHY A;  2P1S A;  4DZ1 A;  1Z7M E;  2HEU A;  4EXL A;  2UYE A;  2ZYO A;  1NV0 A;  1QKA A;  1JP4 A;  4FED A;  5IZ3 A;  2Y84 A;  4EQ9 A;  4LON B;  1LFG A;  2H5Y A;  1EZP A;  4AB5 A;  2OWZ A;  3W9W A;  1AH5 A;  4ONY A;  1P1N A;  4OER A;  1TFA A;  4OET A;  1FPG A;  3EQ1 A;  3O97 A;  1P1W A;  1WDN A;  4FOR A;  1YPN A;  4OHN A;  4G2Z A;  2QVV A;  5H8F A;  5IZ1 A;  4KXP A;  3KOT A;  3PPO A;  2Y7W A;  1I6A A;  1SQY A;  2I4B A;  4QFL A;  4O8M A;  4QBA A;  5H8Q A;  4IY6 A;  4G68 B;  4JSD A;  4C1T A;  1VE4 A;  4TQU Q;  5A5L A;  4DXU A;  1NUY A;  2XXT A;  3OEK A;  4DLD A;  1D9Q A;  4NAP A;  4KI0 E;  2PT1 A;  3KJ7 A;  1PDA A;  3QXM A;  4RK9 A;  1OLA A;  1LST A;  3SZP A;  5I56 A;  1FQB A;  1OQG A;  1M5C A;  2OZZ A;  4H67 A;  2CZK A;  1LBV A;  1PB8 A;  4ZEK A;  3DLN A;  2F35 A;  4OFO A;  1D9Y A;  1OVT A;  4U22 A;  4P0G A;  3U93 A;  1SVX B;  5KDT A;  3Q25 A;  3GBA A;  3TTK A;  2X26 A;  3UA8 A;  4MJO A;  4PFT A;  3HCQ A;  3K1P A;  4XIG Q;  2ANJ A;  1RDZ A;  5I3S A;  2F6P A;  4QFP A;  3FXU A;  2I48 A;  4JWY A;  3FJG A;  1IEJ A;  1IXH A;  4POW A;  3U65 A;  3KEI A;  3SDF A;  4YB6 A;  3T9X B;  1A54 A;  4PF6 A;  2XXQ A;  1N3W A;  4NF8 B;  3G3G A;  5TPA A;  3O28 A;  1JVX A;  3IFA A;  2XX9 A;  4H8J A;  3SEW A;  3MP6 A;  3UK4 A;  2I0B A;  3GXA A;  3QSL A;  3Q29 A;  1FTO A;  3N94 A;  4GWS A;  2Z23 A;  4R2F A;  3E3K A;  4H0W A;  1HSJ A;  3C4M A;  5I2N A;  4DXB A;  4FAT A;  5I57 A;  3IB0 A;  5F7V A;  2I4C A;  2XXP A;  3FVN A;  4RY1 A;  5EYH A;  4FJP A;  1ELJ A;  2OBG A;  1AIV A;  4YB5 A;  3H06 B;  1EH3 A;  1BIY A;  4N91 A;  3MQ9 A;  1USY E;  2HCA A;  4GQO A;  3K6U A;  4AB6 A;  4X1D A;  1QKB A;  4ECF A;  5AA2 D;  3BBR A;  3FVK A;  3LR1 A;  1A7L A;  1N7X A;  1MY2 A;  5EYG A;  4R6H A;  3FXQ A;  1FQC A;  3GZG A;  1IMD A;  3T9H B;  3EHU A;  2OPE A;  3R26 A;  3OMB A;  1QGX A;  3T93 B;  4IO6 A;  3G3F A;  5H8S A;  1ZTY A;  3H4Z A;  1Y4C A;  3M3L A;  2ZZW A;  4N81 A;  4RNS A;  4GVO A;  2VGQ A;  1MQD A;  5I7I A;  3VXB A;  4M4G A;  4C0R A;  3MVY A;  3ROJ A;  2IA4 A;  1NV7 A;  1K9Z A;  4GL8 A;  4OMB A;  4LZ5 A;  1MDP 1;  2HZK A;  1BTJ A;  1DPP A;  4R9F A;  3FVG A;  4ELR A;  2I3W A;  4ZE9 A;  1YCJ A;  4OFL A;  1P1Q A;  3H7M A;  3V8X B;  4F18 A;  4OZ9 A;  3TEL A;  4H65 A;  5HBC A;  5AA1 A;  1B7Z A;  1JW4 A;  4DCY A;  1QUL A;  3AXF A;  3VVD A;  2L5V A;  5TP9 A;  4PTK A;  2GH9 A;  3T1B A;  2CZI A;  3TCG A;  4QHQ A;  1FBE A;  1MQG A;  2BJI A;  1D4N A;  2AYS A;  3C33 A;  1EZ9 A;  4IB2 A;  3LC8 A;  1LBZ A;  1QUK A;  3K6V A;  1NH8 A;  4MX6 A;  3PPQ A;  5LTC A;  1YTV A;  4P8B A;  2QS1 A;  4OES A;  2WBB A;  3D4C A;  3W15 C;  3TUS A;  3KBR A;  2OJT A;  2PFY A;  3U8Q A;  1B7U A;  5IKB A;  3MVZ A;  3OOA A;  2F7A A;  1B3F A;  3FD3 A;  2XXR A;  2HFB A;  3K00 A;  1USY H;  1FBF A;  3PMW A;  4NTL A;  3E78 A;  3R6U A;  5CM6 A;  1OIB A;  2DWH A;  1A99 A;  2B4M A;  3G3I A;  2XWK A;  1FQA A;  1FRP A;  1YXI A;  5KZT A;  3Q27 A;  3IK6 B;  1NV5 A;  5ICQ A;  2QFL A;  3KGC A;  4F29 A;  4NF6 A;  3LUY A;  3MJN A;  4N17 A;  4ZEF A;  4TOZ A;  2KLF A;  2DVZ A;  3ZSF A;  1EYJ A;  2PMS A;  4JWX A;  4L17 A;  1LFI A;  4GXS B;  2O7U A;  3IJO B;  3DP6 A;  4NHB A;  4YB7 A;  4WEP A;  1SW5 A;  1H3D A;  4XFE A;  2ESN A;  2Q8J A;  5I59 B;  5DVJ A;  2FYI A;  3TQL A;  5A5X B;  3TDJ A;  1S7Y A;  3FZV A;  3TTM A;  5J16 A;  1FPK A;  5DT6 A;  2R8T A;  1LCT A;  2CMO A;  4GBW A;  1G0I A;  1UIV A;  1LLS A;  5FHO A;  4XXU A;  3RPL A;  4ZZE A;  3SEY A;  4HCW A;  4GRK A;  3N6T A;  1Y1M A;  1LBY A;  5EHS A;  1BK4 A;  1RDX A;  4PBH A;  2XXU A;  4MNC A;  4N8Y A;  3IL1 B;  4H1X A;  2WYK A;  4R9G A;  3WAF A;  4MCO A;  3H03 A;  4YMB A;  4MFI A;  4G8N A;  4MEV A;  3TTL A;  1RDY A;  3C32 A;  3BFU A;  4ZEB A;  4I3E A;  4WXJ A;  1LAX A;  2E1S A;  4I40 A;  3S9E A;  4THI A;  1NNP A;  3MBP A;  5AA4 A;  1LBX A;  4GF8 A;  3CHG A;  3KJT A;  4YMA A;  1ZU0 A;  1FPB A;  3SEV A;  1XVY A;  2OCU A;  1IXG A;  4JBZ A;  2Z8D A;  2OWS A;  3IO4 A;  1IIW A;  5H8H B;  3QMF A;  3VLW A;  2FIX A;  4NF0 A;  1MXW A;  2QRY A;  5ICT A;  2RC8 A;  4GX3 A;  4PE3 A;  3VLV A;  4P9K A;  5IGA A;  1R6Z A;  1DBZ A;  3MC2 A;  3V89 B;  3OO9 A;  1YYZ A;  4FIM A;  3EHT A;  2F7B A;  4E0X A;  2W7Y A;  3TCH A;  1B3E A;  4P0I A;  1R9L A;  1NNF A;  4X1B A;  2B3F A;  3OO8 A;  3KFM A;  3MVW A;  3HO7 A;  1JW5 A;  2F5X A;  2XXV A;  2HHM A;  4KPT A;  4NN3 A;  1MPB A;  2XXY A;  1DPE A;  2ZZV A;  2ZYM A;  3PD8 A;  4R72 A;  4MNI A;  3TEP A;  4KD5 A;  4KHZ E;  3PPP A;  1P1O A;  3PUV E;  4I3Y A;  4PE5 B;  1YZ0 A;  4GWX A;  3HFU A;  5I5P A;  4X48 A;  3T9U A;  1B6H A;  1LAF E;  5H8H A;  1B3L A;  2B65 A;  3KN8 A;  3UN6 A;  1KZ8 A;  4U2R A;  4OVT A;  4GX4 A;  3HHG A;  1B3H A;  4RJZ A;  4U21 A;  3JYR A;  2NXO A;  4QXD A;  3GLB A;  1NV2 A;  3MZ1 A;  4GIZ A;  1S9T A;  4N07 A;  4JWO A;  1Y20 A;  3LSF B;  4F3G A;  2F34 A;  3MVX A;  4WKM A;  3M3K A;  4O7I A;  4KYS A;  1H76 A;  4QRZ A;  2DQV A;  1VFD A;  2QJE A;  3IOT A;  2QL3 A;  1N3X A;  4XF5 A;  1BKA A;  3QUF A;  4GXA A;  5DYH A;  4OEN A;  4ND9 A;  5T3J A;  2JJK A;  4MMP A;  4NGU A;  4GWO A;  4PAK A;  4PGP A;  4I1D A;  1H44 A;  3M3F A;  4K3F A;  1L5T A;  1NNT A;  5CI5 A;  5B7D A;  3FBP A;  5HPQ A;  3IR1 A;  3RT6 B;  4PAI A;  1Q9D A;  1O63 A;  2DE2 A;  3HV1 A;  4OXV A;  4FE8 A;  3I6V A;  1O64 A;  1NL5 A;  4Z0I A;  4LZ7 A;  3KBZ A;  5I57 B;  3B8B A;  1MXV A;  1B7H A;  4QSE A;  3TCF A;  4BDR A;  2FA7 A;  4R6K A;  4ZDM A;  4R6Y A;  5JTY B;  3RYD A;  3B50 A;  3M8U A;  3Q26 A;  4JSO A;  4POX A;  4QSD A;  1P1U A;  3PV0 E;  3ONM A;  3EHS A;  2XWI A;  1B9J A;  4DXC A;  2R9J A;  2XXK A;  4XKN A;  1ZLQ A;  2DXR A;  4JVC A;  5EQ8 A;  4GLI A;  1LBW A;  2QSX A;  3UOR A;  5H8F B;  1MM7 A;  2VHA A;  2XWO A;  3EF7 A;  1B1H A;  1T0K A;  2I0C A;  4F3B A;  3E13 X;  1NH7 A;  1Q35 A;  4JXI A;  4LQ2 A;  3MYU A;  2A5T B;  3OSQ A;  3T96 B;  1UTB A;  2O69 A;  2YLN A;  5A5X A;  1AWB A;  4DI4 B;  4U1O A;  3HN0 A;  1RKM A;  4F31 B;  1Q1K A;  2V3U A;  3PU5 A;  2XD2 A;  4WED A;  1POY 1;  2P3V A;  1FQE A;  1WOD A;  1Y3P A;  1XI6 A;  1IMB A;  2CZL A;  1KA1 A;  3EPE A;  5M2V A;  4ESW A;  4PFW A;  3WAE A;  5DVI A;  4KQP A;  1FQD A;  2PT2 A;  2RCA A;  4P3L A;  2QMW A;  1TXF A;  2DE4 A;  1UQW A;  3CG3 A;  4HS7 A;  2O68 A;  3CVG A;  4O7M A;  1EYI A;  4G68 A;  1XVX A;  2O1L A;  2ALU A;  1I6B A;  5I58 A;  1URG A;  3S9N C;  3OEN A;  2KR0 A;  3RQT A;  4R75 A;  2AL5 A;  1XT8 A;  4ELP A;  4KCD A;  4YIC A;  1P99 A;  5HM4 B;  1JEU A;  1URD A;  3FAT A;  2ZYN A;  2HAV A;  3O2A A;  1B1X A;  4BDL A;  5CMB A;  4F3S A;  1FTJ A;  3FJM A;  1I69 A;  3H6W A;  3MUQ A;  3HPI A;  2BJJ X;  4GWZ A;  1YAE A;  2R71 A;  3BFT A;  3K6X A;  2ZNS A;  3MW0 A;  5ET8 A;  3KC1 A;  1NUW A;  3IB1 A;  1M5F A;  3I5O A;  3C35 A;  1NI9 A;  3V83 A;  2RC7 A;  4MF3 A;  1FTL A;  3K01 A;  3H3G A;  4N6D A;  1SI0 A;  1DMB A;  5H8N B;  2NUV A;  3N6U A;  4YU0 A;  3OEM A;  2H9B A;  3BIH A;  2HQ0 A;  3LSL A;  3IJX B;  3IAZ A;  4Z7E A;  2Z22 A;  4MBP A;  3E9X A;  3S9L C;  4AS4 A;  2DWI A;  5CMK A;  4IO5 A;  4ISU A;  2F8D A;  2YPN A;  4NE4 A;  3RPW A;  5CBS A;  4ELO A;  4G4P A;  4LP2 B;  1IME A;  1FTA A;  3ISP A;  2MKZ A;  1MH4 A;  3OSR A;  1RYO A;  4NMY A;  3B7D A;  4GWU A;  1ANF A;  5TU0 A;  1LBC A;  2ZXT A;  2Q2A A;  2PVU A;  5I2K A;  4DI3 D;  1NFT A;  1FSA A;  1J1N A;  2Q9T A;  3VVF A;  2E0S A;  5IAI A;  3K1N A;  4PDD A;  2GRV A;  1MY3 A;  4F39 A;  3CI8 A;  1MS7 A;  3FV1 A;  3CFX A;  3TYH A;  4O94 A;  2Q8M A;  2HXR A;  3MAM A;  3TFL A;  4ESX A;  4PDH A;  5FHM A;  1JNF A;  4LA9 A;  3VDF A;  4PGN A;  1PBQ A;  1SW2 A;  3MZB A;  4GWW A;  2O51 A;  3FAS A;  4PFU A;  5DVF A;  3G3J A;  1FBP A;  4IR8 A;  1LAH E;  4JVD A;  3FUZ A;  3K2D A;  3N5L A;  2LAO A;  5L8D A;  1DTG A;  3CFL A;  1IXI A;  1TWY A;  3OO7 A;  4G61 A;  3SEX A;  1MPD A;  5AA4 B;  1A8F A;  4O3B A;  4IGR A;  4YAH X;  4QFO A;  3FXB A;  1B5I A;  4RA1 A;  3RGY A;  5LOM A;  2H4I A;  3PUY E;  5CBR A;  2DVC A;  2G93 A;  2P2A A;  3VE1 B;  2HXW A;  4P1L A;  3RY3 A;  3DP8 A;  4IY5 A;  2ZYK A;  1MXZ A;  2CEY A;  3K02 A;  4HW8 A;  5K2Y A;  1B05 A;  5I84 A;  4NED A;  3LBS A;  2QS2 A;  3IOU A;  1NUZ A;  4G8M A;  3K4U A;  3UP9 A;  3UGW A;  5F1Q A;  3OXN A;  1MQI A;  3VXC A;  4DIG A;  1MPC A;  1US4 A;  4I9D A;  4PFY A;  2FVZ A;  5CC2 A;  2PFZ A;  3CR9 A;  4N8G A;  4F22 A;  1GV8 A;  5JTY A;  1H45 A;  1DCU A;  4HE1 A;  1SI1 A;  1PEB A;  3CSG A;  3MPL A;  2RKM A;  3RT8 A;  4BLA A;  2OX3 A;  3E4R A;  4N13 A;  3ZS6 A;  2FNC A;  1FTM A;  2P3N A;  2PCR A;  5I59 A;  2F7C A;  2UXA A;  4LAT A;  1JQF A;  1UIU A;  2Q89 A;  2ONS A;  2Y7K A;  4P1E A;  1AOV A;  4ZZA A;  4LVQ A;  1SYH A;  5AE4 A;  4KYE A;  1JEV A;  2F36 A;  1VDW A;  3IOR A;  2F6G A;  4H6D A;  1B40 A;  2O1M A;  1SPI A;  4Q8R A;  1BP5 A;  3MZ9 A;  3QIM A;  4PBQ A;  2GHB A;  2THI A;  4RXL A;  1LB8 A;  2WEF A;  3GBB A;  4PFR A;  4BDQ A;  1SBP A;  3DM0 A;  4MH5 A;  3TOD A;  4AS5 A;  4N15 A;  2ZNT A;  1GGG A;  1N7W A;  2ZZX A;  4R74 A;  1B52 A;  5KCJ B;  5KCJ A;  2Z8E A;  3HST A;  1NV3 A;  1MY0 A;  1PC3 A;  2YJP A;  5EHM A;  4PAF A;  4EXK A;  1JET A;  5DEX B;  1PBP A;  1B4Z A;  1CB6 A;  3SES A;  4PF8 A;  1B2H A;  5L9M A;  3SET A;  3C34 A;  5CMC A;  4P47 A;  1D3K A;  3P7I A;  1A8E A;  4EDP A;  4JDF A;  3KC0 A;  1VR5 A;  3PPN A;  4XTC Q;  3QUJ A;  1B5J A;  5ESY A;  3D1R A;  1Y4T A;  1Z7N E;  2ONR A;  4IO7 A;  4DDD A;  4RK2 A;  1MXX A;  2V93 A;  5L9S A;  1FQF A;  4MLV A;  3OO6 A;  4KCC A;  2QS3 A;  4N6K A;  4QFN A;  1FPE A;  1XHY A;  1B0H A;  1B51 A;  4PET A;  2ABH A;  4F3P A;  3VVE A;  1PB9 A;  1LEV A;  3K0V A;  4P56 A;  3LSW A;  3RTF B;  3VV5 A;  4Q5T A;  4IO4 A;  4MAG A;  1MDQ A;  4ZS9 A;  3C31 A;  5EQA A;  4U23 A;  3E79 A;  2KQZ A;  5FBP A;  3QK6 A;  1US5 A;  4OVR A;  5ITP A;  2F3B A;  5DTB A;  3ZKL A;  5FTH A;  1G0H A;  1MXU A;  2REG A;  4ZE8 A;  1N84 A;  5K2X A;  3USD A;  4LN5 A;  4YKI A;  2XXH A;  2H98 A;  4NG7 A;  4F2Q A;  5AA3 A;  4EQB A;  1K9Y A;  2DOJ A;  1M5B A;  2HZL A;  1IIT A;  1MQH A;  2UVH A;  2FBP A;  5IM2 A;  1SW4 A;  1MY1 A;  3CSB A;  3KSX A;  2F3D A;  4OVS A;  3A09 A;  4HTG A;  3N26 A;  3UIF A;  2VD2 A;  1FBD A;  3EKI A;  5JEI A;  4HE0 A;  2VPO A;  2Q2C A;  3DEL B;  3PUX E;  1TT1 A;  1FPL A;  2DXY A;  3PUZ E;  2OK2 A;  2UVG A;  4Q30 B;  3D4G A;  1IXC A;  4EF2 A;  3G3H A;  2RIN A;  5AA2 B;  5JK4 A;  3MP1 A;  3IFC A;  3RUM A;  4OVJ A;  1A40 A;  5EQ9 A;  5BUU A;  4EF1 A;  2Q74 A;  3PPR A;  3Q28 A;  5EYF A;  3A29 A;  3IO6 A;  3C36 A;  4NF6 B;  3LUZ A;  2DWA A;  2AL4 A;  1KWH A;  4PC9 A;  1A55 A;  1QW0 A;  4R2B A;  4MHF A;  3L6H A;  3T22 A;  1WVJ A;  4NF8 A;  4F1Y A;  2WKY A;  1MM6 A;  3B6T A;  3SER A;  1GR2 A;  3MP8 A;  4RPN A;  1FBG A;  3TPA A;  2XX7 A;  5F24 A;  3TZA A;  1EU8 A;  1IUD A;  1SD3 A;  4HCY A;  4UA8 A;  4GX6 A;  2RCB A;  2A5T A;  3ILU B;  5KDT B;  2X7Q A;  5ELV A;  5IZ3 B;  5FHN A;  1INP A;  4FBP A;  5BWJ A;  1ZIU A;  2FIE A;  3FGS A;  3G7W A;  1RYX A;  2DS9 A;  1R9Q A;  1AL3 A;  3ODB A;  2F78 A;  1GTK A;  1FBC A;  2OPD A;  1ZMG A;  4H8I A;  2UVI A;  4OEU A;  1DTZ A;  2QVU A;  3H6V A;  2D21 A;  1ZBM A;  1DSN A;  1CNQ A;  4JVI A;  4YKJ A;  4N4U A;  2D3I A;  3S9M C;  3O29 A;  2VP1 A;  2XXW A;  1F9B A;  2F97 A;  2VT5 A;  2OWT A;  3PGF A;  5I56 B;  4G8H A;  1POT A;  1OQH A;  4AQ4 A;  4YZZ A;  1QUJ A;  3RTW B;  3NOH A;  3TKD A;  1ATG A;  3MST A;  4NF4 B;  4XKQ A;  5FTI A;  3O9P A;  1UTB B;  3IOW A;  5DEX A;  5AA2 A;  3TQW A;  3B6Q A;  1KA0 A;  4OAN A;  4DE8 A;  3GYY A;  1II5 A;  3PD9 A;  1SYI A;  5CRY A;  5J1D A;  4U1Z A;  4DCX A;  3V5A A;  4KFQ A;  1I6Q A;  5ET5 A;  1OLC A;  3T9V A;  1LBB A;  2H25 A;  1HSL A;  1QVS A;  1LFH A;  3I3V A;  1QJM A;  5TP9 B;  3IB2 A;  2Y7I A;  3TTN A;  1AMF A;  4IO2 A;  1NV4 A;  3BIG A;  4OEV A;  3MWB A;  4PFI A;  2VOZ A;  2DDK A;  2X7P A;  3KSJ A;  4NX1 A;  3T66 A;  3LSX A;  1PB7 A;  4IGT A;  2OLB A;  2Z8F A;  4KYD A;  4H46 A;  3O6I A;  4RPO A;  4R73 A;  3A3U A;  5ET7 A;  3PMX A;  2B4L A;  4NF5 A;  3TMG A;  3KN3 A;  3K6W A;  1FPF A;  3G3K A;  1ZJL A;  2A5S A;  1HSE A;  5ITO A;  3RLF E;  1B5H A;  3FIR A;  3CRB A;  3KZG A;  5I58 B;  4OQO A;  3S2V A;  4NF5 B;  2VPN A;  2V3T A;  4P11 A;  1FPJ A;  1NMU A;  3H6U A;  1B3G A;  1N0T A;  4OWD A;  1OMP A;  2IEE A;  3S4U A;  2PX1 A;  1B46 A;  4OFJ A;  2XD3 A;  3RNN A;  1FBH A;  4PCD A;  4U4X A;  3DP4 A;  3MPK A;  2R6G E;  4OA4 A;  4I62 A;  1M5E A;  1FTK A;  3A3C A;  1IZ1 A;  4Q0C A;  1FPI A;  1LAG E;  2QPQ A;  4E0W A;  4GD5 A;  4GFR A;  1LCF A;  3W9V A;  1IMF A;  1O7T A;  1B32 A;  3EN3 A;  2WBD A;  3RPL B;  1JVY A;  3OD7 A;  3BKI B;  5DW8 A;  5CMM A;  4IO3 A;  1FCK A;  1NV6 A;  3FVO A;  3U1O A;  1ZKB A;  2GHA A;  1LGB C;  4UAB A;  4KR5 A;  1N04 A;  1SW1 A;  4O3A A;  1XC1 A;  3FV2 A;  2NWJ A;  4H45 A;  4H5F A;  3VLU A;  4F2O A;  2REJ A;  5LDZ A;  4OYV A;  5ISU A;  4FEC A;  4BDO A;  1MXY A;  4I8C A;  5ET6 A;  2I6E A;  4EQ7 A;  4X04 A;  3SEU A;  2VD3 A;  3PMV A;  4RYA A;  2QMX A;  5IZZ A;  4X8R A;  2RC9 A;  1IMA A;  3K1M A;  4ZEI A;  4F19 A;  1FPD A;  2V4C A;  4YKP A;  1EZO A;  2PBW A;  2V84 A;  2O7I A;  2UVJ A;  1MQJ A;  2XXI A;  4BDM A;  2Q88 A;  1GVC A;  4GL0 A;  1XOC A;  1FJ9 A;  2H99 A;  1M5D A;  2PYY A;  3KG2 A;  3LV0 A;  5TPA B;  3IOV A;  2DE3 A;  2NVU B;  1NUX A;  2Y5K A;  1Y9U A;  2M8C A;  2XXX A;  3VFJ A;  2CZH A;  2I58 A;  1VSO A;  3C9H A;  1TFD A;  3RN8 A;  2DP8 A;  4QFK A;  5I2K B;  1LB9 A;  1Y1Z A;  4GBV A;  3H6T A;  2V25 A;  4G68 C;  2XX8 A;  3THI A;  3JV9 A;  2DYX A;  4HE2 A;  2O6A A;  3L6G A;  4OTE A;  1S50 A;  1OVB A;  3O66 A;  2GQ1 A;  2DSF A;  1R1N A;  3U94 A;  3SKP A;  4EUO A;  2V3Q A;  4LUB A;  4G77 A;  3IX1 A;  2Y7P A;  3O6H A;  4NQ8 A;  1N76 A;  4QF9 A;  4NWD A;  2XWV A;  4TLL B;  4TLM B;  5L9O A;  1BLF A;  4OVP A;  4HXV A;  3ILT B;  2O84 X;  1H43 A;  4F1V A;  1MY4 A;  1B0L A;  1NKX A;  4MNP A;  2HAU A;  3B6W A;  3QAX A;  1QUI A;  3R7X A;  2HPG A;  3O6G A;  2P0S A;  1MRP A;  3U92 A;  1FW0 A;  4MLQ A;  1B4H A;  4FEB A;  4MIJ A;  4ZEC A;  2AIX A;  4M1V A;  2DWJ A;  4XEQ A;  4UAC A;  1NV1 A;  3TTR A;  3ECR A;  4F1U A;  2RF1 A;  1SDX A;  4PQJ A;  4BDN A;  2NOO A;  5H8N A;  4LZ8 A;  1IMC A;  3QYT A;  4U4S A;  3CG1 A;  3FJ7 A;  4N6P A;  3U72 A;  3F11 A;  1D9V A;  1Y3Q A;  4O3C A;  4OVQ A;  5B70 A;  4ELQ A;  3HHF A;  2ZMB A;  4LQ5 A;  5EQ7 A;  2Y7R A;  4ZED A;  3T0J A;  2G29 A;  4H5G A;  4QSC A;  2ZNU A;  3KN7 A;  1UTH B; 
#chains in the Genus database with same CATH homology
 3W9V A;  1YYZ A;  4MAG A;  3BIH A;  4KXP A;  1IMF A;  4GBV A;  1FBE A;  5J1D A;  2BJI A;  4XFE A;  1FJ6 A;  2WBD A;  4NGU A;  1FBG A;  4P1L A;  4PAK A;  4PGP A;  4G61 A;  5EQA A;  2P3V A;  3RPL B;  3E79 A;  2KQZ A;  5FBP A;  4O8M A;  5DW8 A;  4QBA A;  1VDW A;  2Y5L A;  5ET5 A;  4AS4 A;  1XI6 A;  4HE2 A;  1LBZ A;  1NV6 A;  1IMB A;  5F24 A;  1KA1 A;  4OVR A;  5A5L A;  1NUY A;  3FBP A;  1SPI A;  4HCY A;  5EYH A;  4GX6 A;  3FXB A;  2F3B A;  4MX6 A;  4PFR A;  5J16 A;  1FPK A;  5LTC A;  1D9Q A;  2GQ1 A;  4P3L A;  4PAI A;  4NAP A;  1Q9D A;  1G0H A;  4UAB A;  2R8T A;  4GBW A;  4PBQ A;  1G0I A;  4P8B A;  1IME A;  2DE4 A;  5IZ3 B;  3PTY A;  2WBB A;  1FTA A;  2DE2 A;  2WEF A;  2F5X A;  4N91 A;  2CEX A;  1INP A;  1NV4 A;  4FBP A;  3RPL A;  3ISP A;  2QVR A;  4LN5 A;  3BIG A;  2V3Q A;  2HHM A;  2MKZ A;  2XA5 A;  1DK4 A;  4HCW A;  4NG7 A;  2PFY A;  4PFI A;  3SZP A;  1EYK A;  4NQ8 A;  1LBY A;  4H45 A;  1K9Y A;  1BK4 A;  1RDX A;  1EYI A;  2CEY A;  2FIE A;  4NN3 A;  2XWV A;  4MNC A;  4PBH A;  2DDK A;  4AS5 A;  2HZL A;  4N8Y A;  3KBZ A;  4N15 A;  2ZZV A;  4GWY A;  4NX1 A;  2WYK A;  3B8B A;  4MNI A;  4OVP A;  5LDZ A;  2ZZX A;  2FBP A;  5IM2 A;  4GWU A;  4HXV A;  2CZK A;  5ET6 A;  4MCO A;  5EYG A;  1LBV A;  4I3Y A;  4H46 A;  4X04 A;  1NV3 A;  1FBC A;  1NUZ A;  1IMD A;  2F3D A;  4MEV A;  5ET7 A;  4OVS A;  4DI3 D;  1RDY A;  2B4L A;  4MNP A;  1YZ0 A;  1FBF A;  2KR0 A;  2WYP A;  1FSA A;  1FBD A;  4GWX A;  1FPF A;  2QVU A;  3HFU A;  4X9T A;  3E78 A;  3EKI A;  4I3E A;  4PAF A;  1QGX A;  3RYD A;  4HE0 A;  5I5P A;  3B50 A;  5IZZ A;  2VPO A;  2Q9T A;  4X8R A;  2HPG A;  1IMA A;  1FPL A;  5CM6 A;  4YIC A;  4F19 A;  1FPD A;  4I40 A;  2V4C A;  2WX9 A;  4PF8 A;  2B4M A;  2ZZW A;  1CNQ A;  4JVI A;  4MIJ A;  4N4U A;  2XWK A;  4PDD A;  4MJO A;  4N81 A;  4M1V A;  4XEQ A;  1FRP A;  4P47 A;  1KZ8 A;  1YXI A;  1NV1 A;  1RDZ A;  5I3S A;  5I7I A;  4OVT A;  1LBX A;  4PFB A;  2FHY A;  2VT5 A;  4GX4 A;  2VPN A;  3ROJ A;  2FVZ A;  2XWI A;  4F1U A;  3CHG A;  2PFZ A;  3KC0 A;  1FPJ A;  4N8G A;  5JK4 A;  1NV7 A;  2XXK A;  1NV5 A;  4QXD A;  3IFC A;  3U65 A;  1NV2 A;  1K9Z A;  2QFL A;  1FJ9 A;  4GWZ A;  5EQ8 A;  4JVC A;  4O94 A;  1LBW A;  2Q8M A;  1IMC A;  2HXR A;  1FPB A;  1NV0 A;  4PF6 A;  1JP4 A;  4YZZ A;  1DCU A;  5ESY A;  4HE1 A;  4O7M A;  5IZ3 A;  4PDH A;  5EQ9 A;  2HZK A;  2XWO A;  3NOH A;  3D1R A;  2Q74 A;  5ET8 A;  1FBH A;  4O7I A;  3KC1 A;  3LV0 A;  4PCD A;  1NUW A;  3QMF A;  4N17 A;  2OWZ A;  3MST A;  2OX3 A;  3IFA A;  3W9W A;  3A29 A;  2FIX A;  4F18 A;  4PGN A;  4XF5 A;  1NI9 A;  1FPG A;  2DVZ A;  3MYU A;  2P3N A;  4GWW A;  4NF0 A;  2DE3 A;  4N6K A;  2PCR A;  3LUZ A;  4OA4 A;  4PE3 A;  1NUX A;  4GX3 A;  4OVQ A;  2Y5K A;  1EYJ A;  1FPE A;  4PC9 A;  2CZH A;  4P9K A;  5IGA A;  4MHF A;  5EQ7 A;  4PET A;  2QVV A;  1FBP A;  1FPI A;  4IR8 A;  4N6D A;  1AWB A;  4GWS A;  1DBZ A;  4JVD A;  1LEV A;  4DI4 B;  1KA0 A;  4OAN A;  4P1E A;  4P56 A;  4NHB A;  3T0J A;  2QPQ A;  5T3J A;  2JJK A;  2L5V A;  4MMP A;  3GYY A;  4PTK A;  4F1V A;  3T1B A;  2CZI A;  5IZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...