4AS5A

Structure of mouse inositol monophosphatase 1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
274
Chain Sequence
DPWQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVAAGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKLCSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKEIEIIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE 1
publication title Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
pubmed doi rcsb
source organism Mus musculus
total genus 92
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4as5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4as5A02
2QVVA 5T3JA 1LBYA 4G61A 2WEFA 1DCUA 4AS4A 1JP4A 4H45A 1NV6A 3BIGA 4I3YA 4I40A 2FIXA 1LBVA 4H46A 1FBCA 4PTKA 1DK4A 2OWZA 2F3DA 5EQ9A 3IFAA 1Q9DA 1NV3A 4GWYA 2CZHA 1NUZA 2QVRA 2WBDA 1IMEA 1RDXA 4HE2A 2DDKA 3QMFA 5IZ1A 1D9QA 1FRPA 1EYIA 1IMCA 1G0HA 1YXIA 5EQAA 1FPDA 1XI6A 1VDWA 1FPBA 4GWZA 1AWBA 1KA0A 3IFCA 1G0IA 1FBDA 1FPKA 1NUXA 1IMBA 1FPLA 2HHMA 5F24A 4HXVA 1SPIA 5IZ3B 1IMDA 3RPLA 3ROJA 4GWUA 2Q74A 1FBGA 2Y5LA 1QGXA 3FBPA 4GX4A 4IR8A 1INPA 2P3VA 4KXPA 4MJOA 1NV7A 5EQ7A 5J16A 4GWXA 1FPEA 1NV0A 1NUYA 1YYZA 1RDZA 2F3BA 1CNQA 3RYDA 4HE0A 1YZ0A 1FBFA 1FJ6A 5I3SA 5ET7A 5EYHA 1LBWA 2P3NA 4QXDA 4FBPA 2R8TA 3BIHA 2QVUA 5DW8A 1IMAA 5A5LA 1NV1A 2WBBA 5EYGA 2CZKA 1BK4A 2FHYA 2JJKA 2OX3A 1K9ZA 3B8BA 1LEVA 1IMFA 2GQ1A 4GX6A 4O7IA 4GX3A 1RDYA 5ET6A 1FJ9A 4AS5A 1EYKA 1FBPA 3LUZA 1DBZA 1FBHA 4GBVA 1NI9A 2BJIA 2CZIA 2FBPA 1FPFA 2FIEA 1KZ8A 2QFLA 2Q8MA 3LV0A 4GWSA 1FBEA 1FPJA 5FBPA 1KA1A 2PCRA 1EYJA 3KC0A 5ET8A 5EQ8A 3KBZA 4GBWA 2VT5A 4GWWA 4N81A 1NV2A 2Y5KA 1NV4A 3A29A 5IZ3A 2FVZA 1FPIA 1FTAA 5ET5A 3RPLB 5LDZA 1LBZA 1LBXA 3D1RA 5ESYA 4HE1A 1NUWA 1K9YA 3T0JA 3KC1A 1FPGA 1FSAA 1NV5A 4I3EA
chains in the Genus database with same CATH superfamily
3CI8A 2ESNA 4ELQA 1TFDA 4KCCA 3TPAA 1N7WA 2ZNTA 1NKXA 3PD9A 1NV6A 3PGFA 4ZECA 5CMCA 5DTBA 1NNFA 1DK4A 1B1XA 2XXVA 4N6PA 2Z22A 3IR1A 4GXAA 2AYSA 1Q9DA 3E9XA 4P3LA 1A40A 5A5XA 4OVTA 4LONB 3O97A 1IMCA 1O64A 3IL1B 3FV2A 5EQAA 3MC2A 3UP9A 2XD2A 4G8MA 1P1UA 4R9GA 4N8YA 5K2XA 1PB9A 1II5A 1QGXA 5AA2D 4WEPA 3SESA 1MG1A 5EQ7A 1NV0A 4C0RA 1LAGE 2F8DA 2XWKA 1DOTA 4GQOA 1SW2A 4IO2A 3TQLA 2I3WA 4DXCA 4AB5A 3PMXA 4K3FA 5TPAA 3L6GA 4JWXA 4G8HA 2HZLA 2ANJA 1A7LA 3HV1A 4UACA 4MNIA 2L5VA 5CBSA 3A3UA 4FEDA 5H8FB 3KC0A 5EQ8A 1ATGA 3KBZA 2PX1A 3I5OA 1NV2A 1USYH 2HAUA 5IGAA 5AA2B 1SBPA 1LBXA 4HE1A 4OVRA 4O3AA 3KG2A 1EZ9A 2HEUA 1FPGA 3U8QA 2OCUA 4YKPA 1FQEA 5TP9B 3IORA 3A3CA 3TMGA 1ZU0A 3OO6A 4I3YA 4LN5A 3CFXA 4EQ9A 4NE4A 3GBBA 2R6GE 5F1QA 3OEMA 2RINA 2REGA 4QSCA 2WBDA 1YCJA 2XXYA 3W15C 4P9KA 1Y3NA 3H06B 4R2BA 4NX1A 4ZDMA 1IXGA 1JW5A 5DVJA 4BDQA 1FW0A 3K1MA 2Y7KA 1QUIA 1IMDA 5L8DA 3MP6A 4X1BA 1RDZA 3HSTA 4H8IA 3EF7A 3GBAA 5I58B 3RLFE 2UVHA 1IIWA 3E4RA 1OVBA 2GH9A 3M3KA 4NGUA 2QS3A 5A5LA 2WBBA 1BK4A 2O84X 3DM0A 2DVCA 1MPBA 3RY3A 2CZIA 4OENA 2DE4A 1H45A 3IB0A 5FBPA 3Q27A 3VVFA 2X7PA 4U4XA 1S9TA 1B46A 4QFOA 3MVXA 3TQWA 2Y5KA 1UTBA 4U23A 2Y7PA 1NNKA 1HSJA 4R9FA 5I2KA 1K9YA 2WYPA 4GIZA 1R9LA 2G29A 2QVVA 2F35A 1NNTA 4YAHX 3RUMA 4DXUA 4DXBA 1B6HA 3E13X 4WXJA 3MUQA 4N8GA 1MY0A 3FXUA 3T93B 2CMOA 1SD3A 5CM6A 1G0HA 3SETA 2FNCA 4LQ5A 3KSJA 4FIMA 4ESXA 1NL5A 1XHYA 4XFEA 4H5FA 5IM2A 1DTGA 4MMPA 1B7ZA 3HFUA 3MPLA 2D3IA 5H8NA 2DWAA 1H3DA 1YYZA 3B6QA 2Y7RA 3JV9A 5L9MA 1FJ6A 1SW5A 3OSQA 3CSBA 1LAXA 2IA4A 2R8TA 3BIHA 1QKAA 3C32A 4KCDA 1NV1A 5EYGA 5CMKA 4NMYA 1DBZA 5IKBA 4G77A 4YB7A 3TCGA 2RC7A 3LBSA 4BDRA 4PDHA 5J1DA 1MQGA 1N0TA 2B4LA 2H5YA 4XKRA 4F39A 4GRKA 1P1NA 2ONRA 4G68B 1I6QA 4QHQA 4E0XA 2Q8JA 1B3HA 3SDFA 2QPQA 4RJZA 2ZZVA 3FVOA 4PAFA 2XXHA 5FHNA 3CVGA 3PPNA 3VFJA 4OEVA 1LBYA 1EZOA 3K6UA 5ICTA 4XXUA 2OWSA 3VDFA 3FZVA 3IX1A 4N91A 1IXHA 3A09A 2FYIA 1B5IA 3CFZA 2OWZA 1MXVA 4N6KA 2XXPA 2NOOA 3G3IA 3ILTB 3DP6A 4X04A 1JW4A 2YPNA 4R73A 1SI0A 3K01A 1LFGA 3K2DA 3QXMA 4PCDA 3G3JA 4UABA 2R9JA 3FBPA 1SDXA 1LGBC 3V89B 1INPA 4F31B 3IB1A 2BJJX 1FPEA 2O51A 5ELVA 5JK4A 4PBHA 1FBFA 1NMUA 4TOZA 5I57B 3KSXA 1DTZA 2XXQA 1QULA 3OOAA 1MM7A 5I59A 3N26A 4JVIA 4YICA 4FAJA 3B6TA 4ELOA 2GHAA 2E1SA 3G3KA 4PP0A 4ELRA 4M4GA 4NQ8A 4DLDA 1S50A 4QFLA 3PD8A 4ZEDA 2O69A 1EYJA 2OJTA 1IEJA 4GOTA 3MVWA 4EQBA 1N3XA 4GVOA 4FATA 3MW0A 3RGYA 3UORA 2X26A 4LATA 4HS7A 4X48A 4I3EA 3FXRA 4XF5A 1FQAA 3SEVA 4NEDA 5DEXA 3FJMA 4F2OA 1DPPA 4NF6A 1OMPA 3TTLA 2CZHA 3KZGA 1WDNA 1IMEA 4BDOA 4JB7A 4HE2A 4MBPA 3QMFA 3DP8A 1MXXA 1Q35A 4FJPA 1YXIA 1XI6A 4LQ2A 2QS1A 4YB6A 4H6DA 4OMBA 5KCJA 3IK6B 3IOTA 1XVYA 3HCQA 3FXBA 4FE8A 4GX4A 1QVSA 3CSGA 1B32A 5HPQA 2OPEA 3SZPA 1QJMA 2X7QA 4N4UA 1H44A 4OYVA 2CZKA 3M3FA 5K2YA 1FTKA 1JVYA 3B8BA 1XC1A 3CFLA 1MS7A 4MF3A 5EHSA 1Z7NE 4EXLA 4GBVA 3H6WA 3VLUA 2PYYA 2AL5A 4PFUA 1Y9UA 4JVCA 3T9UA 4GBWA 3PV0E 4JWYA 3T1BA 3G3HA 1P1WA 4GWOA 4G4PA 1JW1A 3IOWA 2PMSA 3T96B 4IO7A 2UVGA 3EPEA 4THIA 2I48A 3FJ7A 3RT6B 4WKMA 5EYFA 3PMVA 3USDA 2I4BA 4MLVA 4H1XA 1Q1KA 3B7DA 2NVUB 3FIRA 3D4CA 1NUZA 5I2NB 1MPDA 4OTEA 4X9TA 4OANA 4LVQA 1I6AA 1A8FA 4PQJA 4L17A 4U1OA 4NN3A 1KA0A 3IFCA 4F22A 1UTHA 1MDP1 1F9BA 4WEDA 2V93A 1AOVA 1ZKBA 2XXXA 3Q26A 3RYDA 3PPRA 2VOZA 2F6PA 5CMMA 5H8SA 4LZ5A 3V8XB 4I1DA 2CZLA 2QVUA 4Q0CA 3K02A 2XWIA 5H8QB 4ZZEA 1K9ZA 4U21A 1NH7A 3HPIA 4I9DA 5FHMA 3LUZA 2FBPA 1R6ZA 1Y20A 1FPJA 2PCRA 3N5LA 3CG3A 3N6UA 2DXYA 1Y3PA 1PB7A 4N6DA 4I62A 3ZKLA 3T9HB 1B2HA 1B3LA 2ZZXA 3I6VA 1OVTA 3RPLB 4PFWA 4G8NA 5JTYB 3I3VA 1NUWA 5KDTB 2O7IA 4DCYA 2XX7A 2HZKA 4NF4B 3S4UA 1M5BA 3OMBA 2FIXA 2VD2A 1QUKA 4P11A 3QYTA 2W7YA 3K4UA 4O7MA 3EQ1A 2Q2AA 3K6XA 4KQPA 1NV3A 3B6WA 1IUDA 1MM6A 3TCHA 3ZS6A 4HTGA 4TLLB 4TQUQ 3FVGA 2HFBA 2P1SA 2AL4A 5I56A 5I5PA 3QAXA 4Q8RA 3FD3A 4GF8A 2XWVA 1SW1A 2A5SA 3LC8A 1AWBA 3MBPA 2RC9A 1EH3A 4DIGA 1FPLA 1YAEA 4H0WA 2RKMA 2V3UA 3ROJA 4GWUA 2CEYA 2A5TA 4U4SA 3FGSA 2RC8A 4NF8B 5CC2A 4PAIA 2Z8EA 2NXOA 2ZZWA 5IAIA 3TEPA 4QXDA 1B40A 3M8UA 4DCXA 3GZGA 3CG1A 4YZZA 4OFJA 1MY3A 1PBQA 3VXBA 4GD5A 3ODBA 4C1UA 4O7IA 3R7XA 1L5TA 3FUZA 4IGTA 3SERA 1MY2A 1FBEA 4ND9A 2UXAA 2G93A 4MCOA 3TTNA 2ZMBA 4R6YA 2NWJA 4U22A 2UYFA 2M8CA 1A55A 2QS4A 3B50A 3LSWA 5LOMA 4MIJA 4Q30B 4QFKA 2PT2A 3E3KA 3BIGA 4EUOA 1LBVA 1I69A 4PFIA 1QKBA 3MZ1A 2B4MA 4NF5B 3S9MC 4I8CA 1T0KA 4XKQA 1LBBA 3H03A 3QSLA 4OVJA 4OHNA 3O9PA 2QVRA 4YKIA 4MAGA 1P99A 5IZ1A 3E79A 1SI1A 3QUJA 5H8HA 2NUVA 1GV8A 1D9QA 3PUZE 4R74A 1MY4A 2QMWA 1FPDA 3C31A 5I7IA 4GWZA 2HXWA 1SPIA 5IZ3B 1I6BA 3PUYE 1EU8A 1DSNA 3JZJA 4ECFA 2P3VA 3KEIA 2RF1A 1MXWA 2ZYMA 2XXWA 2LAOA 1LFIA 5I3SA 2QS2A 1LBWA 1RYXA 2DXRA 3MJNA 3O6IA 4OVPA 2OX3A 1B3FA 3U92A 1QW0A 3GYYA 3VXCA 3FATA 2VPOA 4BDMA 1NI9A 1FQCA 4GL0A 2QFLA 1B7HA 1KA1A 4QF9A 4NG7A 4OFLA 1Y1ZA 4RPOA 3PMWA 2B3FA 4PBQA 4LP2B 4PF8A 4OVSA 3A29A 1SW4A 2XXKA 4KYEA 2HPGA 1MY1A 1LB8A 3GXAA 2HAVA 3L6HA 3ONMA 3G7WA 4M1VA 4MFIA 2I3VA 3QUFA 1FSAA 4PFTA 4P0GA 4LUBA 1UIVA 3HHGA 2XX8A 1J1NA 2RCBA 3H6UA 1LCFA 3O66A 3U94A 2V3TA 1US5A 4DZ1A 1Y4TA 1BIYA 1IZ1A 3QK6A 4JXIA 3TUSA 1NFTA 2XXUA 2Z23A 5H8FA 4QFNA 1WVJA 5LTCA 4PE5B 1FPBA 1NUXA 4EF1A 1ELJA 5AA2A 3MZBA 5AA4B 3U1OA 2Y5LA 1LAHE 3VLWA 1JEVA 1M5EA 3THIA 4F19A 4Q5TA 5B7DA 3RTWB 5TP9A 5ET7A 5EHMA 3PPOA 4DI3D 5DVFA 3MVYA 1R1NA 3G3FA 4H65A 1GVCA 3LSXA 3OXNA 3TFLA 2DSFA 2HQ0A 1A54A 3G3GA 3OEKA 2B65A 3V5AA 3Q28A 1JETA 4RXLA 4AS5A 1EYKA 5AA3A 1MDQA 4JBZA 4NHBA 1M5FA 2PFYA 1D9YA 3LUYA 2I4CA 1XVXA 1M5CA 5CI5A 3UN6A 1LSTA 2GFEA 3AXFA 1VSOA 4NWDA 1B05A 4GWWA 1NV4A 4LZ8A 4XTCQ 1A99A 3OD7A 4XEQA 2I0BA 2Q2CA 3TDJA 2DVZA 3TELA 5I58A 2F5XA 4RYAA 4E0WA 1H43A 2F7BA 1DCUA 4H45A 2O7UA 3ZSFA 4I40A 1B5JA 1CB6A 3KN7A 2OPDA 2GHBA 3M3LA 2B3BA 5TPAB 5EQ9A 4MEVA 3RTFB 3H6TA 3FXQA 4MX6A 4RK2A 4OXVA 3C9HA 4DI4B 4XKNA 3BFTA 3C33A 4GFRA 4P56A 3O29A 2V25A 1BP5A 2QSXA 5ITOA 2ZXTA 1B0HA 1FPKA 5FHOA 2R71A 4PETA 4N13A 4FORA 4PDDA 5HBCA 1FBGA 5M2VA 2KR0A 3TTKA 4AQ4A 4HCYA 4ISUA 2XXTA 2ZNSA 3PUXE 3KJTA 4DDDA 1DPEA 2XWOA 3HHFA 4N17A 2KLFA 1TT1A 1B5HA 4OETA 3KOTA 3H4ZA 1POTA 1BLFA 4GXSB 2DE2A 1DMBA 3S2VA 1OLCA 5BUUA 4IO6A 1MQIA 3FVNA 3LV0A 4GWSA 3TYHA 4MH5A 4KPTA 3VV5A 4YB5A 2VT5A 2O1MA 3SEXA 1VFEA 1PB8A 3N94A 1JQFA 1TXFA 1WODA 3TKDA 1N84A 5ESYA 4KYDA 2DWHA 3KC1A 5JEIA 1LAFE 4FEBA 4O94A 3N6TA 4ZE8A 2WEFA 5B70A 3D4GA 1US4A 3BBRA 3RPWA 4Z0IA 4PTKA 1M5DA 4POWA 3FASA 3PPQA 1ZIUA 4GWYA 3MVZA 4RPNA 1D4NA 4R72A 3LSLA 1B4ZA 1IXIA 3UA8A 1MXYA 4PF6A 4ONYA 4ZE9A 1JVXA 4UA8A 3OO7A 3DLNA 4EDPA 1FTLA 4PFBA 4TLMB 2WKYA 4G68A 4PE3A 1UTBB 3C4MA 2HHMA 4YMAA 2OZZA 5ISUA 2QL3A 1S7YA 5I2KB 3O6HA 4MNCA 2F3BA 2DWJA 1PEBA 2ONKE 4F3SA 3OELA 4BLAA 4EXKA 4FBPA 4OWDA 3MPKA 5DW8A 4C1TA 3S9NC 3S9LC 2ZYKA 2GQ1A 3E78A 1RDYA 5ET6A 2V84A 1RKMA 2D5WA 3U93A 3FJGA 4QFPA 1KZ8A 3SKPA 3IAZA 1GR2A 3IJOB 3EN3A 1ZMGA 1PBPA 5LDZA 1FCKA 5L9OA 4LA9A 1O63A 2O68A 4HW8A 1YPNA 1LBCA 5H8NB 3GLBA 4MNPA 5I57A 2XD3A 4P8BA 1ZBMA 4G61A 1ZLQA 2ZYOA 3CHGA 2H9BA 4O8MA 3C36A 1LCTA 4PFYA 4O3CA 3IFAA 2F34A 3O2AA 1MQHA 3FV1A 3TTRA 2WX9A 2DDKA 2DE3A 3OO8A 5DYHA 1FRPA 1GTKA 4KYSA 4ZEFA 2OBGA 4F3BA 2Y84A 1GGGA 4IY6A 1VE4A 3EHUA 5DVIA 3TTMA 2AIXA 2PVUA 4RA1A 2I0CA 2OWTA 4OVQA 4NTLA 2P3NA 2HCAA 2UVIA 5I84A 4LZ7A 4X1DA 3T9VA 1Z7ME 4NWCA 2FHYA 1B1HA 1FTOA 3H6VA 4HCWA 4P1EA 1LEVA 5HM4B 2Q9TA 3OENA 1FBPA 2DYXA 3VVDA 3DELB 4OERA 3HN0A 2Y7IA 1B0LA 4H67A 1PC3A 4F1VA 1AMFA 1USYE 4R75A 4O3BA 1LLSA 4XKPA 2MKZA 2XXIA 1IITA 1A8EA 1SVXB 1D9VA 4QSDA 2ONSA 1ZJLA 3LR1A 5FTHA 3TZAA 5T3JA 1AH5A 4R6KA 3K00A 1JP4A 5L9SA 4NAPA 5IZZA 4ELPA 1HSEA 4H46A 5I59B 2Q89A 2REJA 3KN3A 2DOJA 2P2AA 4MLQA 3R26A 2UYEA 3MQ9A 3EKIA 1P1QA 3TODA 4X8RA 4GL8A 4U1ZA 4JWOA 1RYOA 1B51A 3CRBA 4YKJA 4H8JA 1FBDA 3ECRA 5CBRA 3VVEA 2DQVA 4IR8A 3H3GA 4OZ9A 1URGA 3K6VA 1NV7A 5J16A 4EF2A 4GWXA 2V4CA 4XIGQ 4HE0A 5KZTA 3HO7A 1MXUA 5EYHA 1UIUA 3H7MA 3S9EA 5DEXB 1N7XA 1FQBA 1IMAA 4NF6B 4ZEKA 2GRVA 4PC9A 2H25A 3MWBA 4AB6A 1AL3A 1FJ9A 3Q25A 2F78A 3F11A 5I2NA 2Q8MA 1HSLA 4H5GA 1B3EA 3RT8A 2QJEA 3MSTA 1SQYA 2ZNUA 2DWIA 4BDNA 2H4IA 3RQTA 1FQDA 2O6AA 1IQ7A 3ISPA 3WAFA 4PAKA 5KCJB 4ZS9A 2OK2A 1FPIA 5ET5A 1MQDA 4IB2A 1MPCA 3T9XB 2DP8A 1Y4CA 3UGWA 3K0VA 4P1LA 1SYHA 4QBAA 1O7TA 4IGRA 3EHTA 4IO4A 4AS4A 5TU0A 3K1NA 5H8QA 4ZEBA 3SEUA 1QUJA 4JDFA 4BDLA 3SEWA 3Q29A 2KQZA 4KD5A 2PFZA 4OFOA 1RDXA 1MH3A 2F97A 2DS9A 4F29A 5F7VA 2ALUA 1EYIA 3BFUA 2O1LA 1B7UA 1G0IA 2ZYNA 2Q88A 4MHFA 3RPLA 4ZZAA 3KFMA 3MAMA 3MZ9A 2I6EA 4GLIA 5JTYA 4POXA 5KDTA 2H98A 3FVKA 4OESA 2Z8DA 1NNPA 1YTVA 3IOVA 4NF4A 3UIFA 3CR9A 1OQHA 3DP4A 3IB2A 4F3PA 4U2RA 2XX9A 4GX6A 1BTJA 2VD3A 4GX3A 1TWYA 1FBHA 1FPFA 2FIEA 3W9WA 2VPNA 1H76A 3P7IA 1ANFA 2RCAA 3T66A 3JYRA 1B58A 4G2ZA 2HXRA 4P47A 1OIBA 2Y7WA 1FQFA 1OLAA 1ZTYA 1UTHB 5BWJA 1POY1 4KI0E 1D3KA 4NF8A 5ICQA 2V3QA 2VP1A 1XS5A 3T0JA 2F36A 4DE8A 1OQGA 1NH8A 5A5XB 1P1OA 4ZEIA 1FTJA 4ESWA 3C34A 4KHZE 1JEUA 5FTIA 1FBCA 3VE1B 3KJ7A 2F3DA 3PPPA 1EZPA 2D21A 1XOCA 2H99A 3C35A 4G68C 3PUWE 1KWHA 3TAJA 3K6WA 1VFDA 3IO4A 5CMBA 4KFQA 1BKAA 3KOSA 4RY1A 1MXZA 4RNSA 4EQ7A 2E0SA 2XHDA 1N04A 3LSFB 2XA5A 2YJPA 3U65A 1VR5A 4OQOA 4F1UA 3ILUB 3QIMA 2F7CA 3K1PA 4KXPA 4MJOA 3V83A 2F7AA 4PGNA 1NUYA 4IO5A 2FA7A 1YZ0A 3OO9A 1MQJA 1N76A 1MH4A 4R2FA 2XXRA 1LB9A 4NF5A 4JSDA 1IMFA 2UVJA 3ZKKA 2BJIA 3RN8A 4F2QA 3O28A 3PU5A 3KBRA 3MP8A 2THIA 4QSEA 3MYUA 5ITPA 5I56B 4Z7EA 1JNFA 4YKKA 4N81A 5IZ3A 1FTAA 2Z8FA 1LBZA 3KGCA 2A5TB 3D1RA 2PT1A 3KN8A 4JSOA 1XT8A 1B3GA 3IJXB 1NV5A 2QMXA 4YMBA 4JVDA 1Y1MA 1N3WA 4YU0A 3CIJA 2YLNA 3IOUA 4F3GA 3W9VA 2CEXA 4R6HA 1TFAA 4N15A 1B52A 4N07A 3EHSA 5CRYA 1LFHA 2F6GA 3WAEA 4IO3A 2WYKA 1VDWA 2I49A 2VHAA 1IMBA 2VGQA 5F24A 3BKIB 4HXVA 1B4HA 3SEYA 2Q74A 3VLVA 4RK9A 4QRZA 5AA1A 1CNQA 1MRPA 1FTMA 2I58A 5AE4A 1SYIA 3U72A 1UQWA 4OEUA 3PUVE 4NF0A 2JJKA 4FECA 2QRYA 3IO6A 4PFRA 3O6GA 4IY5A 3RNNA 4P0IA 3MP1A 2OLBA 3NOHA 1IXCA 1R9QA 3OSRA 5H8HB 1PDAA 3T22A 1CE2A 5ET8A 2P0SA 4F1YA 1URSA 3R6UA 5AA4A 2FVZA 1URDA 3TCFA 4OA4A 4PGPA 1B9JA 4F18A 2ABHA 3UK4A 1Y3QA 3PTYA 5DT6A 2PBWA 2IEEA 1AIVA 4KR5A
chains in the Genus database with same CATH topology
4XF5A 5T3JA 1JP4A 1NV6A 4NAPA 5IZZA 4H46A 1DK4A 1Q9DA 4P3LA 2CZHA 3EKIA 1IMEA 4HE2A 4X8RA 3QMFA 4OVTA 1IMCA 1YXIA 5EQAA 1XI6A 5LTCA 1FPBA 1FBDA 1NUXA 4N8YA 3FXBA 2Y5LA 1QGXA 4GX4A 4IR8A 1NV7A 5EQ7A 5J16A 4GWXA 1NV0A 3SZPA 4F19A 2V4CA 4HE0A 2XWKA 5ET7A 4DI3D 5EYHA 4N4UA 1IMAA 2CZKA 4PC9A 3B8BA 1FJ9A 4AS5A 1EYKA 4GBVA 4NHBA 2Q8MA 2HZLA 2PFYA 3MSTA 4MNIA 2L5VA 4JVCA 3KC0A 5EQ8A 3ISPA 3KBZA 4GBWA 4GWWA 4PAKA 3T1BA 1NV2A 1NV4A 5IGAA 1FPIA 5ET5A 1LBXA 4XEQA 4HE1A 2DVZA 4OVRA 2F5XA 1FPGA 4P1LA 4QBAA 1DCUA 4AS4A 4H45A 4I3YA 4I40A 4LN5A 2KQZA 5EQ9A 4MEVA 2PFZA 4MX6A 1NUZA 2WBDA 1RDXA 4DI4B 4X9TA 4OANA 4P56A 4P9KA 1EYIA 4NX1A 4NN3A 1KA0A 3IFCA 1G0IA 1FPKA 4PETA 4PDDA 1IMDA 4MHFA 3RPLA 1FBGA 2KR0A 4HCYA 1RDZA 3RYDA 2XWOA 4N17A 4NGUA 2QVUA 5A5LA 2XWIA 2WBBA 1BK4A 1K9ZA 2DE2A 4GX6A 4GX3A 3LUZA 1FBHA 2FBPA 2CZIA 2DE4A 1FPFA 2FIEA 3W9WA 3LV0A 4GWSA 1FPJA 5FBPA 2VPNA 2PCRA 4N6DA 2HXRA 4P47A 2VT5A 2Y5KA 2ZZXA 3RPLB 2V3QA 5ESYA 1NUWA 1K9YA 2WYPA 3T0JA 3KC1A 2QVVA 4O94A 2WEFA 2HZKA 2FIXA 4O7MA 1FBCA 4PTKA 2F3DA 1NV3A 4GWYA 4N8GA 4PF6A 5CM6A 1G0HA 5I5PA 2XWVA 4PFBA 1AWBA 2XA5A 3U65A 4PE3A 1FPLA 2HHMA 4XFEA 4F1UA 3ROJA 5IM2A 4GWUA 4MMPA 3HFUA 2CEYA 4KXPA 4MJOA 4PAIA 4PGNA 4MNCA 1NUYA 1YYZA 2F3BA 2ZZWA 1YZ0A 1FJ6A 4QXDA 4FBPA 2R8TA 3BIHA 5DW8A 1NV1A 4YZZA 5EYGA 1IMFA 2GQ1A 3E78A 4O7IA 1RDYA 5ET6A 1DBZA 2BJIA 1KZ8A 1FBEA 3MYUA 4MCOA 4PDHA 5J1DA 2B4LA 4N81A 5IZ3A 1FTAA 5LDZA 2QPQA 1LBZA 2ZZVA 4PAFA 3D1RA 3B50A 4MIJA 4MNPA 1NV5A 4P8BA 1LBYA 4G61A 4JVDA 3BIGA 1LBVA 4N91A 4PFIA 3CHGA 2B4MA 4O8MA 2OWZA 3W9VA 2CEXA 4N6KA 3IFAA 4N15A 2QVRA 4MAGA 2WX9A 2DDKA 2DE3A 5IZ1A 3E79A 4X04A 1D9QA 1FRPA 1FPDA 2WYKA 1VDWA 5I7IA 4GWZA 1IMBA 5F24A 4PCDA 4HXVA 1SPIA 5IZ3B 4UABA 2Q74A 3FBPA 1INPA 2P3VA 1FPEA 1CNQA 5JK4A 4PBHA 4OVQA 1FBFA 5I3SA 1LBWA 2P3NA 4OVPA 2FHYA 4NF0A 2JJKA 2OX3A 4HCWA 4P1EA 1LEVA 4JVIA 4YICA 2Q9TA 3GYYA 4PFRA 2VPOA 1FBPA 1NI9A 2QFLA 4NQ8A 3NOHA 1KA1A 4NG7A 1EYJA 4F1VA 5ET8A 4PBQA 4PF8A 4OVSA 3A29A 2XXKA 2MKZA 2FVZA 2HPGA 4OA4A 4PGPA 4F18A 4M1VA 3PTYA 1FSAA 4I3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVV A;  5T3J A;  1LBY A;  4G61 A;  2WEF A;  1DCU A;  4AS4 A;  1JP4 A;  4H45 A;  1NV6 A;  3BIG A;  4I3Y A;  4I40 A;  2FIX A;  1LBV A;  4H46 A;  1FBC A;  4PTK A;  1DK4 A;  2OWZ A;  2F3D A;  5EQ9 A;  3IFA A;  1Q9D A;  1NV3 A;  4GWY A;  2CZH A;  1NUZ A;  2QVR A;  2WBD A;  1IME A;  1RDX A;  4HE2 A;  2DDK A;  3QMF A;  5IZ1 A;  1D9Q A;  1FRP A;  1EYI A;  1IMC A;  1G0H A;  1YXI A;  5EQA A;  1FPD A;  1XI6 A;  1VDW A;  1FPB A;  4GWZ A;  1AWB A;  1KA0 A;  3IFC A;  1G0I A;  1FBD A;  1FPK A;  1NUX A;  1IMB A;  1FPL A;  2HHM A;  5F24 A;  4HXV A;  1SPI A;  5IZ3 B;  1IMD A;  3RPL A;  3ROJ A;  4GWU A;  2Q74 A;  1FBG A;  2Y5L A;  1QGX A;  3FBP A;  4GX4 A;  4IR8 A;  1INP A;  2P3V A;  4KXP A;  4MJO A;  1NV7 A;  5EQ7 A;  5J16 A;  4GWX A;  1FPE A;  1NV0 A;  1NUY A;  1YYZ A;  1RDZ A;  2F3B A;  1CNQ A;  3RYD A;  4HE0 A;  1YZ0 A;  1FBF A;  1FJ6 A;  5I3S A;  5ET7 A;  5EYH A;  1LBW A;  2P3N A;  4QXD A;  4FBP A;  2R8T A;  3BIH A;  2QVU A;  5DW8 A;  1IMA A;  5A5L A;  1NV1 A;  2WBB A;  5EYG A;  2CZK A;  1BK4 A;  2FHY A;  2JJK A;  2OX3 A;  1K9Z A;  3B8B A;  1LEV A;  1IMF A;  2GQ1 A;  4GX6 A;  4O7I A;  4GX3 A;  1RDY A;  5ET6 A;  1FJ9 A;  4AS5 A;  1EYK A;  1FBP A;  3LUZ A;  1DBZ A;  1FBH A;  4GBV A;  1NI9 A;  2BJI A;  2CZI A;  2FBP A;  1FPF A;  2FIE A;  1KZ8 A;  2QFL A;  2Q8M A;  3LV0 A;  4GWS A;  1FBE A;  1FPJ A;  5FBP A;  1KA1 A;  2PCR A;  1EYJ A;  3KC0 A;  5ET8 A;  5EQ8 A;  3KBZ A;  4GBW A;  2VT5 A;  4GWW A;  4N81 A;  1NV2 A;  2Y5K A;  1NV4 A;  3A29 A;  5IZ3 A;  2FVZ A;  1FPI A;  1FTA A;  5ET5 A;  3RPL B;  5LDZ A;  1LBZ A;  1LBX A;  3D1R A;  5ESY A;  4HE1 A;  1NUW A;  1K9Y A;  3T0J A;  3KC1 A;  1FPG A;  1FSA A;  1NV5 A;  4I3E A; 
#chains in the Genus database with same CATH topology
 3CI8 A;  2ESN A;  4ELQ A;  1TFD A;  4KCC A;  3TPA A;  1N7W A;  2ZNT A;  1NKX A;  3PD9 A;  1NV6 A;  3PGF A;  4ZEC A;  5CMC A;  5DTB A;  1NNF A;  1DK4 A;  1B1X A;  2XXV A;  4N6P A;  2Z22 A;  3IR1 A;  4GXA A;  2AYS A;  1Q9D A;  3E9X A;  4P3L A;  1A40 A;  5A5X A;  4OVT A;  4LON B;  3O97 A;  1IMC A;  1O64 A;  3IL1 B;  3FV2 A;  5EQA A;  3MC2 A;  3UP9 A;  2XD2 A;  4G8M A;  1P1U A;  4R9G A;  4N8Y A;  5K2X A;  1PB9 A;  1II5 A;  1QGX A;  5AA2 D;  4WEP A;  3SES A;  1MG1 A;  5EQ7 A;  1NV0 A;  4C0R A;  1LAG E;  2F8D A;  2XWK A;  1DOT A;  4GQO A;  1SW2 A;  4IO2 A;  3TQL A;  2I3W A;  4DXC A;  4AB5 A;  3PMX A;  4K3F A;  5TPA A;  3L6G A;  4JWX A;  4G8H A;  2HZL A;  2ANJ A;  1A7L A;  3HV1 A;  4UAC A;  4MNI A;  2L5V A;  5CBS A;  3A3U A;  4FED A;  5H8F B;  3KC0 A;  5EQ8 A;  1ATG A;  3KBZ A;  2PX1 A;  3I5O A;  1NV2 A;  1USY H;  2HAU A;  5IGA A;  5AA2 B;  1SBP A;  1LBX A;  4HE1 A;  4OVR A;  4O3A A;  3KG2 A;  1EZ9 A;  2HEU A;  1FPG A;  3U8Q A;  2OCU A;  4YKP A;  1FQE A;  5TP9 B;  3IOR A;  3A3C A;  3TMG A;  1ZU0 A;  3OO6 A;  4I3Y A;  4LN5 A;  3CFX A;  4EQ9 A;  4NE4 A;  3GBB A;  2R6G E;  5F1Q A;  3OEM A;  2RIN A;  2REG A;  4QSC A;  2WBD A;  1YCJ A;  2XXY A;  3W15 C;  4P9K A;  1Y3N A;  3H06 B;  4R2B A;  4NX1 A;  4ZDM A;  1IXG A;  1JW5 A;  5DVJ A;  4BDQ A;  1FW0 A;  3K1M A;  2Y7K A;  1QUI A;  1IMD A;  5L8D A;  3MP6 A;  4X1B A;  1RDZ A;  3HST A;  4H8I A;  3EF7 A;  3GBA A;  5I58 B;  3RLF E;  2UVH A;  1IIW A;  3E4R A;  1OVB A;  2GH9 A;  3M3K A;  4NGU A;  2QS3 A;  5A5L A;  2WBB A;  1BK4 A;  2O84 X;  3DM0 A;  2DVC A;  1MPB A;  3RY3 A;  2CZI A;  4OEN A;  2DE4 A;  1H45 A;  3IB0 A;  5FBP A;  3Q27 A;  3VVF A;  2X7P A;  4U4X A;  1S9T A;  1B46 A;  4QFO A;  3MVX A;  3TQW A;  2Y5K A;  1UTB A;  4U23 A;  2Y7P A;  1NNK A;  1HSJ A;  4R9F A;  5I2K A;  1K9Y A;  2WYP A;  4GIZ A;  1R9L A;  2G29 A;  2QVV A;  2F35 A;  1NNT A;  4YAH X;  3RUM A;  4DXU A;  4DXB A;  1B6H A;  3E13 X;  4WXJ A;  3MUQ A;  4N8G A;  1MY0 A;  3FXU A;  3T93 B;  2CMO A;  1SD3 A;  5CM6 A;  1G0H A;  3SET A;  2FNC A;  4LQ5 A;  3KSJ A;  4FIM A;  4ESX A;  1NL5 A;  1XHY A;  4XFE A;  4H5F A;  5IM2 A;  1DTG A;  4MMP A;  1B7Z A;  3HFU A;  3MPL A;  2D3I A;  5H8N A;  2DWA A;  1H3D A;  1YYZ A;  3B6Q A;  2Y7R A;  3JV9 A;  5L9M A;  1FJ6 A;  1SW5 A;  3OSQ A;  3CSB A;  1LAX A;  2IA4 A;  2R8T A;  3BIH A;  1QKA A;  3C32 A;  4KCD A;  1NV1 A;  5EYG A;  5CMK A;  4NMY A;  1DBZ A;  5IKB A;  4G77 A;  4YB7 A;  3TCG A;  2RC7 A;  3LBS A;  4BDR A;  4PDH A;  5J1D A;  1MQG A;  1N0T A;  2B4L A;  2H5Y A;  4XKR A;  4F39 A;  4GRK A;  1P1N A;  2ONR A;  4G68 B;  1I6Q A;  4QHQ A;  4E0X A;  2Q8J A;  1B3H A;  3SDF A;  2QPQ A;  4RJZ A;  2ZZV A;  3FVO A;  4PAF A;  2XXH A;  5FHN A;  3CVG A;  3PPN A;  3VFJ A;  4OEV A;  1LBY A;  1EZO A;  3K6U A;  5ICT A;  4XXU A;  2OWS A;  3VDF A;  3FZV A;  3IX1 A;  4N91 A;  1IXH A;  3A09 A;  2FYI A;  1B5I A;  3CFZ A;  2OWZ A;  1MXV A;  4N6K A;  2XXP A;  2NOO A;  3G3I A;  3ILT B;  3DP6 A;  4X04 A;  1JW4 A;  2YPN A;  4R73 A;  1SI0 A;  3K01 A;  1LFG A;  3K2D A;  3QXM A;  4PCD A;  3G3J A;  4UAB A;  2R9J A;  3FBP A;  1SDX A;  1LGB C;  3V89 B;  1INP A;  4F31 B;  3IB1 A;  2BJJ X;  1FPE A;  2O51 A;  5ELV A;  5JK4 A;  4PBH A;  1FBF A;  1NMU A;  4TOZ A;  5I57 B;  3KSX A;  1DTZ A;  2XXQ A;  1QUL A;  3OOA A;  1MM7 A;  5I59 A;  3N26 A;  4JVI A;  4YIC A;  4FAJ A;  3B6T A;  4ELO A;  2GHA A;  2E1S A;  3G3K A;  4PP0 A;  4ELR A;  4M4G A;  4NQ8 A;  4DLD A;  1S50 A;  4QFL A;  3PD8 A;  4ZED A;  2O69 A;  1EYJ A;  2OJT A;  1IEJ A;  4GOT A;  3MVW A;  4EQB A;  1N3X A;  4GVO A;  4FAT A;  3MW0 A;  3RGY A;  3UOR A;  2X26 A;  4LAT A;  4HS7 A;  4X48 A;  4I3E A;  3FXR A;  4XF5 A;  1FQA A;  3SEV A;  4NED A;  5DEX A;  3FJM A;  4F2O A;  1DPP A;  4NF6 A;  1OMP A;  3TTL A;  2CZH A;  3KZG A;  1WDN A;  1IME A;  4BDO A;  4JB7 A;  4HE2 A;  4MBP A;  3QMF A;  3DP8 A;  1MXX A;  1Q35 A;  4FJP A;  1YXI A;  1XI6 A;  4LQ2 A;  2QS1 A;  4YB6 A;  4H6D A;  4OMB A;  5KCJ A;  3IK6 B;  3IOT A;  1XVY A;  3HCQ A;  3FXB A;  4FE8 A;  4GX4 A;  1QVS A;  3CSG A;  1B32 A;  5HPQ A;  2OPE A;  3SZP A;  1QJM A;  2X7Q A;  4N4U A;  1H44 A;  4OYV A;  2CZK A;  3M3F A;  5K2Y A;  1FTK A;  1JVY A;  3B8B A;  1XC1 A;  3CFL A;  1MS7 A;  4MF3 A;  5EHS A;  1Z7N E;  4EXL A;  4GBV A;  3H6W A;  3VLU A;  2PYY A;  2AL5 A;  4PFU A;  1Y9U A;  4JVC A;  3T9U A;  4GBW A;  3PV0 E;  4JWY A;  3T1B A;  3G3H A;  1P1W A;  4GWO A;  4G4P A;  1JW1 A;  3IOW A;  2PMS A;  3T96 B;  4IO7 A;  2UVG A;  3EPE A;  4THI A;  2I48 A;  3FJ7 A;  3RT6 B;  4WKM A;  5EYF A;  3PMV A;  3USD A;  2I4B A;  4MLV A;  4H1X A;  1Q1K A;  3B7D A;  2NVU B;  3FIR A;  3D4C A;  1NUZ A;  5I2N B;  1MPD A;  4OTE A;  4X9T A;  4OAN A;  4LVQ A;  1I6A A;  1A8F A;  4PQJ A;  4L17 A;  4U1O A;  4NN3 A;  1KA0 A;  3IFC A;  4F22 A;  1UTH A;  1MDP 1;  1F9B A;  4WED A;  2V93 A;  1AOV A;  1ZKB A;  2XXX A;  3Q26 A;  3RYD A;  3PPR A;  2VOZ A;  2F6P A;  5CMM A;  5H8S A;  4LZ5 A;  3V8X B;  4I1D A;  2CZL A;  2QVU A;  4Q0C A;  3K02 A;  2XWI A;  5H8Q B;  4ZZE A;  1K9Z A;  4U21 A;  1NH7 A;  3HPI A;  4I9D A;  5FHM A;  3LUZ A;  2FBP A;  1R6Z A;  1Y20 A;  1FPJ A;  2PCR A;  3N5L A;  3CG3 A;  3N6U A;  2DXY A;  1Y3P A;  1PB7 A;  4N6D A;  4I62 A;  3ZKL A;  3T9H B;  1B2H A;  1B3L A;  2ZZX A;  3I6V A;  1OVT A;  3RPL B;  4PFW A;  4G8N A;  5JTY B;  3I3V A;  1NUW A;  5KDT B;  2O7I A;  4DCY A;  2XX7 A;  2HZK A;  4NF4 B;  3S4U A;  1M5B A;  3OMB A;  2FIX A;  2VD2 A;  1QUK A;  4P11 A;  3QYT A;  2W7Y A;  3K4U A;  4O7M A;  3EQ1 A;  2Q2A A;  3K6X A;  4KQP A;  1NV3 A;  3B6W A;  1IUD A;  1MM6 A;  3TCH A;  3ZS6 A;  4HTG A;  4TLL B;  4TQU Q;  3FVG A;  2HFB A;  2P1S A;  2AL4 A;  5I56 A;  5I5P A;  3QAX A;  4Q8R A;  3FD3 A;  4GF8 A;  2XWV A;  1SW1 A;  2A5S A;  3LC8 A;  1AWB A;  3MBP A;  2RC9 A;  1EH3 A;  4DIG A;  1FPL A;  1YAE A;  4H0W A;  2RKM A;  2V3U A;  3ROJ A;  4GWU A;  2CEY A;  2A5T A;  4U4S A;  3FGS A;  2RC8 A;  4NF8 B;  5CC2 A;  4PAI A;  2Z8E A;  2NXO A;  2ZZW A;  5IAI A;  3TEP A;  4QXD A;  1B40 A;  3M8U A;  4DCX A;  3GZG A;  3CG1 A;  4YZZ A;  4OFJ A;  1MY3 A;  1PBQ A;  3VXB A;  4GD5 A;  3ODB A;  4C1U A;  4O7I A;  3R7X A;  1L5T A;  3FUZ A;  4IGT A;  3SER A;  1MY2 A;  1FBE A;  4ND9 A;  2UXA A;  2G93 A;  4MCO A;  3TTN A;  2ZMB A;  4R6Y A;  2NWJ A;  4U22 A;  2UYF A;  2M8C A;  1A55 A;  2QS4 A;  3B50 A;  3LSW A;  5LOM A;  4MIJ A;  4Q30 B;  4QFK A;  2PT2 A;  3E3K A;  3BIG A;  4EUO A;  1LBV A;  1I69 A;  4PFI A;  1QKB A;  3MZ1 A;  2B4M A;  4NF5 B;  3S9M C;  4I8C A;  1T0K A;  4XKQ A;  1LBB A;  3H03 A;  3QSL A;  4OVJ A;  4OHN A;  3O9P A;  2QVR A;  4YKI A;  4MAG A;  1P99 A;  5IZ1 A;  3E79 A;  1SI1 A;  3QUJ A;  5H8H A;  2NUV A;  1GV8 A;  1D9Q A;  3PUZ E;  4R74 A;  1MY4 A;  2QMW A;  1FPD A;  3C31 A;  5I7I A;  4GWZ A;  2HXW A;  1SPI A;  5IZ3 B;  1I6B A;  3PUY E;  1EU8 A;  1DSN A;  3JZJ A;  4ECF A;  2P3V A;  3KEI A;  2RF1 A;  1MXW A;  2ZYM A;  2XXW A;  2LAO A;  1LFI A;  5I3S A;  2QS2 A;  1LBW A;  1RYX A;  2DXR A;  3MJN A;  3O6I A;  4OVP A;  2OX3 A;  1B3F A;  3U92 A;  1QW0 A;  3GYY A;  3VXC A;  3FAT A;  2VPO A;  4BDM A;  1NI9 A;  1FQC A;  4GL0 A;  2QFL A;  1B7H A;  1KA1 A;  4QF9 A;  4NG7 A;  4OFL A;  1Y1Z A;  4RPO A;  3PMW A;  2B3F A;  4PBQ A;  4LP2 B;  4PF8 A;  4OVS A;  3A29 A;  1SW4 A;  2XXK A;  4KYE A;  2HPG A;  1MY1 A;  1LB8 A;  3GXA A;  2HAV A;  3L6H A;  3ONM A;  3G7W A;  4M1V A;  4MFI A;  2I3V A;  3QUF A;  1FSA A;  4PFT A;  4P0G A;  4LUB A;  1UIV A;  3HHG A;  2XX8 A;  1J1N A;  2RCB A;  3H6U A;  1LCF A;  3O66 A;  3U94 A;  2V3T A;  1US5 A;  4DZ1 A;  1Y4T A;  1BIY A;  1IZ1 A;  3QK6 A;  4JXI A;  3TUS A;  1NFT A;  2XXU A;  2Z23 A;  5H8F A;  4QFN A;  1WVJ A;  5LTC A;  4PE5 B;  1FPB A;  1NUX A;  4EF1 A;  1ELJ A;  5AA2 A;  3MZB A;  5AA4 B;  3U1O A;  2Y5L A;  1LAH E;  3VLW A;  1JEV A;  1M5E A;  3THI A;  4F19 A;  4Q5T A;  5B7D A;  3RTW B;  5TP9 A;  5ET7 A;  5EHM A;  3PPO A;  4DI3 D;  5DVF A;  3MVY A;  1R1N A;  3G3F A;  4H65 A;  1GVC A;  3LSX A;  3OXN A;  3TFL A;  2DSF A;  2HQ0 A;  1A54 A;  3G3G A;  3OEK A;  2B65 A;  3V5A A;  3Q28 A;  1JET A;  4RXL A;  4AS5 A;  1EYK A;  5AA3 A;  1MDQ A;  4JBZ A;  4NHB A;  1M5F A;  2PFY A;  1D9Y A;  3LUY A;  2I4C A;  1XVX A;  1M5C A;  5CI5 A;  3UN6 A;  1LST A;  2GFE A;  3AXF A;  1VSO A;  4NWD A;  1B05 A;  4GWW A;  1NV4 A;  4LZ8 A;  4XTC Q;  1A99 A;  3OD7 A;  4XEQ A;  2I0B A;  2Q2C A;  3TDJ A;  2DVZ A;  3TEL A;  5I58 A;  2F5X A;  4RYA A;  4E0W A;  1H43 A;  2F7B A;  1DCU A;  4H45 A;  2O7U A;  3ZSF A;  4I40 A;  1B5J A;  1CB6 A;  3KN7 A;  2OPD A;  2GHB A;  3M3L A;  2B3B A;  5TPA B;  5EQ9 A;  4MEV A;  3RTF B;  3H6T A;  3FXQ A;  4MX6 A;  4RK2 A;  4OXV A;  3C9H A;  4DI4 B;  4XKN A;  3BFT A;  3C33 A;  4GFR A;  4P56 A;  3O29 A;  2V25 A;  1BP5 A;  2QSX A;  5ITO A;  2ZXT A;  1B0H A;  1FPK A;  5FHO A;  2R71 A;  4PET A;  4N13 A;  4FOR A;  4PDD A;  5HBC A;  1FBG A;  5M2V A;  2KR0 A;  3TTK A;  4AQ4 A;  4HCY A;  4ISU A;  2XXT A;  2ZNS A;  3PUX E;  3KJT A;  4DDD A;  1DPE A;  2XWO A;  3HHF A;  4N17 A;  2KLF A;  1TT1 A;  1B5H A;  4OET A;  3KOT A;  3H4Z A;  1POT A;  1BLF A;  4GXS B;  2DE2 A;  1DMB A;  3S2V A;  1OLC A;  5BUU A;  4IO6 A;  1MQI A;  3FVN A;  3LV0 A;  4GWS A;  3TYH A;  4MH5 A;  4KPT A;  3VV5 A;  4YB5 A;  2VT5 A;  2O1M A;  3SEX A;  1VFE A;  1PB8 A;  3N94 A;  1JQF A;  1TXF A;  1WOD A;  3TKD A;  1N84 A;  5ESY A;  4KYD A;  2DWH A;  3KC1 A;  5JEI A;  1LAF E;  4FEB A;  4O94 A;  3N6T A;  4ZE8 A;  2WEF A;  5B70 A;  3D4G A;  1US4 A;  3BBR A;  3RPW A;  4Z0I A;  4PTK A;  1M5D A;  4POW A;  3FAS A;  3PPQ A;  1ZIU A;  4GWY A;  3MVZ A;  4RPN A;  1D4N A;  4R72 A;  3LSL A;  1B4Z A;  1IXI A;  3UA8 A;  1MXY A;  4PF6 A;  4ONY A;  4ZE9 A;  1JVX A;  4UA8 A;  3OO7 A;  3DLN A;  4EDP A;  1FTL A;  4PFB A;  4TLM B;  2WKY A;  4G68 A;  4PE3 A;  1UTB B;  3C4M A;  2HHM A;  4YMA A;  2OZZ A;  5ISU A;  2QL3 A;  1S7Y A;  5I2K B;  3O6H A;  4MNC A;  2F3B A;  2DWJ A;  1PEB A;  2ONK E;  4F3S A;  3OEL A;  4BLA A;  4EXK A;  4FBP A;  4OWD A;  3MPK A;  5DW8 A;  4C1T A;  3S9N C;  3S9L C;  2ZYK A;  2GQ1 A;  3E78 A;  1RDY A;  5ET6 A;  2V84 A;  1RKM A;  2D5W A;  3U93 A;  3FJG A;  4QFP A;  1KZ8 A;  3SKP A;  3IAZ A;  1GR2 A;  3IJO B;  3EN3 A;  1ZMG A;  1PBP A;  5LDZ A;  1FCK A;  5L9O A;  4LA9 A;  1O63 A;  2O68 A;  4HW8 A;  1YPN A;  1LBC A;  5H8N B;  3GLB A;  4MNP A;  5I57 A;  2XD3 A;  4P8B A;  1ZBM A;  4G61 A;  1ZLQ A;  2ZYO A;  3CHG A;  2H9B A;  4O8M A;  3C36 A;  1LCT A;  4PFY A;  4O3C A;  3IFA A;  2F34 A;  3O2A A;  1MQH A;  3FV1 A;  3TTR A;  2WX9 A;  2DDK A;  2DE3 A;  3OO8 A;  5DYH A;  1FRP A;  1GTK A;  4KYS A;  4ZEF A;  2OBG A;  4F3B A;  2Y84 A;  1GGG A;  4IY6 A;  1VE4 A;  3EHU A;  5DVI A;  3TTM A;  2AIX A;  2PVU A;  4RA1 A;  2I0C A;  2OWT A;  4OVQ A;  4NTL A;  2P3N A;  2HCA A;  2UVI A;  5I84 A;  4LZ7 A;  4X1D A;  3T9V A;  1Z7M E;  4NWC A;  2FHY A;  1B1H A;  1FTO A;  3H6V A;  4HCW A;  4P1E A;  1LEV A;  5HM4 B;  2Q9T A;  3OEN A;  1FBP A;  2DYX A;  3VVD A;  3DEL B;  4OER A;  3HN0 A;  2Y7I A;  1B0L A;  4H67 A;  1PC3 A;  4F1V A;  1AMF A;  1USY E;  4R75 A;  4O3B A;  1LLS A;  4XKP A;  2MKZ A;  2XXI A;  1IIT A;  1A8E A;  1SVX B;  1D9V A;  4QSD A;  2ONS A;  1ZJL A;  3LR1 A;  5FTH A;  3TZA A;  5T3J A;  1AH5 A;  4R6K A;  3K00 A;  1JP4 A;  5L9S A;  4NAP A;  5IZZ A;  4ELP A;  1HSE A;  4H46 A;  5I59 B;  2Q89 A;  2REJ A;  3KN3 A;  2DOJ A;  2P2A A;  4MLQ A;  3R26 A;  2UYE A;  3MQ9 A;  3EKI A;  1P1Q A;  3TOD A;  4X8R A;  4GL8 A;  4U1Z A;  4JWO A;  1RYO A;  1B51 A;  3CRB A;  4YKJ A;  4H8J A;  1FBD A;  3ECR A;  5CBR A;  3VVE A;  2DQV A;  4IR8 A;  3H3G A;  4OZ9 A;  1URG A;  3K6V A;  1NV7 A;  5J16 A;  4EF2 A;  4GWX A;  2V4C A;  4XIG Q;  4HE0 A;  5KZT A;  3HO7 A;  1MXU A;  5EYH A;  1UIU A;  3H7M A;  3S9E A;  5DEX B;  1N7X A;  1FQB A;  1IMA A;  4NF6 B;  4ZEK A;  2GRV A;  4PC9 A;  2H25 A;  3MWB A;  4AB6 A;  1AL3 A;  1FJ9 A;  3Q25 A;  2F78 A;  3F11 A;  5I2N A;  2Q8M A;  1HSL A;  4H5G A;  1B3E A;  3RT8 A;  2QJE A;  3MST A;  1SQY A;  2ZNU A;  2DWI A;  4BDN A;  2H4I A;  3RQT A;  1FQD A;  2O6A A;  1IQ7 A;  3ISP A;  3WAF A;  4PAK A;  5KCJ B;  4ZS9 A;  2OK2 A;  1FPI A;  5ET5 A;  1MQD A;  4IB2 A;  1MPC A;  3T9X B;  2DP8 A;  1Y4C A;  3UGW A;  3K0V A;  4P1L A;  1SYH A;  4QBA A;  1O7T A;  4IGR A;  3EHT A;  4IO4 A;  4AS4 A;  5TU0 A;  3K1N A;  5H8Q A;  4ZEB A;  3SEU A;  1QUJ A;  4JDF A;  4BDL A;  3SEW A;  3Q29 A;  2KQZ A;  4KD5 A;  2PFZ A;  4OFO A;  1RDX A;  1MH3 A;  2F97 A;  2DS9 A;  4F29 A;  5F7V A;  2ALU A;  1EYI A;  3BFU A;  2O1L A;  1B7U A;  1G0I A;  2ZYN A;  2Q88 A;  4MHF A;  3RPL A;  4ZZA A;  3KFM A;  3MAM A;  3MZ9 A;  2I6E A;  4GLI A;  5JTY A;  4POX A;  5KDT A;  2H98 A;  3FVK A;  4OES A;  2Z8D A;  1NNP A;  1YTV A;  3IOV A;  4NF4 A;  3UIF A;  3CR9 A;  1OQH A;  3DP4 A;  3IB2 A;  4F3P A;  4U2R A;  2XX9 A;  4GX6 A;  1BTJ A;  2VD3 A;  4GX3 A;  1TWY A;  1FBH A;  1FPF A;  2FIE A;  3W9W A;  2VPN A;  1H76 A;  3P7I A;  1ANF A;  2RCA A;  3T66 A;  3JYR A;  1B58 A;  4G2Z A;  2HXR A;  4P47 A;  1OIB A;  2Y7W A;  1FQF A;  1OLA A;  1ZTY A;  1UTH B;  5BWJ A;  1POY 1;  4KI0 E;  1D3K A;  4NF8 A;  5ICQ A;  2V3Q A;  2VP1 A;  1XS5 A;  3T0J A;  2F36 A;  4DE8 A;  1OQG A;  1NH8 A;  5A5X B;  1P1O A;  4ZEI A;  1FTJ A;  4ESW A;  3C34 A;  4KHZ E;  1JEU A;  5FTI A;  1FBC A;  3VE1 B;  3KJ7 A;  2F3D A;  3PPP A;  1EZP A;  2D21 A;  1XOC A;  2H99 A;  3C35 A;  4G68 C;  3PUW E;  1KWH A;  3TAJ A;  3K6W A;  1VFD A;  3IO4 A;  5CMB A;  4KFQ A;  1BKA A;  3KOS A;  4RY1 A;  1MXZ A;  4RNS A;  4EQ7 A;  2E0S A;  2XHD A;  1N04 A;  3LSF B;  2XA5 A;  2YJP A;  3U65 A;  1VR5 A;  4OQO A;  4F1U A;  3ILU B;  3QIM A;  2F7C A;  3K1P A;  4KXP A;  4MJO A;  3V83 A;  2F7A A;  4PGN A;  1NUY A;  4IO5 A;  2FA7 A;  1YZ0 A;  3OO9 A;  1MQJ A;  1N76 A;  1MH4 A;  4R2F A;  2XXR A;  1LB9 A;  4NF5 A;  4JSD A;  1IMF A;  2UVJ A;  3ZKK A;  2BJI A;  3RN8 A;  4F2Q A;  3O28 A;  3PU5 A;  3KBR A;  3MP8 A;  2THI A;  4QSE A;  3MYU A;  5ITP A;  5I56 B;  4Z7E A;  1JNF A;  4YKK A;  4N81 A;  5IZ3 A;  1FTA A;  2Z8F A;  1LBZ A;  3KGC A;  2A5T B;  3D1R A;  2PT1 A;  3KN8 A;  4JSO A;  1XT8 A;  1B3G A;  3IJX B;  1NV5 A;  2QMX A;  4YMB A;  4JVD A;  1Y1M A;  1N3W A;  4YU0 A;  3CIJ A;  2YLN A;  3IOU A;  4F3G A;  3W9V A;  2CEX A;  4R6H A;  1TFA A;  4N15 A;  1B52 A;  4N07 A;  3EHS A;  5CRY A;  1LFH A;  2F6G A;  3WAE A;  4IO3 A;  2WYK A;  1VDW A;  2I49 A;  2VHA A;  1IMB A;  2VGQ A;  5F24 A;  3BKI B;  4HXV A;  1B4H A;  3SEY A;  2Q74 A;  3VLV A;  4RK9 A;  4QRZ A;  5AA1 A;  1CNQ A;  1MRP A;  1FTM A;  2I58 A;  5AE4 A;  1SYI A;  3U72 A;  1UQW A;  4OEU A;  3PUV E;  4NF0 A;  2JJK A;  4FEC A;  2QRY A;  3IO6 A;  4PFR A;  3O6G A;  4IY5 A;  3RNN A;  4P0I A;  3MP1 A;  2OLB A;  3NOH A;  1IXC A;  1R9Q A;  3OSR A;  5H8H B;  1PDA A;  3T22 A;  1CE2 A;  5ET8 A;  2P0S A;  4F1Y A;  1URS A;  3R6U A;  5AA4 A;  2FVZ A;  1URD A;  3TCF A;  4OA4 A;  4PGP A;  1B9J A;  4F18 A;  2ABH A;  3UK4 A;  1Y3Q A;  3PTY A;  5DT6 A;  2PBW A;  2IEE A;  1AIV A;  4KR5 A; 
#chains in the Genus database with same CATH homology
 4XF5 A;  5T3J A;  1JP4 A;  1NV6 A;  4NAP A;  5IZZ A;  4H46 A;  1DK4 A;  1Q9D A;  4P3L A;  2CZH A;  3EKI A;  1IME A;  4HE2 A;  4X8R A;  3QMF A;  4OVT A;  1IMC A;  1YXI A;  5EQA A;  1XI6 A;  5LTC A;  1FPB A;  1FBD A;  1NUX A;  4N8Y A;  3FXB A;  2Y5L A;  1QGX A;  4GX4 A;  4IR8 A;  1NV7 A;  5EQ7 A;  5J16 A;  4GWX A;  1NV0 A;  3SZP A;  4F19 A;  2V4C A;  4HE0 A;  2XWK A;  5ET7 A;  4DI3 D;  5EYH A;  4N4U A;  1IMA A;  2CZK A;  4PC9 A;  3B8B A;  1FJ9 A;  4AS5 A;  1EYK A;  4GBV A;  4NHB A;  2Q8M A;  2HZL A;  2PFY A;  3MST A;  4MNI A;  2L5V A;  4JVC A;  3KC0 A;  5EQ8 A;  3ISP A;  3KBZ A;  4GBW A;  4GWW A;  4PAK A;  3T1B A;  1NV2 A;  1NV4 A;  5IGA A;  1FPI A;  5ET5 A;  1LBX A;  4XEQ A;  4HE1 A;  2DVZ A;  4OVR A;  2F5X A;  1FPG A;  4P1L A;  4QBA A;  1DCU A;  4AS4 A;  4H45 A;  4I3Y A;  4I40 A;  4LN5 A;  2KQZ A;  5EQ9 A;  4MEV A;  2PFZ A;  4MX6 A;  1NUZ A;  2WBD A;  1RDX A;  4DI4 B;  4X9T A;  4OAN A;  4P56 A;  4P9K A;  1EYI A;  4NX1 A;  4NN3 A;  1KA0 A;  3IFC A;  1G0I A;  1FPK A;  4PET A;  4PDD A;  1IMD A;  4MHF A;  3RPL A;  1FBG A;  2KR0 A;  4HCY A;  1RDZ A;  3RYD A;  2XWO A;  4N17 A;  4NGU A;  2QVU A;  5A5L A;  2XWI A;  2WBB A;  1BK4 A;  1K9Z A;  2DE2 A;  4GX6 A;  4GX3 A;  3LUZ A;  1FBH A;  2FBP A;  2CZI A;  2DE4 A;  1FPF A;  2FIE A;  3W9W A;  3LV0 A;  4GWS A;  1FPJ A;  5FBP A;  2VPN A;  2PCR A;  4N6D A;  2HXR A;  4P47 A;  2VT5 A;  2Y5K A;  2ZZX A;  3RPL B;  2V3Q A;  5ESY A;  1NUW A;  1K9Y A;  2WYP A;  3T0J A;  3KC1 A;  2QVV A;  4O94 A;  2WEF A;  2HZK A;  2FIX A;  4O7M A;  1FBC A;  4PTK A;  2F3D A;  1NV3 A;  4GWY A;  4N8G A;  4PF6 A;  5CM6 A;  1G0H A;  5I5P A;  2XWV A;  4PFB A;  1AWB A;  2XA5 A;  3U65 A;  4PE3 A;  1FPL A;  2HHM A;  4XFE A;  4F1U A;  3ROJ A;  5IM2 A;  4GWU A;  4MMP A;  3HFU A;  2CEY A;  4KXP A;  4MJO A;  4PAI A;  4PGN A;  4MNC A;  1NUY A;  1YYZ A;  2F3B A;  2ZZW A;  1YZ0 A;  1FJ6 A;  4QXD A;  4FBP A;  2R8T A;  3BIH A;  5DW8 A;  1NV1 A;  4YZZ A;  5EYG A;  1IMF A;  2GQ1 A;  3E78 A;  4O7I A;  1RDY A;  5ET6 A;  1DBZ A;  2BJI A;  1KZ8 A;  1FBE A;  3MYU A;  4MCO A;  4PDH A;  5J1D A;  2B4L A;  4N81 A;  5IZ3 A;  1FTA A;  5LDZ A;  2QPQ A;  1LBZ A;  2ZZV A;  4PAF A;  3D1R A;  3B50 A;  4MIJ A;  4MNP A;  1NV5 A;  4P8B A;  1LBY A;  4G61 A;  4JVD A;  3BIG A;  1LBV A;  4N91 A;  4PFI A;  3CHG A;  2B4M A;  4O8M A;  2OWZ A;  3W9V A;  2CEX A;  4N6K A;  3IFA A;  4N15 A;  2QVR A;  4MAG A;  2WX9 A;  2DDK A;  2DE3 A;  5IZ1 A;  3E79 A;  4X04 A;  1D9Q A;  1FRP A;  1FPD A;  2WYK A;  1VDW A;  5I7I A;  4GWZ A;  1IMB A;  5F24 A;  4PCD A;  4HXV A;  1SPI A;  5IZ3 B;  4UAB A;  2Q74 A;  3FBP A;  1INP A;  2P3V A;  1FPE A;  1CNQ A;  5JK4 A;  4PBH A;  4OVQ A;  1FBF A;  5I3S A;  1LBW A;  2P3N A;  4OVP A;  2FHY A;  4NF0 A;  2JJK A;  2OX3 A;  4HCW A;  4P1E A;  1LEV A;  4JVI A;  4YIC A;  2Q9T A;  3GYY A;  4PFR A;  2VPO A;  1FBP A;  1NI9 A;  2QFL A;  4NQ8 A;  3NOH A;  1KA1 A;  4NG7 A;  1EYJ A;  4F1V A;  5ET8 A;  4PBQ A;  4PF8 A;  4OVS A;  3A29 A;  2XXK A;  2MKZ A;  2FVZ A;  2HPG A;  4OA4 A;  4PGP A;  4F18 A;  4M1V A;  3PTY A;  1FSA A;  4I3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...