3KC1A

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 19a
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 97
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kc1A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kc1A02
1K9ZA 4I3YA 1QGXA 5J16A 1DCUA 5IZ3B 2Q8MA 3T0JA 1NV7A 1AWBA 1RDYA 1IMFA 1NV4A 5EQ9A 5EYGA 5ET8A 3IFCA 3RYDA 1EYKA 4GX6A 2CZKA 1DK4A 2Q74A 1FSAA 3BIHA 1BK4A 1FPIA 2GQ1A 5DW8A 1FPBA 1LEVA 4GWUA 1FBHA 3RPLB 4AS4A 1EYIA 4AS5A 5ET6A 1FPFA 1NV5A 1KZ8A 1FPEA 2QFLA 4KXPA 5ET5A 2Y5KA 4FBPA 3RPLA 1FBEA 2CZHA 4GWYA 1FJ9A 1RDZA 1KA1A 1NV0A 1IMEA 2FIXA 1NUXA 1NV1A 1CNQA 3LUZA 2QVUA 2WEFA 4HE0A 1NUWA 2F3BA 2OWZA 3BIGA 3KC0A 1XI6A 5EQ8A 1NUYA 4GX4A 2QVVA 4IR8A 5IZ3A 3LV0A 2FHYA 1Q9DA 4GBVA 1K9YA 1FJ6A 5ET7A 5A5LA 3IFAA 1YYZA 1IMCA 4GWWA 5EQ7A 5IZ1A 1LBWA 1NV3A 4I3EA 4HE1A 2CZIA 2FBPA 4O7IA 1IMBA 2FIEA 1FBPA 1NUZA 3FBPA 5FBPA 1LBVA 2OX3A 3KC1A 1FPKA 3QMFA 2FVZA 2HHMA 3B8BA 1INPA 1FBDA 1FBFA 2VT5A 4GWSA 3A29A 4HXVA 5EYHA 1NV6A 2P3NA 1KA0A 2WBDA 1G0IA 2QVRA 5EQAA 1FTAA 1NI9A 2JJKA 1IMAA 1IMDA 3D1RA 1G0HA 4HE2A 4GBWA 1FPDA 1FRPA 4GWXA 2DDKA 2R8TA 2WBBA 1FBCA 5F24A 2F3DA 4PTKA 3ROJA 1D9QA 1FPLA 4MJOA 4N81A 3KBZA 1DBZA 1SPIA 1VDWA 1FBGA 4QXDA 4G61A 4GX3A 1YXIA 1LBXA 4H45A 2BJIA 2P3VA 1LBZA 4H46A 2PCRA 1JP4A 5ESYA 4I40A 5T3JA 1FPJA 1RDXA 5I3SA 1NV2A 1EYJA 1YZ0A 2Y5LA 1FPGA 1LBYA 5LDZA 4GWZA
chains in the Genus database with same CATH superfamily
5L8DA 4XKPA 1USYH 2NWJA 4PETA 2G29A 1B5IA 1FTOA 5KZTA 4FATA 4NTLA 2A5SA 5IM2A 2F36A 5IGAA 3DELB 1NKXA 1CNQA 2B3BA 4N8GA 4P9KA 3C4MA 3KG2A 2OPEA 3KN7A 3BFTA 1OQHA 1LFHA 1VE4A 4U1ZA 2F7AA 4H8JA 3FATA 2BJJX 2V3UA 5ELVA 4OVQA 3OXNA 4Q30B 1NV3A 1OVTA 4MF3A 1FBPA 2QPQA 1MQHA 1SYHA 2DE2A 1LBVA 1P1UA 2LAOA 3SEVA 3VV5A 4PQJA 4IY5A 4M1VA 5I59A 3THIA 4HXVA 3M3KA 1MY1A 1LBBA 2HFBA 4DIGA 2GRVA 1P99A 3TKDA 3TZAA 4E0WA 3KOTA 1EZ9A 2P0SA 4R6HA 1JP4A 4ZDMA 4X04A 5JTYA 2HXRA 3FJGA 5I56B 1EU8A 4F3PA 3IJXB 1WDNA 2F78A 3OENA 5J16A 4ZE9A 2ALUA 3IFCA 3CIJA 5AA3A 2ZNUA 4RPNA 1WODA 1BK4A 2GQ1A 5DW8A 3E78A 4DLDA 3V5AA 4AS4A 1FCKA 3H03A 4RY1A 3OEMA 4R9GA 4ZE8A 2I0BA 2QFLA 4PF6A 3ZSFA 5ET5A 2Y5KA 4LQ2A 4AB6A 1FQAA 4P47A 5DVIA 3HO7A 2XD3A 4GX4A 1B7ZA 3VLWA 4DXCA 4JVCA 3KJTA 4OQOA 3LSXA 4FEBA 3U94A 3H7MA 5I7IA 1LBWA 3FIRA 3HHFA 1HSEA 2V4CA 2O51A 5I59B 3IO6A 1SW2A 1VSOA 2OX3A 4FEDA 1OMPA 3ODBA 1MY4A 1OIBA 2B65A 4DCYA 3RT6B 3CG1A 3VE1B 3A29A 1QUJA 4Q5TA 4EXLA 1B32A 3FVKA 2ZYKA 4EDPA 4H67A 2HAUA 1ANFA 4MMPA 4YB5A 4X9TA 3I3VA 1QKBA 1ZTYA 1B1XA 5F24A 3IJOB 3DP6A 2DVCA 3A09A 1LSTA 5JTYB 3TUSA 4QXDA 3H3GA 5AA4B 3B6TA 1LGBC 2RINA 4Q0CA 4ZEIA 2XXRA 2Y5LA 3MQ9A 2I6EA 1LAHE 2XXVA 4QFOA 3U93A 2THIA 1MPDA 4OERA 5DTBA 3JYRA 1QGXA 4OXVA 5L9MA 2Y84A 1NV7A 1NV4A 3CSGA 4POWA 2I48A 1I6AA 2V25A 4O3BA 1LFGA 2Q88A 4N8YA 2XXPA 4IO5A 3B50A 4WEPA 1AH5A 3FXRA 2DXYA 4GF8A 4QHQA 1SBPA 2XXXA 2PVUA 4OHNA 4BDQA 4X48A 5I57B 4BDMA 4FBPA 2ZZWA 3M3LA 1T0KA 1IMEA 3O28A 2GH9A 2ZZVA 1M5BA 1BKAA 4DI4B 3G3HA 2L5VA 2KLFA 1YCJA 1ZJLA 1GVCA 4ISUA 4P3LA 3K6WA 4RA1A 2NOOA 3SESA 2QS4A 1NMUA 1AL3A 1YYZA 1ZU0A 3FGSA 1SW4A 5AA2A 4ZEKA 3OELA 1R6ZA 3TCGA 1ZKBA 3IR1A 4O7IA 3IL1B 2QSXA 1DPPA 1NH8A 3HN0A 1NNFA 3CRBA 1UTBB 2ZXTA 4F3GA 5EHMA 3FV2A 3IB1A 2D3IA 3WAFA 3GBAA 1IMAA 3IAZA 3R7XA 4GBWA 1Z7ME 2GHBA 2ONRA 2DDKA 2WBBA 1XOCA 1D9QA 4NGUA 1FPLA 4N81A 4DXBA 1B7UA 4X1BA 3BFUA 1LBZA 2H4IA 2B4MA 3Q26A 4PE5B 1UTHB 3U72A 1B5JA 5TPAA 3VXBA 4OEUA 1US5A 3MPLA 4U23A 3M3FA 3QAXA 4P0GA 4PE3A 1RDYA 4EXKA 1MH3A 4P0IA 3IB2A 3SDFA 3PPOA 1H43A 3V8XB 3LC8A 2Q74A 5BUUA 3VDFA 4F1YA 5H8SA 4ESXA 1LEVA 3HHGA 5ET6A 3SERA 2RCAA 3C9HA 4LUBA 5AE4A 1B3LA 3MP1A 3PUXE 2Z8DA 1KA1A 1A54A 3N26A 5JEIA 4NE4A 2XX9A 3ILTB 2ONKE 2R9JA 5CRYA 4I62A 1A8EA 5CMMA 3O6GA 2QJEA 1NNTA 1PEBA 5EQ7A 2ZZXA 1B4ZA 1XC1A 3FJMA 3IX1A 4THIA 4DCXA 2XWIA 4XKQA 4NF4B 1B6HA 4NF5B 2HZKA 5EYFA 3PUYE 3MUQA 3FBPA 1MXUA 4RXLA 1NNPA 3IOTA 2WYPA 4JDFA 1LFIA 2P3NA 1FQEA 1NI9A 2Z22A 4F22A 1Y20A 4QRZA 2F3DA 4PTKA 5FHNA 4EQ9A 3KBZA 5A5XA 3OD7A 5H8NA 4NWCA 5HPQA 3GXAA 4I40A 5T3JA 1O64A 4PDDA 5B7DA 2QMXA 4DZ1A 2QMWA 5ICTA 4ZECA 3SEUA 4YKPA 3PUWE 3H6UA 3MZ1A 2VD2A 5HM4B 4GWZA 2Q8MA 5IZ3B 5EQ9A 1DTZA 4C1TA 4PAIA 1JNFA 2REJA 4BDLA 4ZS9A 3RY3A 1ZBMA 4U1OA 1RYXA 1MQDA 3Q28A 4F29A 1JW5A 3PV0E 2O6AA 3KN3A 2O7UA 1S9TA 4MCOA 3FD3A 3TAJA 1NUYA 3D4CA 1SW5A 1N3WA 1PBPA 2ONSA 2DE4A 2PFYA 5IZ1A 1J1NA 2DSFA 1PB9A 4EF2A 4QBAA 5FBPA 1I6BA 2FVZA 3B8BA 4NF6B 1M5FA 2PYYA 4PCDA 4KPTA 4GIZA 4OFOA 4QFNA 2DWIA 4LP2B 4XFEA 3K4UA 3VVDA 1MDP1 3B7DA 3QUJA 4FJPA 3ZKKA 5FHOA 1JVXA 3HCQA 1PC3A 3GZGA 3K00A 4C0RA 2XD2A 3MVYA 3PU5A 4OFJA 1MY3A 5DVJA 1LCTA 4MNIA 3T22A 1Q1KA 5AA1A 3RLFE 1ZIUA 3RTWB 1H44A 3T0JA 3VVEA 4R72A 2HAVA 3UN6A 1A99A 1B5HA 3SEXA 3CI8A 1IXHA 3EQ1A 1ZMGA 4EQ7A 2Q2CA 3OO8A 4AS5A 4PAFA 1PB8A 4HW8A 2G93A 3Q29A 3VLUA 1IUDA 3QYTA 1MXVA 3RPLA 1MQGA 1AIVA 4TLMB 1LAFE 4KR5A 3OO6A 3RUMA 2DQVA 2VPNA 3LUZA 5I56A 2H5YA 3MBPA 3ZKLA 1JETA 4NWDA 1URGA 2XXWA 4G68C 3H6WA 4NAPA 1FJ6A 2DYXA 4H5FA 3TCHA 2Z23A 3UIFA 4GWWA 4MHFA 3G3KA 3K6UA 2NUVA 4NX1A 1KWHA 3OO7A 4UACA 4MEVA 2X7QA 4IB2A 1SI0A 2HEUA 3SETA 3GYYA 3NOHA 3O9PA 4H0WA 4F19A 2XX8A 1FBCA 2V3TA 3ROJA 4MJOA 1ELJA 3KJ7A 2WX9A 1FBGA 1B51A 3O29A 1QULA 2PCRA 3E3KA 4N17A 5I3SA 4JVDA 1NL5A 3TTKA 2DE3A 4N07A 3FVNA 1IIWA 2OK2A 1K9ZA 1SD3A 2I58A 3KN8A 4OVSA 1LB8A 2KR0A 4JBZA 5EYGA 3AXFA 4N15A 3PMVA 3GBBA 2CZKA 3HPIA 4RK9A 1UIUA 3E4RA 4GWUA 3RPLB 1EYIA 3TTMA 5AA4A 5CC2A 1FPFA 1NV5A 1OLCA 2F5XA 3ILUB 5TU0A 1S50A 5H8FB 4ZZEA 4XTCQ 1NUXA 5H8QB 4OVRA 4IO2A 1FQCA 2RC8A 3RNNA 5H8HA 2I4CA 3VVFA 2FHYA 4NG7A 1NFTA 4JWOA 2XHDA 4MX6A 2B3FA 5A5LA 3PD8A 1PDAA 1IMCA 4NEDA 2OWSA 2CZIA 2FIEA 1NUZA 1TFDA 3MPKA 4X8RA 2PT2A 5I57A 4ZEFA 2M8CA 1TFAA 4Q8RA 5LOMA 5IKBA 4ELPA 3EF7A 3TTRA 2REGA 4LZ5A 4P11A 1GTKA 4GWXA 4BDNA 4LVQA 1UQWA 3T96B 1FTLA 3DLNA 3OEKA 1DBZA 1VDWA 4U2RA 4H46A 4Z7EA 2Y7WA 4NF8B 3CFLA 4O94A 4TQUQ 2Z8FA 2VP1A 3FVGA 5HBCA 1JQFA 4JWXA 3MC2A 1FTMA 3BBRA 1UTBA 4N6DA 1IMFA 1Y1MA 5ET8A 1Z7NE 1EYKA 3PGFA 2DVZA 2RKMA 4XIGQ 3RQTA 3B6QA 2UYFA 3H6TA 3USDA 1B58A 2IA4A 1FBHA 4OENA 4NQ8A 3U1OA 3G7WA 4N6KA 1UTHA 5H8HB 5I58B 4F1VA 1QVSA 2ZYOA 1NUWA 4JWYA 4YU0A 2ESNA 3FXBA 4KYDA 4KCDA 4ONYA 3IORA 1Y3PA 3OO9A 2R71A 3EHSA 4JSOA 2OCUA 4OVPA 4LZ8A 4YB7A 3RT8A 4R73A 2XXKA 4BDRA 3KSJA 2CMOA 1MG1A 2I0CA 2RF1A 4NN3A 2E0SA 2KQZA 4DXUA 1IMBA 3FJ7A 4QFLA 2AIXA 2VPOA 1JVYA 1DTGA 1JEUA 1M5EA 4KD5A 4L17A 3TELA 4IGRA 4OYVA 3O2AA 4GLIA 2O68A 5CMBA 5DEXB 3JZJA 2DWAA 4PFUA 1VFDA 1Y4TA 2DOJA 2BJIA 3TEPA 2CZLA 4G77A 4NF4A 4NF5A 1YZ0A 2XXUA 2HXWA 2YLNA 1DSNA 2FA7A 2I3VA 5EQAA 4ND9A 4C1UA 5FHMA 4F2OA 4PAKA 3TPAA 3UP9A 5J1DA 2XXIA 4R9FA 4PFTA 4TOZA 1R9LA 3OMBA 3E9XA 4IO6A 3EPEA 1P1OA 4BDOA 1MY0A 5L9SA 1FPEA 4PFRA 4F3BA 2XX7A 3K1PA 4RPOA 4ZEBA 2NXOA 4P1EA 4GWYA 1HSLA 4YKKA 1USYE 3H06B 1AOVA 5M2VA 1I6QA 3KC0A 3K01A 5IZ3A 1DMBA 4O8MA 3FVOA 4IGTA 3DP4A 1B3EA 3MVZA 4ELOA 3OSQA 3G3GA 3UORA 2PMSA 3EHTA 2R6GE 3BKIB 1B1HA 3EHUA 3V89B 2OZZA 1A7LA 1Q35A 5ITPA 1JEVA 1B9JA 5F1QA 1VFEA 2OBGA 4PBQA 3C36A 1FW0A 2F8DA 1QUKA 1Y9UA 2WBDA 3PPQA 2F7CA 1SQYA 2D21A 4FIMA 2ZNTA 3MP6A 3QUFA 2P2AA 2XXQA 4P8BA 5ICQA 3R26A 4PFBA 5ESYA 1OVBA 1VR5A 4JSDA 2RC9A 2XXHA 1IQ7A 3G3JA 2GHAA 4NF6A 4OTEA 3Q25A 4UA8A 4OVJA 1H45A 3L6HA 4F2QA 4QF9A 1FPIA 1PBQA 4AB5A 2UVIA 4HTGA 1FPBA 1ZLQA 2HQ0A 1KZ8A 3TYHA 3N6UA 3T66A 2XWKA 1A8FA 1MM6A 1MRPA 4KYSA 5ITOA 2FIXA 1YTVA 4MLQA 1Y3QA 3R6UA 4IR8A 2VOZA 1CB6A 2DWHA 1FTJA 4H8IA 4HCWA 3RPWA 3SKPA 1M5DA 4HE1A 3N5LA 1MXZA 4LN5A 1EZOA 3E13X 5I2NB 2IEEA 4GVOA 3LUYA 4KHZE 2H99A 3V83A 5ISUA 1POTA 3O6HA 2XXTA 1H76A 5KCJB 1IMDA 4OVTA 4G8NA 1D3KA 1TT1A 2VHAA 1S7YA 4EQBA 3MW0A 1LBXA 4H45A 5CBRA 1IEJA 3TMGA 2X26A 1QW0A 3HSTA 3OOAA 4QSCA 4F1UA 3EN3A 4MFIA 3A3UA 3FXQA 4PGNA 1DPEA 3KZGA 3K0VA 1N0TA 5CM6A 4JB7A 3I5OA 4G8HA 2Y7RA 3IK6B 2H98A 4FAJA 1DK4A 3CG3A 3QIMA 4G68B 2UVGA 3CR9A 4H65A 1FQDA 4OA4A 5KDTB 1P1NA 2Q9TA 4GWOA 5CI5A 1H3DA 1XHYA 4LA9A 3SZPA 4MLVA 1IXIA 3RGYA 2QVUA 1JW1A 2F6PA 4YICA 2ZYMA 1SDXA 1BLFA 4GFRA 3TODA 3W15C 3L6GA 1N76A 2PBWA 4ZEDA 3MYUA 3D4GA 2FBPA 3O6IA 3S4UA 3K6XA 3KSXA 2HPGA 3T1BA 2F6GA 4OZ9A 4WEDA 5H8FA 2X7PA 4OWDA 3C31A 3IOWA 5H8QA 4X1DA 2OJTA 3QK6A 2QVRA 4HS7A 3PPRA 4TLLB 3D1RA 3CFXA 4HE2A 3U65A 1IZ1A 1O63A 4OESA 3FUZA 3C34A 3KOSA 3QXMA 3PMXA 5CMCA 4YKJA 4N6PA 2P3VA 4GL0A 4OANA 2PFZA 2GFEA 3HFUA 1A55A 2Q8JA 4O3CA 1LBYA 2ZMBA 4F31B 4I3YA 3EKIA 1CE2A 4POXA 1AWBA 2UVHA 4OEVA 2A5TB 4P1LA 4U4SA 3B6WA 3QSLA 1MM7A 3M8UA 4DE8A 2UXAA 3UK4A 4R2BA 2P1SA 3K02A 4EUOA 1QJMA 4GRKA 2H25A 2I4BA 1POY1 4RNSA 4NF8A 1FBEA 3GLBA 3T9HB 5TP9B 2O69A 2OWZA 2E1SA 4LATA 1Q9DA 3OSRA 5EHSA 3MP8A 1K9YA 1AMFA 3MVXA 1FTKA 3MVWA 3TTNA 4KI0E 1Y3NA 3KFMA 4OMBA 3FASA 1Y1ZA 4JVIA 4IO4A 4I3EA 3G3FA 5DVFA 2WYKA 2XA5A 3LBSA 4KCCA 1ATGA 3IO4A 2ABHA 5I58A 3PUVE 1INPA 1FBDA 1FBFA 2VT5A 3T9VA 3ZS6A 1MPCA 3H6VA 1NV6A 4RK2A 4ELRA 1XS5A 4FE8A 4KYEA 3W9VA 3LSLA 4PFWA 1HSJA 2QS3A 2I3WA 3UGWA 1GV8A 2YPNA 4GX3A 4XF5A 4RYAA 3PPPA 3KGCA 3FXUA 1RKMA 3KBRA 1B3GA 1EYJA 1MY2A 1R9QA 3T9UA 2PX1A 3K2DA 1MQJA 1XT8A 1URDA 1OQGA 4H5GA 3SEYA 1EH3A 4IO3A 1MXWA 1LAXA 2FNCA 2OLBA 5CMKA 3IOVA 4EF1A 1B4HA 2Q89A 5DEXA 2D5WA 1US4A 4N91A 1IXCA 4I1DA 1D9YA 5BWJA 3ISPA 3RN8A 4P56A 4R2FA 2UYEA 4H1XA 1LLSA 4G4PA 4MH5A 2Y7PA 2H9BA 5AA2D 2F3BA 4N13A 1XI6A 2QVVA 2XWVA 5CBSA 4FECA 2AL5A 3IOUA 1QUIA 5K2YA 4PF8A 2ANJA 3TTLA 4H6DA 1SI1A 1B7HA 4PC9A 3S9EA 3A3CA 1MQIA 3ONMA 3KC1A 2ZNSA 5B70A 3TQLA 2HHMA 3ECRA 1BP5A 3S9NC 1OLAA 1SW1A 1G0IA 4MNPA 1FTAA 1QKAA 1P1QA 4WKMA 1FPDA 1FRPA 1N7WA 4DDDA 1B2HA 4PP0A 3LR1A 4MBPA 1N84A 1WVJA 1LBCA 1UIVA 1YXIA 4JXIA 3CVGA 1LAGE 1B3FA 3JV9A 1B0LA 4K3FA 4IO7A 4LZ7A 1YPNA 1DCUA 2CEYA 4ZZAA 2O84X 2OWTA 2RCBA 4GL8A 4ELQA 4M4GA 4F18A 4AQ4A 3RYDA 4DI3D 4GX6A 1FSAA 2O1LA 3MJNA 4R6YA 5FTIA 2F7BA 1BIYA 2CZHA 1FJ9A 1RDZA 1NV0A 1MH4A 1YAEA 4YKIA 2WEFA 1B0HA 2HZLA 4F3SA 3PTYA 5EQ8A 4QFPA 1NH7A 2F34A 4F39A 4GBVA 2F97A 4LQ5A 3LSWA 2HCAA 5ET7A 2FYIA 3IFAA 1DOTA 1B05A 4E0XA 1D4NA 2O7IA 2V84A 2F35A 2DS9A 3C35A 3MAMA 1Y4CA 1SYIA 3WAEA 1M5CA 4BLAA 4NHBA 5L9OA 2Y7KA 4GWSA 5EYHA 1KA0A 2UVJA 4R74A 3C32A 2JJKA 1G0HA 3G3IA 3T9XB 2Z8EA 1N04A 1SVXB 1MPBA 1MXYA 1SPIA 1N7XA 5I2KA 4YAHX 5FTHA 4GOTA 4G8MA 4YZZA 2QL3A 2YJPA 4OFLA 2V93A 1NV2A 3KEIA 5I2NA 1FPGA 5LDZA 2PT1A 3I6VA 3MZBA 2MKZA 5LTCA 4NF0A 5K2XA 1GR2A 2B4LA 3E79A 4R6KA 4GD5A 5KCJA 3Q27A 2O1MA 5AA2B 2I49A 3H4ZA 3W9WA 4FORA 3BIHA 4GXAA 4XXUA 3TFLA 2DP8A 1II5A 4O7MA 4YMAA 5IAIA 1TXFA 2XXYA 1FQBA 4R75A 4HE0A 3PPNA 2Y7IA 4GQOA 2W7YA 4WXJA 3BIGA 4U4XA 2Q2AA 4LONB 3K6VA 3P7IA 5DYHA 1TWYA 2V3QA 5F7VA 4MNCA 4G68A 4QSDA 5DT6A 1MS7A 2AL4A 1B52A 5TPAB 1O7TA 4NMYA 5KDTA 1I69A 1XVYA 4MIJA 4Z0IA 2XWOA 3CSBA 4I8CA 3RTFB 2DXRA 5I2KB 3U92A 3U8QA 1F9BA 2CEXA 1EZPA 4KFQA 4U21A 4KQPA 3VLVA 2VD3A 3HV1A 3PD9A 4PBHA 1LB9A 4XKNA 4G61A 1D9VA 5I84A 4QFKA 3FZVA 3O97A 2WKYA 2OPDA 1FPJA 4PFIA 4QSEA 1N3XA 2RC7A 5IZZA 5I5PA 4GXSB 1GGGA 4UABA 4OETA 1NNKA 1IXGA 3K1MA 1XVXA 3PUZE 3PMWA 1JW4A 3S2VA 4O3AA 3N94A 2QRYA 3TQWA 3UA8A 3CHGA 4ESWA 5JK4A 4IY6A 3O66A 3F11A 4ECFA 1MXXA 4N4UA 4XEQA 1A40A 4KXPA 1L5TA 1NV1A 1B3HA 3MZ9A 1PB7A 1FQFA 4PFYA 3LV0A 3TDJA 3FV1A 1RYOA 2A5TA 1IITA 3DP8A 5A5XB 5H8NB 2QS2A 3IB0A 3C33A 4I9DA 3S9LC 4G2ZA 2ZYNA 3S9MC 3SEWA 1FPKA 1P1WA 3QMFA 1URSA 3MWBA 1MDQA 4U22A 3N6TA 2AYSA 5TP9A 3T93B 2VGQA 3MSTA 4PGPA 4YB6A 4HCYA 2R8TA 4MAGA 1LCFA 1B40A 3TCFA 4XKRA 3LSFB 1B46A 3CFZA 1R1NA 3VFJA 2NVUB 4RJZA 4PDHA 3VXCA 3K1NA 1RDXA 4YMBA 2DWJA 2QS1A 1BTJA 3DM0A
chains in the Genus database with same CATH topology
2Q8MA 5IZ3B 5EQ9A 4PAKA 5J1DA 4GWZA 4PETA 4PAIA 4N91A 5IM2A 5IGAA 1FPEA 4PFRA 3ISPA 4P1EA 4P56A 4GWYA 1CNQA 4MCOA 4N8GA 4P9KA 2F3BA 3KC0A 1XI6A 1NUYA 2QVVA 2XWVA 5IZ3A 4O8MA 2DE4A 2PFYA 4OVQA 4PF8A 5IZ1A 1NV3A 4PC9A 1FBPA 2QPQA 4QBAA 5FBPA 2DE2A 1LBVA 3KC1A 4PBQA 2FVZA 2HHMA 3B8BA 4M1VA 4HXVA 4PCDA 2WBDA 1G0IA 4MNPA 1FTAA 1FPDA 1FRPA 4XFEA 4P8BA 1YXIA 4PFBA 1JP4A 5ESYA 4MNIA 4X04A 2HXRA 5J16A 1DCUA 2CEYA 3T0JA 4F18A 3IFCA 3RYDA 4DI3D 4GX6A 1FSAA 1BK4A 1FPIA 2GQ1A 5DW8A 3E78A 1FPBA 4AS4A 4AS5A 4PAFA 1KZ8A 2QFLA 2XWKA 4PF6A 5ET5A 2Y5KA 3RPLA 2CZHA 1FJ9A 1RDZA 1NV0A 2FIXA 4P47A 2VPNA 3LUZA 2WEFA 2HZLA 3PTYA 5EQ8A 4GX4A 4IR8A 4JVCA 4GBVA 4NAPA 1FJ6A 5ET7A 3IFAA 4HCWA 4GWWA 4MHFA 5I7IA 1LBWA 4NX1A 2V4CA 4HE1A 4LN5A 4NHBA 2OX3A 4MEVA 4GWSA 3A29A 5EYHA 1KA0A 2JJKA 4OVTA 1IMDA 1G0HA 3GYYA 3NOHA 4MMPA 4X9TA 4F19A 1FBCA 5F24A 3ROJA 4MJOA 1SPIA 2WX9A 1FBGA 4QXDA 1LBXA 4H45A 2PCRA 4YZZA 4N17A 5I3SA 1NV2A 2Y5LA 4JVDA 1FPGA 4F1UA 5LDZA 2DE3A 1K9ZA 2MKZA 1QGXA 4PGNA 4OVSA 5CM6A 1NV7A 2KR0A 4NF0A 5LTCA 2B4LA 3E79A 1NV4A 5EYGA 4N15A 2CZKA 1DK4A 3W9WA 3BIHA 4N8YA 4OA4A 4GWUA 3RPLB 3B50A 1EYIA 1FPFA 2Q9TA 1NV5A 2F5XA 4O7MA 4FBPA 2ZZWA 3SZPA 1IMEA 1NUXA 2ZZVA 4DI4B 2QVUA 4HE0A 4OVRA 4YICA 3BIGA 2L5VA 2FHYA 4NG7A 4P3LA 4MX6A 2V3QA 5A5LA 1YYZA 1IMCA 4MNCA 3MYUA 2CZIA 2FBPA 4O7IA 2FIEA 1NUZA 2HPGA 4X8RA 3T1BA 4MIJA 2XWOA 2QVRA 1IMAA 3D1RA 4HE2A 4GBWA 3U65A 4GWXA 2DDKA 2CEXA 2WBBA 1D9QA 1FPLA 4N81A 4NGUA 1DBZA 1VDWA 4PBHA 4G61A 2P3VA 1LBZA 4H46A 4OANA 2PFZA 2B4MA 3HFUA 1FPJA 4PFIA 5IZZA 5I5PA 1LBYA 4O94A 4UABA 4I3YA 3EKIA 4N6DA 1AWBA 4PE3A 1RDYA 1IMFA 4P1LA 5ET8A 1EYKA 2DVZA 2Q74A 3CHGA 5JK4A 1LEVA 1FBHA 4N4UA 5ET6A 4XEQA 4NQ8A 4KXPA 4N6KA 1FBEA 4F1VA 1KA1A 1NV1A 1NUWA 2OWZA 3FXBA 3LV0A 1Q9DA 1K9YA 4OVPA 2XXKA 5EQ7A 4JVIA 4I3EA 2ZZXA 2XWIA 4NN3A 2KQZA 2WYKA 2XA5A 2HZKA 1IMBA 3FBPA 2VPOA 1FPKA 3QMFA 1INPA 1FBDA 1FBFA 2VT5A 2WYPA 1NV6A 2P3NA 1NI9A 3MSTA 4PGPA 4HCYA 3W9VA 2R8TA 4MAGA 2F3DA 4PTKA 3KBZA 4GX3A 2BJIA 4XF5A 4PDHA 4I40A 5T3JA 4PDDA 1RDXA 1YZ0A 1EYJA 5EQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9Z A;  4I3Y A;  1QGX A;  5J16 A;  1DCU A;  5IZ3 B;  2Q8M A;  3T0J A;  1NV7 A;  1AWB A;  1RDY A;  1IMF A;  1NV4 A;  5EQ9 A;  5EYG A;  5ET8 A;  3IFC A;  3RYD A;  1EYK A;  4GX6 A;  2CZK A;  1DK4 A;  2Q74 A;  1FSA A;  3BIH A;  1BK4 A;  1FPI A;  2GQ1 A;  5DW8 A;  1FPB A;  1LEV A;  4GWU A;  1FBH A;  3RPL B;  4AS4 A;  1EYI A;  4AS5 A;  5ET6 A;  1FPF A;  1NV5 A;  1KZ8 A;  1FPE A;  2QFL A;  4KXP A;  5ET5 A;  2Y5K A;  4FBP A;  3RPL A;  1FBE A;  2CZH A;  4GWY A;  1FJ9 A;  1RDZ A;  1KA1 A;  1NV0 A;  1IME A;  2FIX A;  1NUX A;  1NV1 A;  1CNQ A;  3LUZ A;  2QVU A;  2WEF A;  4HE0 A;  1NUW A;  2F3B A;  2OWZ A;  3BIG A;  3KC0 A;  1XI6 A;  5EQ8 A;  1NUY A;  4GX4 A;  2QVV A;  4IR8 A;  5IZ3 A;  3LV0 A;  2FHY A;  1Q9D A;  4GBV A;  1K9Y A;  1FJ6 A;  5ET7 A;  5A5L A;  3IFA A;  1YYZ A;  1IMC A;  4GWW A;  5EQ7 A;  5IZ1 A;  1LBW A;  1NV3 A;  4I3E A;  4HE1 A;  2CZI A;  2FBP A;  4O7I A;  1IMB A;  2FIE A;  1FBP A;  1NUZ A;  3FBP A;  5FBP A;  1LBV A;  2OX3 A;  3KC1 A;  1FPK A;  3QMF A;  2FVZ A;  2HHM A;  3B8B A;  1INP A;  1FBD A;  1FBF A;  2VT5 A;  4GWS A;  3A29 A;  4HXV A;  5EYH A;  1NV6 A;  2P3N A;  1KA0 A;  2WBD A;  1G0I A;  2QVR A;  5EQA A;  1FTA A;  1NI9 A;  2JJK A;  1IMA A;  1IMD A;  3D1R A;  1G0H A;  4HE2 A;  4GBW A;  1FPD A;  1FRP A;  4GWX A;  2DDK A;  2R8T A;  2WBB A;  1FBC A;  5F24 A;  2F3D A;  4PTK A;  3ROJ A;  1D9Q A;  1FPL A;  4MJO A;  4N81 A;  3KBZ A;  1DBZ A;  1SPI A;  1VDW A;  1FBG A;  4QXD A;  4G61 A;  4GX3 A;  1YXI A;  1LBX A;  4H45 A;  2BJI A;  2P3V A;  1LBZ A;  4H46 A;  2PCR A;  1JP4 A;  5ESY A;  4I40 A;  5T3J A;  1FPJ A;  1RDX A;  5I3S A;  1NV2 A;  1EYJ A;  1YZ0 A;  2Y5L A;  1FPG A;  1LBY A;  5LDZ A;  4GWZ A; 
#chains in the Genus database with same CATH topology
 5L8D A;  4XKP A;  1USY H;  2NWJ A;  4PET A;  2G29 A;  1B5I A;  1FTO A;  5KZT A;  4FAT A;  4NTL A;  2A5S A;  5IM2 A;  2F36 A;  5IGA A;  3DEL B;  1NKX A;  1CNQ A;  2B3B A;  4N8G A;  4P9K A;  3C4M A;  3KG2 A;  2OPE A;  3KN7 A;  3BFT A;  1OQH A;  1LFH A;  1VE4 A;  4U1Z A;  2F7A A;  4H8J A;  3FAT A;  2BJJ X;  2V3U A;  5ELV A;  4OVQ A;  3OXN A;  4Q30 B;  1NV3 A;  1OVT A;  4MF3 A;  1FBP A;  2QPQ A;  1MQH A;  1SYH A;  2DE2 A;  1LBV A;  1P1U A;  2LAO A;  3SEV A;  3VV5 A;  4PQJ A;  4IY5 A;  4M1V A;  5I59 A;  3THI A;  4HXV A;  3M3K A;  1MY1 A;  1LBB A;  2HFB A;  4DIG A;  2GRV A;  1P99 A;  3TKD A;  3TZA A;  4E0W A;  3KOT A;  1EZ9 A;  2P0S A;  4R6H A;  1JP4 A;  4ZDM A;  4X04 A;  5JTY A;  2HXR A;  3FJG A;  5I56 B;  1EU8 A;  4F3P A;  3IJX B;  1WDN A;  2F78 A;  3OEN A;  5J16 A;  4ZE9 A;  2ALU A;  3IFC A;  3CIJ A;  5AA3 A;  2ZNU A;  4RPN A;  1WOD A;  1BK4 A;  2GQ1 A;  5DW8 A;  3E78 A;  4DLD A;  3V5A A;  4AS4 A;  1FCK A;  3H03 A;  4RY1 A;  3OEM A;  4R9G A;  4ZE8 A;  2I0B A;  2QFL A;  4PF6 A;  3ZSF A;  5ET5 A;  2Y5K A;  4LQ2 A;  4AB6 A;  1FQA A;  4P47 A;  5DVI A;  3HO7 A;  2XD3 A;  4GX4 A;  1B7Z A;  3VLW A;  4DXC A;  4JVC A;  3KJT A;  4OQO A;  3LSX A;  4FEB A;  3U94 A;  3H7M A;  5I7I A;  1LBW A;  3FIR A;  3HHF A;  1HSE A;  2V4C A;  2O51 A;  5I59 B;  3IO6 A;  1SW2 A;  1VSO A;  2OX3 A;  4FED A;  1OMP A;  3ODB A;  1MY4 A;  1OIB A;  2B65 A;  4DCY A;  3RT6 B;  3CG1 A;  3VE1 B;  3A29 A;  1QUJ A;  4Q5T A;  4EXL A;  1B32 A;  3FVK A;  2ZYK A;  4EDP A;  4H67 A;  2HAU A;  1ANF A;  4MMP A;  4YB5 A;  4X9T A;  3I3V A;  1QKB A;  1ZTY A;  1B1X A;  5F24 A;  3IJO B;  3DP6 A;  2DVC A;  3A09 A;  1LST A;  5JTY B;  3TUS A;  4QXD A;  3H3G A;  5AA4 B;  3B6T A;  1LGB C;  2RIN A;  4Q0C A;  4ZEI A;  2XXR A;  2Y5L A;  3MQ9 A;  2I6E A;  1LAH E;  2XXV A;  4QFO A;  3U93 A;  2THI A;  1MPD A;  4OER A;  5DTB A;  3JYR A;  1QGX A;  4OXV A;  5L9M A;  2Y84 A;  1NV7 A;  1NV4 A;  3CSG A;  4POW A;  2I48 A;  1I6A A;  2V25 A;  4O3B A;  1LFG A;  2Q88 A;  4N8Y A;  2XXP A;  4IO5 A;  3B50 A;  4WEP A;  1AH5 A;  3FXR A;  2DXY A;  4GF8 A;  4QHQ A;  1SBP A;  2XXX A;  2PVU A;  4OHN A;  4BDQ A;  4X48 A;  5I57 B;  4BDM A;  4FBP A;  2ZZW A;  3M3L A;  1T0K A;  1IME A;  3O28 A;  2GH9 A;  2ZZV A;  1M5B A;  1BKA A;  4DI4 B;  3G3H A;  2L5V A;  2KLF A;  1YCJ A;  1ZJL A;  1GVC A;  4ISU A;  4P3L A;  3K6W A;  4RA1 A;  2NOO A;  3SES A;  2QS4 A;  1NMU A;  1AL3 A;  1YYZ A;  1ZU0 A;  3FGS A;  1SW4 A;  5AA2 A;  4ZEK A;  3OEL A;  1R6Z A;  3TCG A;  1ZKB A;  3IR1 A;  4O7I A;  3IL1 B;  2QSX A;  1DPP A;  1NH8 A;  3HN0 A;  1NNF A;  3CRB A;  1UTB B;  2ZXT A;  4F3G A;  5EHM A;  3FV2 A;  3IB1 A;  2D3I A;  3WAF A;  3GBA A;  1IMA A;  3IAZ A;  3R7X A;  4GBW A;  1Z7M E;  2GHB A;  2ONR A;  2DDK A;  2WBB A;  1XOC A;  1D9Q A;  4NGU A;  1FPL A;  4N81 A;  4DXB A;  1B7U A;  4X1B A;  3BFU A;  1LBZ A;  2H4I A;  2B4M A;  3Q26 A;  4PE5 B;  1UTH B;  3U72 A;  1B5J A;  5TPA A;  3VXB A;  4OEU A;  1US5 A;  3MPL A;  4U23 A;  3M3F A;  3QAX A;  4P0G A;  4PE3 A;  1RDY A;  4EXK A;  1MH3 A;  4P0I A;  3IB2 A;  3SDF A;  3PPO A;  1H43 A;  3V8X B;  3LC8 A;  2Q74 A;  5BUU A;  3VDF A;  4F1Y A;  5H8S A;  4ESX A;  1LEV A;  3HHG A;  5ET6 A;  3SER A;  2RCA A;  3C9H A;  4LUB A;  5AE4 A;  1B3L A;  3MP1 A;  3PUX E;  2Z8D A;  1KA1 A;  1A54 A;  3N26 A;  5JEI A;  4NE4 A;  2XX9 A;  3ILT B;  2ONK E;  2R9J A;  5CRY A;  4I62 A;  1A8E A;  5CMM A;  3O6G A;  2QJE A;  1NNT A;  1PEB A;  5EQ7 A;  2ZZX A;  1B4Z A;  1XC1 A;  3FJM A;  3IX1 A;  4THI A;  4DCX A;  2XWI A;  4XKQ A;  4NF4 B;  1B6H A;  4NF5 B;  2HZK A;  5EYF A;  3PUY E;  3MUQ A;  3FBP A;  1MXU A;  4RXL A;  1NNP A;  3IOT A;  2WYP A;  4JDF A;  1LFI A;  2P3N A;  1FQE A;  1NI9 A;  2Z22 A;  4F22 A;  1Y20 A;  4QRZ A;  2F3D A;  4PTK A;  5FHN A;  4EQ9 A;  3KBZ A;  5A5X A;  3OD7 A;  5H8N A;  4NWC A;  5HPQ A;  3GXA A;  4I40 A;  5T3J A;  1O64 A;  4PDD A;  5B7D A;  2QMX A;  4DZ1 A;  2QMW A;  5ICT A;  4ZEC A;  3SEU A;  4YKP A;  3PUW E;  3H6U A;  3MZ1 A;  2VD2 A;  5HM4 B;  4GWZ A;  2Q8M A;  5IZ3 B;  5EQ9 A;  1DTZ A;  4C1T A;  4PAI A;  1JNF A;  2REJ A;  4BDL A;  4ZS9 A;  3RY3 A;  1ZBM A;  4U1O A;  1RYX A;  1MQD A;  3Q28 A;  4F29 A;  1JW5 A;  3PV0 E;  2O6A A;  3KN3 A;  2O7U A;  1S9T A;  4MCO A;  3FD3 A;  3TAJ A;  1NUY A;  3D4C A;  1SW5 A;  1N3W A;  1PBP A;  2ONS A;  2DE4 A;  2PFY A;  5IZ1 A;  1J1N A;  2DSF A;  1PB9 A;  4EF2 A;  4QBA A;  5FBP A;  1I6B A;  2FVZ A;  3B8B A;  4NF6 B;  1M5F A;  2PYY A;  4PCD A;  4KPT A;  4GIZ A;  4OFO A;  4QFN A;  2DWI A;  4LP2 B;  4XFE A;  3K4U A;  3VVD A;  1MDP 1;  3B7D A;  3QUJ A;  4FJP A;  3ZKK A;  5FHO A;  1JVX A;  3HCQ A;  1PC3 A;  3GZG A;  3K00 A;  4C0R A;  2XD2 A;  3MVY A;  3PU5 A;  4OFJ A;  1MY3 A;  5DVJ A;  1LCT A;  4MNI A;  3T22 A;  1Q1K A;  5AA1 A;  3RLF E;  1ZIU A;  3RTW B;  1H44 A;  3T0J A;  3VVE A;  4R72 A;  2HAV A;  3UN6 A;  1A99 A;  1B5H A;  3SEX A;  3CI8 A;  1IXH A;  3EQ1 A;  1ZMG A;  4EQ7 A;  2Q2C A;  3OO8 A;  4AS5 A;  4PAF A;  1PB8 A;  4HW8 A;  2G93 A;  3Q29 A;  3VLU A;  1IUD A;  3QYT A;  1MXV A;  3RPL A;  1MQG A;  1AIV A;  4TLM B;  1LAF E;  4KR5 A;  3OO6 A;  3RUM A;  2DQV A;  2VPN A;  3LUZ A;  5I56 A;  2H5Y A;  3MBP A;  3ZKL A;  1JET A;  4NWD A;  1URG A;  2XXW A;  4G68 C;  3H6W A;  4NAP A;  1FJ6 A;  2DYX A;  4H5F A;  3TCH A;  2Z23 A;  3UIF A;  4GWW A;  4MHF A;  3G3K A;  3K6U A;  2NUV A;  4NX1 A;  1KWH A;  3OO7 A;  4UAC A;  4MEV A;  2X7Q A;  4IB2 A;  1SI0 A;  2HEU A;  3SET A;  3GYY A;  3NOH A;  3O9P A;  4H0W A;  4F19 A;  2XX8 A;  1FBC A;  2V3T A;  3ROJ A;  4MJO A;  1ELJ A;  3KJ7 A;  2WX9 A;  1FBG A;  1B51 A;  3O29 A;  1QUL A;  2PCR A;  3E3K A;  4N17 A;  5I3S A;  4JVD A;  1NL5 A;  3TTK A;  2DE3 A;  4N07 A;  3FVN A;  1IIW A;  2OK2 A;  1K9Z A;  1SD3 A;  2I58 A;  3KN8 A;  4OVS A;  1LB8 A;  2KR0 A;  4JBZ A;  5EYG A;  3AXF A;  4N15 A;  3PMV A;  3GBB A;  2CZK A;  3HPI A;  4RK9 A;  1UIU A;  3E4R A;  4GWU A;  3RPL B;  1EYI A;  3TTM A;  5AA4 A;  5CC2 A;  1FPF A;  1NV5 A;  1OLC A;  2F5X A;  3ILU B;  5TU0 A;  1S50 A;  5H8F B;  4ZZE A;  4XTC Q;  1NUX A;  5H8Q B;  4OVR A;  4IO2 A;  1FQC A;  2RC8 A;  3RNN A;  5H8H A;  2I4C A;  3VVF A;  2FHY A;  4NG7 A;  1NFT A;  4JWO A;  2XHD A;  4MX6 A;  2B3F A;  5A5L A;  3PD8 A;  1PDA A;  1IMC A;  4NED A;  2OWS A;  2CZI A;  2FIE A;  1NUZ A;  1TFD A;  3MPK A;  4X8R A;  2PT2 A;  5I57 A;  4ZEF A;  2M8C A;  1TFA A;  4Q8R A;  5LOM A;  5IKB A;  4ELP A;  3EF7 A;  3TTR A;  2REG A;  4LZ5 A;  4P11 A;  1GTK A;  4GWX A;  4BDN A;  4LVQ A;  1UQW A;  3T96 B;  1FTL A;  3DLN A;  3OEK A;  1DBZ A;  1VDW A;  4U2R A;  4H46 A;  4Z7E A;  2Y7W A;  4NF8 B;  3CFL A;  4O94 A;  4TQU Q;  2Z8F A;  2VP1 A;  3FVG A;  5HBC A;  1JQF A;  4JWX A;  3MC2 A;  1FTM A;  3BBR A;  1UTB A;  4N6D A;  1IMF A;  1Y1M A;  5ET8 A;  1Z7N E;  1EYK A;  3PGF A;  2DVZ A;  2RKM A;  4XIG Q;  3RQT A;  3B6Q A;  2UYF A;  3H6T A;  3USD A;  1B58 A;  2IA4 A;  1FBH A;  4OEN A;  4NQ8 A;  3U1O A;  3G7W A;  4N6K A;  1UTH A;  5H8H B;  5I58 B;  4F1V A;  1QVS A;  2ZYO A;  1NUW A;  4JWY A;  4YU0 A;  2ESN A;  3FXB A;  4KYD A;  4KCD A;  4ONY A;  3IOR A;  1Y3P A;  3OO9 A;  2R71 A;  3EHS A;  4JSO A;  2OCU A;  4OVP A;  4LZ8 A;  4YB7 A;  3RT8 A;  4R73 A;  2XXK A;  4BDR A;  3KSJ A;  2CMO A;  1MG1 A;  2I0C A;  2RF1 A;  4NN3 A;  2E0S A;  2KQZ A;  4DXU A;  1IMB A;  3FJ7 A;  4QFL A;  2AIX A;  2VPO A;  1JVY A;  1DTG A;  1JEU A;  1M5E A;  4KD5 A;  4L17 A;  3TEL A;  4IGR A;  4OYV A;  3O2A A;  4GLI A;  2O68 A;  5CMB A;  5DEX B;  3JZJ A;  2DWA A;  4PFU A;  1VFD A;  1Y4T A;  2DOJ A;  2BJI A;  3TEP A;  2CZL A;  4G77 A;  4NF4 A;  4NF5 A;  1YZ0 A;  2XXU A;  2HXW A;  2YLN A;  1DSN A;  2FA7 A;  2I3V A;  5EQA A;  4ND9 A;  4C1U A;  5FHM A;  4F2O A;  4PAK A;  3TPA A;  3UP9 A;  5J1D A;  2XXI A;  4R9F A;  4PFT A;  4TOZ A;  1R9L A;  3OMB A;  3E9X A;  4IO6 A;  3EPE A;  1P1O A;  4BDO A;  1MY0 A;  5L9S A;  1FPE A;  4PFR A;  4F3B A;  2XX7 A;  3K1P A;  4RPO A;  4ZEB A;  2NXO A;  4P1E A;  4GWY A;  1HSL A;  4YKK A;  1USY E;  3H06 B;  1AOV A;  5M2V A;  1I6Q A;  3KC0 A;  3K01 A;  5IZ3 A;  1DMB A;  4O8M A;  3FVO A;  4IGT A;  3DP4 A;  1B3E A;  3MVZ A;  4ELO A;  3OSQ A;  3G3G A;  3UOR A;  2PMS A;  3EHT A;  2R6G E;  3BKI B;  1B1H A;  3EHU A;  3V89 B;  2OZZ A;  1A7L A;  1Q35 A;  5ITP A;  1JEV A;  1B9J A;  5F1Q A;  1VFE A;  2OBG A;  4PBQ A;  3C36 A;  1FW0 A;  2F8D A;  1QUK A;  1Y9U A;  2WBD A;  3PPQ A;  2F7C A;  1SQY A;  2D21 A;  4FIM A;  2ZNT A;  3MP6 A;  3QUF A;  2P2A A;  2XXQ A;  4P8B A;  5ICQ A;  3R26 A;  4PFB A;  5ESY A;  1OVB A;  1VR5 A;  4JSD A;  2RC9 A;  2XXH A;  1IQ7 A;  3G3J A;  2GHA A;  4NF6 A;  4OTE A;  3Q25 A;  4UA8 A;  4OVJ A;  1H45 A;  3L6H A;  4F2Q A;  4QF9 A;  1FPI A;  1PBQ A;  4AB5 A;  2UVI A;  4HTG A;  1FPB A;  1ZLQ A;  2HQ0 A;  1KZ8 A;  3TYH A;  3N6U A;  3T66 A;  2XWK A;  1A8F A;  1MM6 A;  1MRP A;  4KYS A;  5ITO A;  2FIX A;  1YTV A;  4MLQ A;  1Y3Q A;  3R6U A;  4IR8 A;  2VOZ A;  1CB6 A;  2DWH A;  1FTJ A;  4H8I A;  4HCW A;  3RPW A;  3SKP A;  1M5D A;  4HE1 A;  3N5L A;  1MXZ A;  4LN5 A;  1EZO A;  3E13 X;  5I2N B;  2IEE A;  4GVO A;  3LUY A;  4KHZ E;  2H99 A;  3V83 A;  5ISU A;  1POT A;  3O6H A;  2XXT A;  1H76 A;  5KCJ B;  1IMD A;  4OVT A;  4G8N A;  1D3K A;  1TT1 A;  2VHA A;  1S7Y A;  4EQB A;  3MW0 A;  1LBX A;  4H45 A;  5CBR A;  1IEJ A;  3TMG A;  2X26 A;  1QW0 A;  3HST A;  3OOA A;  4QSC A;  4F1U A;  3EN3 A;  4MFI A;  3A3U A;  3FXQ A;  4PGN A;  1DPE A;  3KZG A;  3K0V A;  1N0T A;  5CM6 A;  4JB7 A;  3I5O A;  4G8H A;  2Y7R A;  3IK6 B;  2H98 A;  4FAJ A;  1DK4 A;  3CG3 A;  3QIM A;  4G68 B;  2UVG A;  3CR9 A;  4H65 A;  1FQD A;  4OA4 A;  5KDT B;  1P1N A;  2Q9T A;  4GWO A;  5CI5 A;  1H3D A;  1XHY A;  4LA9 A;  3SZP A;  4MLV A;  1IXI A;  3RGY A;  2QVU A;  1JW1 A;  2F6P A;  4YIC A;  2ZYM A;  1SDX A;  1BLF A;  4GFR A;  3TOD A;  3W15 C;  3L6G A;  1N76 A;  2PBW A;  4ZED A;  3MYU A;  3D4G A;  2FBP A;  3O6I A;  3S4U A;  3K6X A;  3KSX A;  2HPG A;  3T1B A;  2F6G A;  4OZ9 A;  4WED A;  5H8F A;  2X7P A;  4OWD A;  3C31 A;  3IOW A;  5H8Q A;  4X1D A;  2OJT A;  3QK6 A;  2QVR A;  4HS7 A;  3PPR A;  4TLL B;  3D1R A;  3CFX A;  4HE2 A;  3U65 A;  1IZ1 A;  1O63 A;  4OES A;  3FUZ A;  3C34 A;  3KOS A;  3QXM A;  3PMX A;  5CMC A;  4YKJ A;  4N6P A;  2P3V A;  4GL0 A;  4OAN A;  2PFZ A;  2GFE A;  3HFU A;  1A55 A;  2Q8J A;  4O3C A;  1LBY A;  2ZMB A;  4F31 B;  4I3Y A;  3EKI A;  1CE2 A;  4POX A;  1AWB A;  2UVH A;  4OEV A;  2A5T B;  4P1L A;  4U4S A;  3B6W A;  3QSL A;  1MM7 A;  3M8U A;  4DE8 A;  2UXA A;  3UK4 A;  4R2B A;  2P1S A;  3K02 A;  4EUO A;  1QJM A;  4GRK A;  2H25 A;  2I4B A;  1POY 1;  4RNS A;  4NF8 A;  1FBE A;  3GLB A;  3T9H B;  5TP9 B;  2O69 A;  2OWZ A;  2E1S A;  4LAT A;  1Q9D A;  3OSR A;  5EHS A;  3MP8 A;  1K9Y A;  1AMF A;  3MVX A;  1FTK A;  3MVW A;  3TTN A;  4KI0 E;  1Y3N A;  3KFM A;  4OMB A;  3FAS A;  1Y1Z A;  4JVI A;  4IO4 A;  4I3E A;  3G3F A;  5DVF A;  2WYK A;  2XA5 A;  3LBS A;  4KCC A;  1ATG A;  3IO4 A;  2ABH A;  5I58 A;  3PUV E;  1INP A;  1FBD A;  1FBF A;  2VT5 A;  3T9V A;  3ZS6 A;  1MPC A;  3H6V A;  1NV6 A;  4RK2 A;  4ELR A;  1XS5 A;  4FE8 A;  4KYE A;  3W9V A;  3LSL A;  4PFW A;  1HSJ A;  2QS3 A;  2I3W A;  3UGW A;  1GV8 A;  2YPN A;  4GX3 A;  4XF5 A;  4RYA A;  3PPP A;  3KGC A;  3FXU A;  1RKM A;  3KBR A;  1B3G A;  1EYJ A;  1MY2 A;  1R9Q A;  3T9U A;  2PX1 A;  3K2D A;  1MQJ A;  1XT8 A;  1URD A;  1OQG A;  4H5G A;  3SEY A;  1EH3 A;  4IO3 A;  1MXW A;  1LAX A;  2FNC A;  2OLB A;  5CMK A;  3IOV A;  4EF1 A;  1B4H A;  2Q89 A;  5DEX A;  2D5W A;  1US4 A;  4N91 A;  1IXC A;  4I1D A;  1D9Y A;  5BWJ A;  3ISP A;  3RN8 A;  4P56 A;  4R2F A;  2UYE A;  4H1X A;  1LLS A;  4G4P A;  4MH5 A;  2Y7P A;  2H9B A;  5AA2 D;  2F3B A;  4N13 A;  1XI6 A;  2QVV A;  2XWV A;  5CBS A;  4FEC A;  2AL5 A;  3IOU A;  1QUI A;  5K2Y A;  4PF8 A;  2ANJ A;  3TTL A;  4H6D A;  1SI1 A;  1B7H A;  4PC9 A;  3S9E A;  3A3C A;  1MQI A;  3ONM A;  3KC1 A;  2ZNS A;  5B70 A;  3TQL A;  2HHM A;  3ECR A;  1BP5 A;  3S9N C;  1OLA A;  1SW1 A;  1G0I A;  4MNP A;  1FTA A;  1QKA A;  1P1Q A;  4WKM A;  1FPD A;  1FRP A;  1N7W A;  4DDD A;  1B2H A;  4PP0 A;  3LR1 A;  4MBP A;  1N84 A;  1WVJ A;  1LBC A;  1UIV A;  1YXI A;  4JXI A;  3CVG A;  1LAG E;  1B3F A;  3JV9 A;  1B0L A;  4K3F A;  4IO7 A;  4LZ7 A;  1YPN A;  1DCU A;  2CEY A;  4ZZA A;  2O84 X;  2OWT A;  2RCB A;  4GL8 A;  4ELQ A;  4M4G A;  4F18 A;  4AQ4 A;  3RYD A;  4DI3 D;  4GX6 A;  1FSA A;  2O1L A;  3MJN A;  4R6Y A;  5FTI A;  2F7B A;  1BIY A;  2CZH A;  1FJ9 A;  1RDZ A;  1NV0 A;  1MH4 A;  1YAE A;  4YKI A;  2WEF A;  1B0H A;  2HZL A;  4F3S A;  3PTY A;  5EQ8 A;  4QFP A;  1NH7 A;  2F34 A;  4F39 A;  4GBV A;  2F97 A;  4LQ5 A;  3LSW A;  2HCA A;  5ET7 A;  2FYI A;  3IFA A;  1DOT A;  1B05 A;  4E0X A;  1D4N A;  2O7I A;  2V84 A;  2F35 A;  2DS9 A;  3C35 A;  3MAM A;  1Y4C A;  1SYI A;  3WAE A;  1M5C A;  4BLA A;  4NHB A;  5L9O A;  2Y7K A;  4GWS A;  5EYH A;  1KA0 A;  2UVJ A;  4R74 A;  3C32 A;  2JJK A;  1G0H A;  3G3I A;  3T9X B;  2Z8E A;  1N04 A;  1SVX B;  1MPB A;  1MXY A;  1SPI A;  1N7X A;  5I2K A;  4YAH X;  5FTH A;  4GOT A;  4G8M A;  4YZZ A;  2QL3 A;  2YJP A;  4OFL A;  2V93 A;  1NV2 A;  3KEI A;  5I2N A;  1FPG A;  5LDZ A;  2PT1 A;  3I6V A;  3MZB A;  2MKZ A;  5LTC A;  4NF0 A;  5K2X A;  1GR2 A;  2B4L A;  3E79 A;  4R6K A;  4GD5 A;  5KCJ A;  3Q27 A;  2O1M A;  5AA2 B;  2I49 A;  3H4Z A;  3W9W A;  4FOR A;  3BIH A;  4GXA A;  4XXU A;  3TFL A;  2DP8 A;  1II5 A;  4O7M A;  4YMA A;  5IAI A;  1TXF A;  2XXY A;  1FQB A;  4R75 A;  4HE0 A;  3PPN A;  2Y7I A;  4GQO A;  2W7Y A;  4WXJ A;  3BIG A;  4U4X A;  2Q2A A;  4LON B;  3K6V A;  3P7I A;  5DYH A;  1TWY A;  2V3Q A;  5F7V A;  4MNC A;  4G68 A;  4QSD A;  5DT6 A;  1MS7 A;  2AL4 A;  1B52 A;  5TPA B;  1O7T A;  4NMY A;  5KDT A;  1I69 A;  1XVY A;  4MIJ A;  4Z0I A;  2XWO A;  3CSB A;  4I8C A;  3RTF B;  2DXR A;  5I2K B;  3U92 A;  3U8Q A;  1F9B A;  2CEX A;  1EZP A;  4KFQ A;  4U21 A;  4KQP A;  3VLV A;  2VD3 A;  3HV1 A;  3PD9 A;  4PBH A;  1LB9 A;  4XKN A;  4G61 A;  1D9V A;  5I84 A;  4QFK A;  3FZV A;  3O97 A;  2WKY A;  2OPD A;  1FPJ A;  4PFI A;  4QSE A;  1N3X A;  2RC7 A;  5IZZ A;  5I5P A;  4GXS B;  1GGG A;  4UAB A;  4OET A;  1NNK A;  1IXG A;  3K1M A;  1XVX A;  3PUZ E;  3PMW A;  1JW4 A;  3S2V A;  4O3A A;  3N94 A;  2QRY A;  3TQW A;  3UA8 A;  3CHG A;  4ESW A;  5JK4 A;  4IY6 A;  3O66 A;  3F11 A;  4ECF A;  1MXX A;  4N4U A;  4XEQ A;  1A40 A;  4KXP A;  1L5T A;  1NV1 A;  1B3H A;  3MZ9 A;  1PB7 A;  1FQF A;  4PFY A;  3LV0 A;  3TDJ A;  3FV1 A;  1RYO A;  2A5T A;  1IIT A;  3DP8 A;  5A5X B;  5H8N B;  2QS2 A;  3IB0 A;  3C33 A;  4I9D A;  3S9L C;  4G2Z A;  2ZYN A;  3S9M C;  3SEW A;  1FPK A;  1P1W A;  3QMF A;  1URS A;  3MWB A;  1MDQ A;  4U22 A;  3N6T A;  2AYS A;  5TP9 A;  3T93 B;  2VGQ A;  3MST A;  4PGP A;  4YB6 A;  4HCY A;  2R8T A;  4MAG A;  1LCF A;  1B40 A;  3TCF A;  4XKR A;  3LSF B;  1B46 A;  3CFZ A;  1R1N A;  3VFJ A;  2NVU B;  4RJZ A;  4PDH A;  3VXC A;  3K1N A;  1RDX A;  4YMB A;  2DWJ A;  2QS1 A;  1BTJ A;  3DM0 A; 
#chains in the Genus database with same CATH homology
 2Q8M A;  5IZ3 B;  5EQ9 A;  4PAK A;  5J1D A;  4GWZ A;  4PET A;  4PAI A;  4N91 A;  5IM2 A;  5IGA A;  1FPE A;  4PFR A;  3ISP A;  4P1E A;  4P56 A;  4GWY A;  1CNQ A;  4MCO A;  4N8G A;  4P9K A;  2F3B A;  3KC0 A;  1XI6 A;  1NUY A;  2QVV A;  2XWV A;  5IZ3 A;  4O8M A;  2DE4 A;  2PFY A;  4OVQ A;  4PF8 A;  5IZ1 A;  1NV3 A;  4PC9 A;  1FBP A;  2QPQ A;  4QBA A;  5FBP A;  2DE2 A;  1LBV A;  3KC1 A;  4PBQ A;  2FVZ A;  2HHM A;  3B8B A;  4M1V A;  4HXV A;  4PCD A;  2WBD A;  1G0I A;  4MNP A;  1FTA A;  1FPD A;  1FRP A;  4XFE A;  4P8B A;  1YXI A;  4PFB A;  1JP4 A;  5ESY A;  4MNI A;  4X04 A;  2HXR A;  5J16 A;  1DCU A;  2CEY A;  3T0J A;  4F18 A;  3IFC A;  3RYD A;  4DI3 D;  4GX6 A;  1FSA A;  1BK4 A;  1FPI A;  2GQ1 A;  5DW8 A;  3E78 A;  1FPB A;  4AS4 A;  4AS5 A;  4PAF A;  1KZ8 A;  2QFL A;  2XWK A;  4PF6 A;  5ET5 A;  2Y5K A;  3RPL A;  2CZH A;  1FJ9 A;  1RDZ A;  1NV0 A;  2FIX A;  4P47 A;  2VPN A;  3LUZ A;  2WEF A;  2HZL A;  3PTY A;  5EQ8 A;  4GX4 A;  4IR8 A;  4JVC A;  4GBV A;  4NAP A;  1FJ6 A;  5ET7 A;  3IFA A;  4HCW A;  4GWW A;  4MHF A;  5I7I A;  1LBW A;  4NX1 A;  2V4C A;  4HE1 A;  4LN5 A;  4NHB A;  2OX3 A;  4MEV A;  4GWS A;  3A29 A;  5EYH A;  1KA0 A;  2JJK A;  4OVT A;  1IMD A;  1G0H A;  3GYY A;  3NOH A;  4MMP A;  4X9T A;  4F19 A;  1FBC A;  5F24 A;  3ROJ A;  4MJO A;  1SPI A;  2WX9 A;  1FBG A;  4QXD A;  1LBX A;  4H45 A;  2PCR A;  4YZZ A;  4N17 A;  5I3S A;  1NV2 A;  2Y5L A;  4JVD A;  1FPG A;  4F1U A;  5LDZ A;  2DE3 A;  1K9Z A;  2MKZ A;  1QGX A;  4PGN A;  4OVS A;  5CM6 A;  1NV7 A;  2KR0 A;  4NF0 A;  5LTC A;  2B4L A;  3E79 A;  1NV4 A;  5EYG A;  4N15 A;  2CZK A;  1DK4 A;  3W9W A;  3BIH A;  4N8Y A;  4OA4 A;  4GWU A;  3RPL B;  3B50 A;  1EYI A;  1FPF A;  2Q9T A;  1NV5 A;  2F5X A;  4O7M A;  4FBP A;  2ZZW A;  3SZP A;  1IME A;  1NUX A;  2ZZV A;  4DI4 B;  2QVU A;  4HE0 A;  4OVR A;  4YIC A;  3BIG A;  2L5V A;  2FHY A;  4NG7 A;  4P3L A;  4MX6 A;  2V3Q A;  5A5L A;  1YYZ A;  1IMC A;  4MNC A;  3MYU A;  2CZI A;  2FBP A;  4O7I A;  2FIE A;  1NUZ A;  2HPG A;  4X8R A;  3T1B A;  4MIJ A;  2XWO A;  2QVR A;  1IMA A;  3D1R A;  4HE2 A;  4GBW A;  3U65 A;  4GWX A;  2DDK A;  2CEX A;  2WBB A;  1D9Q A;  1FPL A;  4N81 A;  4NGU A;  1DBZ A;  1VDW A;  4PBH A;  4G61 A;  2P3V A;  1LBZ A;  4H46 A;  4OAN A;  2PFZ A;  2B4M A;  3HFU A;  1FPJ A;  4PFI A;  5IZZ A;  5I5P A;  1LBY A;  4O94 A;  4UAB A;  4I3Y A;  3EKI A;  4N6D A;  1AWB A;  4PE3 A;  1RDY A;  1IMF A;  4P1L A;  5ET8 A;  1EYK A;  2DVZ A;  2Q74 A;  3CHG A;  5JK4 A;  1LEV A;  1FBH A;  4N4U A;  5ET6 A;  4XEQ A;  4NQ8 A;  4KXP A;  4N6K A;  1FBE A;  4F1V A;  1KA1 A;  1NV1 A;  1NUW A;  2OWZ A;  3FXB A;  3LV0 A;  1Q9D A;  1K9Y A;  4OVP A;  2XXK A;  5EQ7 A;  4JVI A;  4I3E A;  2ZZX A;  2XWI A;  4NN3 A;  2KQZ A;  2WYK A;  2XA5 A;  2HZK A;  1IMB A;  3FBP A;  2VPO A;  1FPK A;  3QMF A;  1INP A;  1FBD A;  1FBF A;  2VT5 A;  2WYP A;  1NV6 A;  2P3N A;  1NI9 A;  3MST A;  4PGP A;  4HCY A;  3W9V A;  2R8T A;  4MAG A;  2F3D A;  4PTK A;  3KBZ A;  4GX3 A;  2BJI A;  4XF5 A;  4PDH A;  4I40 A;  5T3J A;  4PDD A;  1RDX A;  1YZ0 A;  1EYJ A;  5EQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...