4AS5A

Structure of mouse inositol monophosphatase 1
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
274
structure length
274
Chain Sequence
DPWQECMDYAVILARQAGEMIREALKNEMDVMIKSSPADLVTVTDQKVEKMLMSSIKEKYPCHSFIGEESVAAGEKTVFTEQPTWVIDPIDGTTNFVHRFPFVAVSIGFLVNKEMEFGIVYSCVEDKMYTGRKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRKPETLRIVLSNMEKLCSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVTEAGGVLMDVTGGPFDLMSRRIIAANSITLAKRIAKEIEIIPLQRDDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cloning, Expression, Purification, Crystallization and X-Ray Analysis of Inositol Monophosphatase from Mus Musculus and Homo Sapiens.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords INOSITOL MONOPHOSPHATASE 1
total genus 92
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.25: Inositol-phosphate phosphatase.
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 4as5A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4as5A02
2QFLA 5F24A 1DK4A 5A5LA 2QVUA 5IZ1A 1RDXA 1IMFA 4AS4A 1NUZA 5EQ8A 1FPGA 1BK4A 1LBWA 3LUZA 3QMFA 5EQ7A 1FJ6A 1QGXA 3FBPA 1NUWA 1FBGA 5IZ3B 2Y5LA 4KXPA 2BJIA 1G0IA 1DBZA 1NV6A 1IMEA 4GWWA 2PCRA 1FBFA 1D9QA 1NI9A 1FPBA 2R8TA 4IR8A 4I40A 5T3JA 4GX6A 2FBPA 4GX3A 2GQ1A 2P3NA 4GWXA 4GBWA 5ESYA 3IFAA 1EYJA 5DW8A 1K9YA 3B8BA 2Q8MA 1DCUA 1EYKA 1FBCA 1FPLA 1NV3A 1NV5A 2Q74A 2WEFA 5LDZA 1Q9DA 1RDZA 3RYDA 4GWUA 1NV1A 1FBDA 1NV4A 4GX4A 1FBPA 3ROJA 2P3VA 3KC0A 1FPDA 4PTKA 5EYGA 4GWYA 1FPIA 2DDKA 2QVVA 3RPLA 5FBPA 1SPIA 1JP4A 4N81A 2CZIA 4O7IA 3KC1A 1KA0A 2FHYA 5EQAA 4AS5A 1IMDA 2WBBA 3IFCA 1LBZA 1IMCA 4HE2A 2OWZA 5ET6A 3RPLB 1LBYA 2QVRA 1FBEA 4H45A 1INPA 4QXDA 4HXVA 1FPKA 1LBXA 1NUXA 1KZ8A 1NV2A 1K9ZA 4HE1A 2JJKA 4MJOA 1YYZA 2FIXA 1NV0A 1VDWA 2OX3A 3BIHA 1IMBA 1CNQA 1RDYA 1FSAA 5IZ3A 5EQ9A 4I3YA 1LEVA 1YXIA 2Y5KA 2VT5A 1NUYA 2F3DA 1EYIA 1LBVA 3KBZA 5I3SA 5ET7A 2F3BA 1FPJA 4GBVA 1AWBA 1FJ9A 1KA1A 1NV7A 3T0JA 4GWZA 4I3EA 1FPFA 1FBHA 2CZKA 2WBDA 1FPEA 1IMAA 5ET5A 1YZ0A 3D1RA 4FBPA 1FTAA 4HE0A 4G61A 2FIEA 3LV0A 2HHMA 3A29A 4H46A 5ET8A 1XI6A 3BIGA 4GWSA 5EYHA 2FVZA 5J16A 1G0HA 2CZHA 1FRPA
chains in the Genus database with same CATH superfamily
3KN7A 1IXCA 1MPDA 2UYEA 4QFLA 4DIGA 4FORA 1SI1A 4N6KA 2XXUA 3G7WA 4YAHX 3BBRA 4XKRA 1FCKA 4POXA 2QPQA 4JVIA 4FAJA 3IFAA 2GHAA 2QS2A 5I84A 4Z0IA 4LATA 1LCFA 3A3CA 1MPBA 2XX7A 1EYKA 4HCWA 3H03A 1FBDA 2HZKA 1FPDA 2PVUA 3R26A 3G3FA 1SPIA 4OVRA 3MZ9A 1SQYA 2AIXA 3TEPA 1PBQA 4RK9A 5EQAA 2QMXA 5TU0A 3FXBA 2DWHA 4H45A 4KCDA 2W7YA 1K9ZA 1RKMA 3QSLA 1S50A 4GXSB 4U1ZA 2XXWA 4ELOA 4PGNA 4MFIA 5KZTA 3FUZA 3W9VA 3BFTA 1GR2A 3H3GA 4QF9A 5I59A 2B4MA 2X26A 2YPNA 1MM7A 4XTCQ 4P47A 1NV7A 1FQAA 4MX6A 4JVCA 4XKPA 4HCYA 4XKNA 3GLBA 4P0GA 2Y7KA 3U65A 4OETA 1FQCA 3C34A 4PGPA 1A8FA 2Q8JA 1LFGA 3KFMA 2I3WA 3MPKA 1MDQA 4MBPA 4DCYA 1DTGA 1LAHE 2GFEA 2QFLA 3MP8A 1DK4A 1MRPA 1I6QA 2XX9A 1BK4A 2G93A 3O28A 2RC7A 5IZ3B 2ZNSA 1GV8A 3Q28A 2P1SA 1BP5A 1MH4A 3FJGA 3Q27A 4O3BA 3FJMA 1IXIA 2HCAA 4QSEA 3QAXA 4F39A 5ESYA 3G3JA 5AA2B 4ZEIA 3O6GA 2Q74A 3IO4A 2ONKE 4BDLA 4GX4A 3ROJA 1JETA 3B7DA 4PTKA 1S9TA 2DE2A 1B3HA 1XVYA 3RT8A 4UABA 1ELJA 3TMGA 2CEXA 2UXAA 2QVRA 1NFTA 4QSCA 3SESA 4HTGA 3RTFB 3KEIA 3TQWA 1B3LA 2A5SA 3K4UA 3FJ7A 4PE5B 3BIHA 1IMBA 3AXFA 2OK2A 4MNCA 1ANFA 4NG7A 4JBZA 2NOOA 2CMOA 1EU8A 1GTKA 1YPNA 4BDOA 1LBVA 1RYOA 1TWYA 1WDNA 1ZTYA 3ZKLA 4GWOA 3ZSFA 1LFHA 5JTYB 2XXXA 3K1PA 2H25A 1IMAA 4FATA 3VVEA 3L6GA 3Q25A 1XI6A 3PD9A 4QRZA 2XXYA 3KZGA 4G8NA 4TOZA 3OMBA 1NKXA 3EHTA 1N84A 3SEVA 4H5GA 1LSTA 2PT2A 3PMVA 2XWIA 3L6HA 5CC2A 1DPPA 2ONSA 4FE8A 2O51A 1XVXA 2OWTA 5HPQA 4KXPA 3ZS6A 5IAIA 1FQDA 5CMBA 4ZEBA 4OHNA 3QXMA 1YCJA 4RK2A 2ZZXA 1SYHA 4LQ2A 3PUWE 4H6DA 1ZIUA 3N26A 2NVUB 5EHMA 2AL4A 4X04A 5TPAB 4RA1A 3KC0A 1N3XA 3OEKA 1B7UA 1JNFA 1Y9UA 2RF1A 4F3GA 4JSOA 3FASA 1LBYA 4H5FA 2B3BA 4Q5TA 1NV0A 5K2XA 2DE4A 4ZS9A 3HN0A 3QIMA 5I2KA 4H8IA 4YKKA 3B6WA 2F6GA 1H45A 3K1MA 2F7AA 2O7IA 3EN3A 4KCCA 3Q26A 3RUMA 2G29A 2DP8A 4ZE9A 4IY5A 4LVQA 1US4A 1FTOA 3E9XA 2I48A 1NL5A 3LBSA 2ZZWA 2QS3A 4DCXA 2E1SA 2FIEA 1M5EA 2RINA 3LR1A 5H8HA 4MLQA 4I9DA 1EH3A 4ND9A 5AA3A 2DWIA 1VSOA 5EYHA 1NNFA 3RT6B 3IAZA 3SEWA 1SI0A 2CEYA 2XXHA 1H3DA 4WXJA 1FTMA 3U93A 1NUZA 4XEQA 1PB8A 3USDA 3OELA 3VV5A 4I62A 1B3EA 1D9QA 3KG2A 4IR8A 3T1BA 2X7QA 2V3QA 3T9UA 4GBWA 1B52A 1AL3A 2Y7RA 4EQ9A 3OSRA 4R6KA 4F3SA 4DE8A 2DOJA 1B7ZA 3FXUA 4Q8RA 2QVVA 1H43A 3K6VA 4OVQA 3IJOB 3T93B 4N81A 4O7IA 3I5OA 2OJTA 1AMFA 3KN8A 1AH5A 4YKPA 1LBXA 4PDHA 3NOHA 2FIXA 1DSNA 4N13A 4R75A 2O69A 1QKBA 3OEMA 1FSAA 1YXIA 4PFIA 4E0WA 1XC1A 1JW4A 1XT8A 4H65A 4ESXA 4EUOA 1B05A 4LZ7A 3TUSA 3GBAA 4PFRA 4O3CA 4OVJA 2WYPA 5M2VA 2CZKA 4EXKA 1FPEA 1Y1MA 5HM4B 5F1QA 4FBPA 4YB7A 4WKMA 3TCGA 3VLWA 3I6VA 4OFJA 2OBGA 3O29A 3K6WA 3T9HB 4U2RA 5EQ8A 4PC9A 5EHSA 4GOTA 4GL8A 1MXYA 4MIJA 4NN3A 4OEVA 2H4IA 2B4LA 3CSBA 3O9PA 1VFEA 5L9SA 5ISUA 1A7LA 3IB2A 1MQGA 4NF4A 4H0WA 3FD3A 1NNKA 4EF1A 3FV2A 3KSJA 4GF8A 4ECFA 3V83A 2HEUA 1FBCA 5DTBA 1MS7A 2I58A 5AA4B 2REGA 2ZZVA 4MNIA 3FGSA 3HV1A 4XFEA 4IO2A 1N0TA 3IFCA 2F34A 1IQ7A 3RQTA 1PEBA 4KYSA 1LBCA 2THIA 1YYZA 3IK6B 5ICQA 5TP9A 2PFYA 1RDYA 3B6QA 4I3YA 5JEIA 2A5TA 3T9XB 3THIA 4IO7A 3TAJA 2HZLA 3PMWA 3QUJA 5I3SA 2Z8FA 1PBPA 3BKIB 1URSA 1FJ9A 3IO6A 2ZYKA 1A54A 4IB2A 1POY1 4MAGA 5HBCA 2QRYA 1MDP1 2O68A 4PP0A 4KR5A 3FATA 3BIGA 3OO8A 3PUYE 4NF0A 1GGGA 2A5TB 4PDDA 1ATGA 4X1BA 4NX1A 2OZZA 2F35A 1XOCA 1FPGA 2RCAA 1B3GA 1IEJA 3O6IA 2V3TA 5L9OA 3KJ7A 2REJA 2P2AA 2R6GE 1SDXA 1IMEA 4GWWA 3TFLA 1FBFA 1MQJA 3D4CA 4IO4A 1NNTA 4ZZAA 4GRKA 2PX1A 5DW8A 1EYJA 1O64A 5JK4A 4PFYA 2Q8MA 4PF8A 4NF5A 1WVJA 1Z7NE 3MP1A 3EF7A 3HCQA 2V25A 4FEBA 4DDDA 2V3UA 5AA2A 2RC9A 4IO6A 2QSXA 3U1OA 3G3HA 1OMPA 3MVZA 3K02A 3CG1A 2XWKA 3OOAA 5I56A 4IO3A 4XXUA 1POTA 1D9YA 1XHYA 4IGRA 2OPDA 4PETA 4HE1A 2JJKA 5K2YA 3PPOA 3MP6A 1Y20A 2AL5A 2Y84A 4UACA 5EQ9A 3SDFA 3JZJA 4ONYA 3LSLA 3T66A 3LSXA 1ZU0A 1KA1A 1MQHA 1IUDA 1MXUA 1MY2A 3JYRA 3KJTA 4PF6A 5H8QB 2XXTA 4BDMA 1M5FA 2HHMA 4F3BA 5JTYA 2X7PA 3SZPA 2FVZA 3IR1A 2QL3A 3MC2A 3K00A 1SW1A 4N8GA 5KDTB 3O6HA 3VLVA 4NTLA 5TP9B 1QGXA 2H5YA 4OXVA 1B1HA 3PU5A 2PCRA 4IY6A 1URDA 3SEXA 2VOZA 3N6UA 1VE4A 5EYFA 4G68C 5DT6A 2CZLA 3FIRA 4OVTA 3FV1A 4R6HA 2ZYMA 1B58A 4NF8B 3CFZA 2P0SA 4OFOA 1USYH 4GWYA 1J1NA 3RPLA 2RC8A 5I58A 5FHOA 2CZIA 3DLNA 2F7BA 3MWBA 3E78A 2V4CA 1LBZA 4HE2A 3DP4A 1US5A 2XX8A 3QUFA 1A40A 2Y7IA 1B46A 4HXVA 4GLIA 4R9GA 1PB9A 3ONMA 1EZOA 3OO7A 4NWCA 5H8SA 2DQVA 1WODA 3HHFA 3TDJA 4ZECA 4JWYA 3U92A 5I2NB 1T0KA 4F31B 5CI5A 3OO6A 3PPQA 2PT1A 3JV9A 4OWDA 4U23A 5J1DA 3TELA 2XD2A 2Y7PA 2ZXTA 3QMFA 4OESA 2IA4A 1SVXB 2ALUA 1OIBA 4KYDA 4OQOA 1M5BA 4XF5A 4PFBA 3U72A 4ZDMA 3I3VA 1JW1A 4QBAA 2ESNA 3FVKA 4U21A 4GWXA 3B8BA 5TPAA 3CSGA 3GYYA 1DCUA 4DI3D 2WEFA 2I0BA 2XA5A 3M3KA 4O3AA 1Y4TA 1ZJLA 3H6VA 1FPIA 4M1VA 4DXUA 4YKIA 2Q89A 1KA0A 4PBQA 4C1TA 3UK4A 1JW5A 4N17A 4DZ1A 1MQIA 4R6YA 3C4MA 2F8DA 3RGYA 2H9BA 3E13X 1ZKBA 2UVJA 4RXLA 4HS7A 2VT5A 2UYFA 3U94A 1MG1A 1A55A 1O63A 3CFXA 3FXRA 4BDRA 1NMUA 2AYSA 3S9EA 4ESWA 2NWJA 3U8QA 1R9QA 4NF6B 4G68B 3TPAA 1HSLA 3EHUA 1Q1KA 5J16A 1O7TA 5FHMA 1OLCA 1QKAA 5F24A 1LB8A 5BUUA 3EHSA 3WAFA 3MUQA 1B1XA 1F9BA 3S4UA 2KQZA 3N5LA 3K2DA 4LUBA 3WAEA 2F36A 1DBZA 4ZE8A 3MSTA 5IGAA 4YB5A 4GX3A 1QUKA 4LQ5A 4F22A 1A8EA 3TYHA 4Q0CA 2HAVA 3MYUA 1NV4A 4ZEFA 4R2BA 2F7CA 1QJMA 3OSQA 1JP4A 3KC1A 1UTBA 2O6AA 4JWXA 3MZBA 5ET6A 3TZAA 3TTKA 4KD5A 3MBPA 4NWDA 4IO5A 4OANA 1A99A 4M4GA 3VVDA 3IL1B 4G68A 2FA7A 3EKIA 4JVDA 4JWOA 2Y5KA 2F3DA 1URGA 3UGWA 3M8UA 2HXWA 4R9FA 5I57B 2WYKA 4ELPA 1AWBA 1IXGA 3C9HA 1VFDA 4ZZEA 2D5WA 3DP6A 4UA8A 4MLVA 2WKYA 1FTAA 1OQHA 4F29A 1AIVA 1IIWA 1RYXA 1ZMGA 5CBSA 4Z7EA 3Q29A 2V84A 3H6WA 4IGTA 1G0HA 3VXBA 2F97A 3GZGA 2HQ0A 1RDXA 1IZ1A 1IMFA 1PDAA 4LONB 5LTCA 4XIGQ 1BKAA 1LFIA 4R73A 3VDFA 4MCOA 4QFOA 4YKJA 2Z22A 5I57A 3PUVE 5T3JA 2FBPA 1D3KA 1LAFE 1LGBC 4YZZA 5B70A 2V93A 2I4CA 4BLAA 1QULA 2DXRA 4P56A 1FPLA 4GVOA 4RPNA 3V5AA 1NV1A 1ZLQA 1NNPA 3IOWA 2I6EA 2DDKA 4O7MA 1LBBA 4P1LA 1JEVA 4U4SA 4QHQA 2OWZA 4I1DA 4NHBA 5FTIA 4QFPA 4F2QA 1KZ8A 4GD5A 4HW8A 2L5VA 3O97A 4LA9A 3ILTB 3OXNA 4G77A 1NUYA 5KCJB 4P3LA 3EPEA 2BJJX 3PPNA 3ISPA 2GRVA 1FPJA 4ELQA 5IKBA 1BLFA 3M3FA 2D3IA 3C35A 2Z8DA 3MPLA 3K6UA 1H76A 3MZ1A 3A29A 1QUJA 4U22A 4GBVA 4MF3A 1P99A 2QVUA 2R9JA 1FBGA 1JEUA 2OLBA 1GVCA 2BJIA 3T22A 1R6ZA 3EQ1A 2DE3A 2XWOA 5DVJA 4LN5A 5LOMA 4F1UA 2QS1A 1Q35A 4H1XA 3RY3A 4QFNA 1KWHA 5LDZA 1RDZA 1B4ZA 1N76A 3C36A 3RTWB 3TCHA 5FBPA 3C33A 1B32A 5KDTA 4AQ4A 3MVYA 2OCUA 1M5DA 2O1LA 5I58B 3VE1B 4POWA 1B4HA 2O1MA 4OENA 2F78A 1CNQA 3PGFA 4P0IA 3TTLA 4F1VA 1OVTA 1B9JA 4PFUA 1BTJA 3T9VA 3RN8A 2HXRA 5ELVA 2O84X 4PQJA 4NEDA 4X1DA 4KHZE 4PBHA 5CMMA 3BFUA 1I6BA 5DVIA 5ET5A 1MXZA 2M8CA 2ZYOA 1FTJA 5H8FB 3TCFA 4X48A 4C1UA 2XXIA 4O94A 4DXBA 4G61A 3N6TA 4H46A 5ET8A 2UVHA 3A3UA 4OERA 4OEUA 4F1YA 4F3PA 3S9LC 2GHBA 3TKDA 4AS4A 3RPWA 3C32A 5A5XB 1SYIA 5AA2D 3LUZA 2ZMBA 1FJ6A 4NAPA 3V89B 1D9VA 5ITOA 3S2VA 4P11A 1NV6A 3UIFA 4DXCA 1NI9A 1Y4CA 4QSDA 1IXHA 3K01A 2O7UA 2VGQA 1DPEA 4OMBA 3H6TA 2Q2CA 1N04A 4N6PA 2WX9A 1FBPA 1OLAA 1P1OA 2ONRA 1LCTA 3VLUA 3C31A 3SERA 1TFDA 4TQUQ 2XXPA 1DMBA 2XXVA 4O8MA 4AS5A 2ABHA 1IMDA 4F19A 3RPLB 3PMXA 4JB7A 3E79A 1JVXA 2DSFA 1EZPA 2IEEA 3CVGA 1UIUA 3PUXE 4BDQA 1B7HA 4TLMB 5BWJA 3SETA 4JDFA 3RNNA 3TODA 4R74A 3KBZA 3M3LA 2XXKA 5AA1A 3S9MC 2F3BA 2DVZA 4YMAA 4MH5A 3G3KA 4GWZA 5H8FA 3KOTA 1FPFA 4OVPA 1M5CA 4PAKA 5DEXA 4R2FA 2Q88A 1B51A 3G3GA 1FQBA 2KR0A 2Z8EA 5DEXB 3S9NC 2UVGA 4KPTA 5ITPA 3UA8A 5CRYA 2YJPA 1OVBA 2XWVA 1UTBB 3FZVA 2Y7WA 1L5TA 1H44A 1LLSA 4LZ5A 3VXCA 4N6DA 2Y5LA 4PCDA 4P8BA 1SW2A 3IOUA 5CMKA 3ODBA 2R8TA 2Q9TA 4R72A 1QVSA 3W15C 4NF4B 5F7VA 1MY0A 3W9WA 3H7MA 1N3WA 4OA4A 3HO7A 3TTMA 3IB1A 5L8DA 1NV5A 4EDPA 3RYDA 4GWUA 1UTHA 3TTNA 1DTZA 1MY3A 1MM6A 3FVGA 4I8CA 4OFLA 4N91A 4C0RA 5CBRA 1P1WA 4G2ZA 1Y3PA 2XXRA 4PAIA 4U4XA 4YB6A 4EQBA 4NQ8A 3H06B 2VD2A 3KSXA 4EF2A 4N15A 1MXWA 3RLFE 1IMCA 2ZYNA 4OVSA 4N8YA 2RCBA 2NUVA 4GIZA 1FPKA 1NUXA 2F6PA 4EQ7A 4AB6A 4ISUA 4H67A 4TLLB 3QYTA 3CRBA 1FTKA 2VD3A 4KYEA 3VFJA 4RJZA 4H8JA 1P1NA 5I2NA 3IJXB 5ET7A 3R6UA 1LB9A 4F2OA 3TTRA 2NXOA 3T0JA 2PYYA 2FNCA 3LC8A 4QFKA 4G4PA 1N7WA 1XS5A 3MQ9A 4XKQA 1CE2A 1QUIA 2XHDA 4L17A 4K3FA 1P1UA 4F18A 1SD3A 2ZNUA 1B40A 5FHNA 4GFRA 4RY1A 2PBWA 3UP9A 1FRPA 3O66A 3LUYA 3R7XA 3E4RA 1B0HA 5EQ7A 5IZZA 4NE4A 3UN6A 1G0IA 3LSFB 2ZNTA 4N07A 4LP2B 1B5IA 4PFWA 4I40A 4GX6A 3G3IA 3VVFA 3IB0A 1MH3A 2GQ1A 4E0XA 3PV0E 4OTEA 3PPRA 1B2HA 1HSJA 2DXYA 4KFQA 1TT1A 1IITA 2RKMA 1Q9DA 3ECRA 2P3VA 4GXAA 1NH7A 4X9TA 1S7YA 3IOTA 2FYIA 3TQLA 4WEPA 2ANJA 1DOTA 5ICTA 4PE3A 5B7DA 2QJEA 5IM2A 2E0SA 1Y3QA 4MJOA 3K6XA 4THIA 5H8HB 5CMCA 3DM0A 3GXAA 1VDWA 3E3KA 3B50A 3MVWA 5IZ3A 5I5PA 1JQFA 3HHGA 4X8RA 5FTHA 1LAXA 4OYVA 3H6UA 1AOVA 1MXXA 2KLFA 2YLNA 1OQGA 3PD8A 3UORA 4YMBA 1YZ0A 2UVIA 2DS9A 1MY4A 4RNSA 3CR9A 4RPOA 1TXFA 4NMYA 4PAFA 2OPEA 3HPIA 3A09A 5I56B 4YU0A 2CZHA 2HAUA 5A5LA 1NH8A 2QS4A 5AE4A 1LBWA 4JXIA 4WEDA 3H4ZA 3FBPA 1NUWA 1TFAA 1B5JA 1YAEA 5CM6A 4KQPA 3CG3A 4GL0A 1UQWA 3F11A 4N4UA 2VHAA 3PUZE 1SBPA 1R9LA 4MMPA 2D21A 2PFZA 4Q30B 4YICA 3V8XB 1EZ9A 1K9YA 1UTHB 1Z7ME 1CB6A 3CI8A 1NV3A 1B0LA 3GBBA 3CFLA 1MY1A 3IOVA 1B5HA 3KBRA 2I49A 2I0CA 1MPCA 2VPNA 2FHYA 2XD3A 4G8HA 2I4BA 2WBBA 4KI0E 3T96B 3KOSA 3OD7A 3SEYA 1FQEA 1INPA 4PFTA 3SKPA 1NV2A 3O2AA 1FQFA 2DWJA 4NF8A 3KGCA 4LZ8A 2DYXA 3FXQA 1N7XA 2MKZA 4FEDA 2XXQA 1VR5A 4FJPA 5DYHA 2HFBA 1QW0A 3IX1A 4ZEDA 1LEVA 1B3FA 4U1OA 3K0VA 3N94A 4DLDA 1D4NA 1YTVA 1BIYA 3D4GA 1FW0A 4P1EA 2H99A 3DELB 4FECA 4I3EA 3SEUA 4MEVA 2HPGA 1FBHA 4NF6A 4P9KA 3ILUB 1B6HA 4OZ9A 1PC3A 1PB7A 3D1RA 3LV0A 1ZBMA 3IORA 3MVXA 1P1QA 5L9MA 3K1NA 3OENA 5IZ1A 2PMSA 5H8QA 1USYE 5AA4A 1MXVA 3LSWA 2DVCA 3MJNA 1FPBA 3B6TA 3KN3A 3HSTA 4AB5A 2DWAA 3HFUA 5I7IA 2P3NA 5H8NB 2B65A 1UIVA 1Y1ZA 5I2KB 2VPOA 3ZKKA 2I3VA 2B3FA 5EYGA 3P7IA 3DP8A 2GH9A 2Q2AA 1SW5A 4BDNA 4ZEKA 3PPPA 4MNPA 5H8NA 2LAOA 1I6AA 1FBEA 4QXDA 1R1NA 4NF5B 1SW4A 4ELRA 1Y3NA 2OX3A 1JVYA 2Z23A 2H98A 4EXLA 4MHFA 4NGUA 1II5A 2QMWA 4RYAA 3OO9A 3QK6A 3PTYA 5A5XA 2VP1A 1EYIA 3MAMA 4DI4B 1MQDA 3CIJA 4GQOA 2R71A 5DVFA 1FTLA 5I59B 1HSEA 3CHGA 4FIMA 2WBDA 1I69A 2OWSA 4JSDA 3FVOA 4HE0A 4G8MA 4GWSA 3MW0A 2F5XA 1LAGE 5KCJA 3FVNA
chains in the Genus database with same CATH topology
2QFLA 5F24A 1DK4A 4NX1A 5A5LA 4N8GA 2QVUA 5IZ1A 1RDXA 1IMFA 4AS4A 1NUZA 5EQ8A 4PC9A 1FPGA 1BK4A 4XEQA 1LBWA 3LUZA 3QMFA 5EQ7A 1FJ6A 1QGXA 4NAPA 3FBPA 1NUWA 5IZZA 1FBGA 2KQZA 5LTCA 5IZ3B 2Y5LA 4MIJA 4N6DA 4PCDA 5CM6A 4KXPA 4NN3A 4P8BA 4N6KA 2BJIA 1G0IA 1DBZA 1NV6A 2DE3A 4MCOA 1IMEA 4GWWA 2PCRA 2B4LA 3MSTA 1FBFA 4N4UA 2XWOA 1D9QA 1NI9A 1FPBA 4XF5A 4PFBA 5IGAA 2R8TA 4IR8A 4LN5A 2Q9TA 2ZZXA 3T1BA 4I40A 5T3JA 4GX6A 2FBPA 4QBAA 2V3QA 4GX3A 4MMPA 4F1UA 2GQ1A 2PFZA 3HFUA 4YICA 2P3NA 5I7IA 4GWXA 2QPQA 4YZZA 4GBWA 5ESYA 4JVIA 3IFAA 1EYJA 5DW8A 3W9WA 4OVTA 1K9YA 3B8BA 5JK4A 4OA4A 2VPOA 2Q8MA 3GYYA 4PF8A 4P56A 1DCUA 3MYUA 1EYKA 1FBCA 1FPLA 1NV3A 1NV5A 2Q74A 2WEFA 5LDZA 1Q9DA 2XA5A 4HCWA 1RDZA 3RYDA 4GWUA 2WX9A 1NV1A 1FBDA 1NV4A 4GX4A 2HZKA 1FBPA 3ROJA 4X04A 2P3VA 3KC0A 1FPDA 4PTKA 5EYGA 4N91A 4GWYA 1FPIA 2DDKA 2QVVA 3RPLA 5FBPA 2ZZVA 2DE2A 4PAIA 1SPIA 1JP4A 4M1VA 4OVRA 4MNIA 4OVQA 4NQ8A 4N81A 2CZIA 4O7IA 3KC1A 2VPNA 1KA0A 2FHYA 4N15A 4O7MA 5EQAA 4O8MA 4P1LA 4AS5A 4PBQA 4XFEA 1IMDA 4MNPA 2WBBA 3IFCA 2V4CA 1LBZA 1IMCA 4HE2A 2XWKA 4UABA 2OWZA 4OVSA 3FXBA 5ET6A 3RPLB 2CEXA 4PE3A 1LBYA 4F19A 4NHBA 2QVRA 5IM2A 1FBEA 4N17A 3E79A 4H45A 4N8YA 1INPA 4QXDA 4HXVA 4PETA 1FPKA 1LBXA 1NUXA 1KZ8A 1NV2A 1K9ZA 4HE1A 2JJKA 4MJOA 1YYZA 2FIXA 3NOHA 3E78A 1NV0A 2MKZA 1VDWA 2L5VA 4OANA 4PGNA 2OX3A 3BIHA 1IMBA 2DE4A 4MNCA 4NG7A 2PFYA 1CNQA 1RDYA 3B50A 1FSAA 5IZ3A 3EKIA 5EQ9A 4JVDA 5I5PA 4MHFA 4I3YA 4NGUA 1LEVA 3W9VA 1YXIA 2Y5KA 4PFIA 2VT5A 4X8RA 4F1VA 1NUYA 3PTYA 2F3DA 2B4MA 4P3LA 1EYIA 2HZLA 2HXRA 1LBVA 4DI4B 3KBZA 5I3SA 5ET7A 2XXKA 3ISPA 4P1EA 2F3BA 1FPJA 4GBVA 2DVZA 2WYKA 4P47A 1AWBA 1FJ9A 1KA1A 1NV7A 3T0JA 4MX6A 4DI3D 4GWZA 4I3EA 4PFRA 4JVCA 4HCYA 4PBHA 4MEVA 1FPFA 2HPGA 3CHGA 2WYPA 1FBHA 4OVPA 4PAKA 4PDHA 4P9KA 4MAGA 2CZKA 2WBDA 1FPEA 4PF6A 1IMAA 3U65A 5ET5A 1YZ0A 2KR0A 3D1RA 4FBPA 2ZZWA 4PGPA 1FTAA 4HE0A 4O94A 4G61A 2FIEA 3LV0A 2HHMA 3A29A 4H46A 5ET8A 1XI6A 3BIGA 4GWSA 4NF0A 4F18A 2F5XA 4X9TA 5EYHA 4PAFA 3SZPA 2FVZA 5J1DA 5J16A 2CEYA 4PDDA 1G0HA 2CZHA 2XWIA 2XWVA 1FRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFL A;  5F24 A;  1DK4 A;  5A5L A;  2QVU A;  5IZ1 A;  1RDX A;  1IMF A;  4AS4 A;  1NUZ A;  5EQ8 A;  1FPG A;  1BK4 A;  1LBW A;  3LUZ A;  3QMF A;  5EQ7 A;  1FJ6 A;  1QGX A;  3FBP A;  1NUW A;  1FBG A;  5IZ3 B;  2Y5L A;  4KXP A;  2BJI A;  1G0I A;  1DBZ A;  1NV6 A;  1IME A;  4GWW A;  2PCR A;  1FBF A;  1D9Q A;  1NI9 A;  1FPB A;  2R8T A;  4IR8 A;  4I40 A;  5T3J A;  4GX6 A;  2FBP A;  4GX3 A;  2GQ1 A;  2P3N A;  4GWX A;  4GBW A;  5ESY A;  3IFA A;  1EYJ A;  5DW8 A;  1K9Y A;  3B8B A;  2Q8M A;  1DCU A;  1EYK A;  1FBC A;  1FPL A;  1NV3 A;  1NV5 A;  2Q74 A;  2WEF A;  5LDZ A;  1Q9D A;  1RDZ A;  3RYD A;  4GWU A;  1NV1 A;  1FBD A;  1NV4 A;  4GX4 A;  1FBP A;  3ROJ A;  2P3V A;  3KC0 A;  1FPD A;  4PTK A;  5EYG A;  4GWY A;  1FPI A;  2DDK A;  2QVV A;  3RPL A;  5FBP A;  1SPI A;  1JP4 A;  4N81 A;  2CZI A;  4O7I A;  3KC1 A;  1KA0 A;  2FHY A;  5EQA A;  4AS5 A;  1IMD A;  2WBB A;  3IFC A;  1LBZ A;  1IMC A;  4HE2 A;  2OWZ A;  5ET6 A;  3RPL B;  1LBY A;  2QVR A;  1FBE A;  4H45 A;  1INP A;  4QXD A;  4HXV A;  1FPK A;  1LBX A;  1NUX A;  1KZ8 A;  1NV2 A;  1K9Z A;  4HE1 A;  2JJK A;  4MJO A;  1YYZ A;  2FIX A;  1NV0 A;  1VDW A;  2OX3 A;  3BIH A;  1IMB A;  1CNQ A;  1RDY A;  1FSA A;  5IZ3 A;  5EQ9 A;  4I3Y A;  1LEV A;  1YXI A;  2Y5K A;  2VT5 A;  1NUY A;  2F3D A;  1EYI A;  1LBV A;  3KBZ A;  5I3S A;  5ET7 A;  2F3B A;  1FPJ A;  4GBV A;  1AWB A;  1FJ9 A;  1KA1 A;  1NV7 A;  3T0J A;  4GWZ A;  4I3E A;  1FPF A;  1FBH A;  2CZK A;  2WBD A;  1FPE A;  1IMA A;  5ET5 A;  1YZ0 A;  3D1R A;  4FBP A;  1FTA A;  4HE0 A;  4G61 A;  2FIE A;  3LV0 A;  2HHM A;  3A29 A;  4H46 A;  5ET8 A;  1XI6 A;  3BIG A;  4GWS A;  5EYH A;  2FVZ A;  5J16 A;  1G0H A;  2CZH A;  1FRP A; 
#chains in the Genus database with same CATH topology
 3KN7 A;  1IXC A;  1MPD A;  2UYE A;  4QFL A;  4DIG A;  4FOR A;  1SI1 A;  4N6K A;  2XXU A;  3G7W A;  4YAH X;  3BBR A;  4XKR A;  1FCK A;  4POX A;  2QPQ A;  4JVI A;  4FAJ A;  3IFA A;  2GHA A;  2QS2 A;  5I84 A;  4Z0I A;  4LAT A;  1LCF A;  3A3C A;  1MPB A;  2XX7 A;  1EYK A;  4HCW A;  3H03 A;  1FBD A;  2HZK A;  1FPD A;  2PVU A;  3R26 A;  3G3F A;  1SPI A;  4OVR A;  3MZ9 A;  1SQY A;  2AIX A;  3TEP A;  1PBQ A;  4RK9 A;  5EQA A;  2QMX A;  5TU0 A;  3FXB A;  2DWH A;  4H45 A;  4KCD A;  2W7Y A;  1K9Z A;  1RKM A;  3QSL A;  1S50 A;  4GXS B;  4U1Z A;  2XXW A;  4ELO A;  4PGN A;  4MFI A;  5KZT A;  3FUZ A;  3W9V A;  3BFT A;  1GR2 A;  3H3G A;  4QF9 A;  5I59 A;  2B4M A;  2X26 A;  2YPN A;  1MM7 A;  4XTC Q;  4P47 A;  1NV7 A;  1FQA A;  4MX6 A;  4JVC A;  4XKP A;  4HCY A;  4XKN A;  3GLB A;  4P0G A;  2Y7K A;  3U65 A;  4OET A;  1FQC A;  3C34 A;  4PGP A;  1A8F A;  2Q8J A;  1LFG A;  3KFM A;  2I3W A;  3MPK A;  1MDQ A;  4MBP A;  4DCY A;  1DTG A;  1LAH E;  2GFE A;  2QFL A;  3MP8 A;  1DK4 A;  1MRP A;  1I6Q A;  2XX9 A;  1BK4 A;  2G93 A;  3O28 A;  2RC7 A;  5IZ3 B;  2ZNS A;  1GV8 A;  3Q28 A;  2P1S A;  1BP5 A;  1MH4 A;  3FJG A;  3Q27 A;  4O3B A;  3FJM A;  1IXI A;  2HCA A;  4QSE A;  3QAX A;  4F39 A;  5ESY A;  3G3J A;  5AA2 B;  4ZEI A;  3O6G A;  2Q74 A;  3IO4 A;  2ONK E;  4BDL A;  4GX4 A;  3ROJ A;  1JET A;  3B7D A;  4PTK A;  1S9T A;  2DE2 A;  1B3H A;  1XVY A;  3RT8 A;  4UAB A;  1ELJ A;  3TMG A;  2CEX A;  2UXA A;  2QVR A;  1NFT A;  4QSC A;  3SES A;  4HTG A;  3RTF B;  3KEI A;  3TQW A;  1B3L A;  2A5S A;  3K4U A;  3FJ7 A;  4PE5 B;  3BIH A;  1IMB A;  3AXF A;  2OK2 A;  4MNC A;  1ANF A;  4NG7 A;  4JBZ A;  2NOO A;  2CMO A;  1EU8 A;  1GTK A;  1YPN A;  4BDO A;  1LBV A;  1RYO A;  1TWY A;  1WDN A;  1ZTY A;  3ZKL A;  4GWO A;  3ZSF A;  1LFH A;  5JTY B;  2XXX A;  3K1P A;  2H25 A;  1IMA A;  4FAT A;  3VVE A;  3L6G A;  3Q25 A;  1XI6 A;  3PD9 A;  4QRZ A;  2XXY A;  3KZG A;  4G8N A;  4TOZ A;  3OMB A;  1NKX A;  3EHT A;  1N84 A;  3SEV A;  4H5G A;  1LST A;  2PT2 A;  3PMV A;  2XWI A;  3L6H A;  5CC2 A;  1DPP A;  2ONS A;  4FE8 A;  2O51 A;  1XVX A;  2OWT A;  5HPQ A;  4KXP A;  3ZS6 A;  5IAI A;  1FQD A;  5CMB A;  4ZEB A;  4OHN A;  3QXM A;  1YCJ A;  4RK2 A;  2ZZX A;  1SYH A;  4LQ2 A;  3PUW E;  4H6D A;  1ZIU A;  3N26 A;  2NVU B;  5EHM A;  2AL4 A;  4X04 A;  5TPA B;  4RA1 A;  3KC0 A;  1N3X A;  3OEK A;  1B7U A;  1JNF A;  1Y9U A;  2RF1 A;  4F3G A;  4JSO A;  3FAS A;  1LBY A;  4H5F A;  2B3B A;  4Q5T A;  1NV0 A;  5K2X A;  2DE4 A;  4ZS9 A;  3HN0 A;  3QIM A;  5I2K A;  4H8I A;  4YKK A;  3B6W A;  2F6G A;  1H45 A;  3K1M A;  2F7A A;  2O7I A;  3EN3 A;  4KCC A;  3Q26 A;  3RUM A;  2G29 A;  2DP8 A;  4ZE9 A;  4IY5 A;  4LVQ A;  1US4 A;  1FTO A;  3E9X A;  2I48 A;  1NL5 A;  3LBS A;  2ZZW A;  2QS3 A;  4DCX A;  2E1S A;  2FIE A;  1M5E A;  2RIN A;  3LR1 A;  5H8H A;  4MLQ A;  4I9D A;  1EH3 A;  4ND9 A;  5AA3 A;  2DWI A;  1VSO A;  5EYH A;  1NNF A;  3RT6 B;  3IAZ A;  3SEW A;  1SI0 A;  2CEY A;  2XXH A;  1H3D A;  4WXJ A;  1FTM A;  3U93 A;  1NUZ A;  4XEQ A;  1PB8 A;  3USD A;  3OEL A;  3VV5 A;  4I62 A;  1B3E A;  1D9Q A;  3KG2 A;  4IR8 A;  3T1B A;  2X7Q A;  2V3Q A;  3T9U A;  4GBW A;  1B52 A;  1AL3 A;  2Y7R A;  4EQ9 A;  3OSR A;  4R6K A;  4F3S A;  4DE8 A;  2DOJ A;  1B7Z A;  3FXU A;  4Q8R A;  2QVV A;  1H43 A;  3K6V A;  4OVQ A;  3IJO B;  3T93 B;  4N81 A;  4O7I A;  3I5O A;  2OJT A;  1AMF A;  3KN8 A;  1AH5 A;  4YKP A;  1LBX A;  4PDH A;  3NOH A;  2FIX A;  1DSN A;  4N13 A;  4R75 A;  2O69 A;  1QKB A;  3OEM A;  1FSA A;  1YXI A;  4PFI A;  4E0W A;  1XC1 A;  1JW4 A;  1XT8 A;  4H65 A;  4ESX A;  4EUO A;  1B05 A;  4LZ7 A;  3TUS A;  3GBA A;  4PFR A;  4O3C A;  4OVJ A;  2WYP A;  5M2V A;  2CZK A;  4EXK A;  1FPE A;  1Y1M A;  5HM4 B;  5F1Q A;  4FBP A;  4YB7 A;  4WKM A;  3TCG A;  3VLW A;  3I6V A;  4OFJ A;  2OBG A;  3O29 A;  3K6W A;  3T9H B;  4U2R A;  5EQ8 A;  4PC9 A;  5EHS A;  4GOT A;  4GL8 A;  1MXY A;  4MIJ A;  4NN3 A;  4OEV A;  2H4I A;  2B4L A;  3CSB A;  3O9P A;  1VFE A;  5L9S A;  5ISU A;  1A7L A;  3IB2 A;  1MQG A;  4NF4 A;  4H0W A;  3FD3 A;  1NNK A;  4EF1 A;  3FV2 A;  3KSJ A;  4GF8 A;  4ECF A;  3V83 A;  2HEU A;  1FBC A;  5DTB A;  1MS7 A;  2I58 A;  5AA4 B;  2REG A;  2ZZV A;  4MNI A;  3FGS A;  3HV1 A;  4XFE A;  4IO2 A;  1N0T A;  3IFC A;  2F34 A;  1IQ7 A;  3RQT A;  1PEB A;  4KYS A;  1LBC A;  2THI A;  1YYZ A;  3IK6 B;  5ICQ A;  5TP9 A;  2PFY A;  1RDY A;  3B6Q A;  4I3Y A;  5JEI A;  2A5T A;  3T9X B;  3THI A;  4IO7 A;  3TAJ A;  2HZL A;  3PMW A;  3QUJ A;  5I3S A;  2Z8F A;  1PBP A;  3BKI B;  1URS A;  1FJ9 A;  3IO6 A;  2ZYK A;  1A54 A;  4IB2 A;  1POY 1;  4MAG A;  5HBC A;  2QRY A;  1MDP 1;  2O68 A;  4PP0 A;  4KR5 A;  3FAT A;  3BIG A;  3OO8 A;  3PUY E;  4NF0 A;  1GGG A;  2A5T B;  4PDD A;  1ATG A;  4X1B A;  4NX1 A;  2OZZ A;  2F35 A;  1XOC A;  1FPG A;  2RCA A;  1B3G A;  1IEJ A;  3O6I A;  2V3T A;  5L9O A;  3KJ7 A;  2REJ A;  2P2A A;  2R6G E;  1SDX A;  1IME A;  4GWW A;  3TFL A;  1FBF A;  1MQJ A;  3D4C A;  4IO4 A;  1NNT A;  4ZZA A;  4GRK A;  2PX1 A;  5DW8 A;  1EYJ A;  1O64 A;  5JK4 A;  4PFY A;  2Q8M A;  4PF8 A;  4NF5 A;  1WVJ A;  1Z7N E;  3MP1 A;  3EF7 A;  3HCQ A;  2V25 A;  4FEB A;  4DDD A;  2V3U A;  5AA2 A;  2RC9 A;  4IO6 A;  2QSX A;  3U1O A;  3G3H A;  1OMP A;  3MVZ A;  3K02 A;  3CG1 A;  2XWK A;  3OOA A;  5I56 A;  4IO3 A;  4XXU A;  1POT A;  1D9Y A;  1XHY A;  4IGR A;  2OPD A;  4PET A;  4HE1 A;  2JJK A;  5K2Y A;  3PPO A;  3MP6 A;  1Y20 A;  2AL5 A;  2Y84 A;  4UAC A;  5EQ9 A;  3SDF A;  3JZJ A;  4ONY A;  3LSL A;  3T66 A;  3LSX A;  1ZU0 A;  1KA1 A;  1MQH A;  1IUD A;  1MXU A;  1MY2 A;  3JYR A;  3KJT A;  4PF6 A;  5H8Q B;  2XXT A;  4BDM A;  1M5F A;  2HHM A;  4F3B A;  5JTY A;  2X7P A;  3SZP A;  2FVZ A;  3IR1 A;  2QL3 A;  3MC2 A;  3K00 A;  1SW1 A;  4N8G A;  5KDT B;  3O6H A;  3VLV A;  4NTL A;  5TP9 B;  1QGX A;  2H5Y A;  4OXV A;  1B1H A;  3PU5 A;  2PCR A;  4IY6 A;  1URD A;  3SEX A;  2VOZ A;  3N6U A;  1VE4 A;  5EYF A;  4G68 C;  5DT6 A;  2CZL A;  3FIR A;  4OVT A;  3FV1 A;  4R6H A;  2ZYM A;  1B58 A;  4NF8 B;  3CFZ A;  2P0S A;  4OFO A;  1USY H;  4GWY A;  1J1N A;  3RPL A;  2RC8 A;  5I58 A;  5FHO A;  2CZI A;  3DLN A;  2F7B A;  3MWB A;  3E78 A;  2V4C A;  1LBZ A;  4HE2 A;  3DP4 A;  1US5 A;  2XX8 A;  3QUF A;  1A40 A;  2Y7I A;  1B46 A;  4HXV A;  4GLI A;  4R9G A;  1PB9 A;  3ONM A;  1EZO A;  3OO7 A;  4NWC A;  5H8S A;  2DQV A;  1WOD A;  3HHF A;  3TDJ A;  4ZEC A;  4JWY A;  3U92 A;  5I2N B;  1T0K A;  4F31 B;  5CI5 A;  3OO6 A;  3PPQ A;  2PT1 A;  3JV9 A;  4OWD A;  4U23 A;  5J1D A;  3TEL A;  2XD2 A;  2Y7P A;  2ZXT A;  3QMF A;  4OES A;  2IA4 A;  1SVX B;  2ALU A;  1OIB A;  4KYD A;  4OQO A;  1M5B A;  4XF5 A;  4PFB A;  3U72 A;  4ZDM A;  3I3V A;  1JW1 A;  4QBA A;  2ESN A;  3FVK A;  4U21 A;  4GWX A;  3B8B A;  5TPA A;  3CSG A;  3GYY A;  1DCU A;  4DI3 D;  2WEF A;  2I0B A;  2XA5 A;  3M3K A;  4O3A A;  1Y4T A;  1ZJL A;  3H6V A;  1FPI A;  4M1V A;  4DXU A;  4YKI A;  2Q89 A;  1KA0 A;  4PBQ A;  4C1T A;  3UK4 A;  1JW5 A;  4N17 A;  4DZ1 A;  1MQI A;  4R6Y A;  3C4M A;  2F8D A;  3RGY A;  2H9B A;  3E13 X;  1ZKB A;  2UVJ A;  4RXL A;  4HS7 A;  2VT5 A;  2UYF A;  3U94 A;  1MG1 A;  1A55 A;  1O63 A;  3CFX A;  3FXR A;  4BDR A;  1NMU A;  2AYS A;  3S9E A;  4ESW A;  2NWJ A;  3U8Q A;  1R9Q A;  4NF6 B;  4G68 B;  3TPA A;  1HSL A;  3EHU A;  1Q1K A;  5J16 A;  1O7T A;  5FHM A;  1OLC A;  1QKA A;  5F24 A;  1LB8 A;  5BUU A;  3EHS A;  3WAF A;  3MUQ A;  1B1X A;  1F9B A;  3S4U A;  2KQZ A;  3N5L A;  3K2D A;  4LUB A;  3WAE A;  2F36 A;  1DBZ A;  4ZE8 A;  3MST A;  5IGA A;  4YB5 A;  4GX3 A;  1QUK A;  4LQ5 A;  4F22 A;  1A8E A;  3TYH A;  4Q0C A;  2HAV A;  3MYU A;  1NV4 A;  4ZEF A;  4R2B A;  2F7C A;  1QJM A;  3OSQ A;  1JP4 A;  3KC1 A;  1UTB A;  2O6A A;  4JWX A;  3MZB A;  5ET6 A;  3TZA A;  3TTK A;  4KD5 A;  3MBP A;  4NWD A;  4IO5 A;  4OAN A;  1A99 A;  4M4G A;  3VVD A;  3IL1 B;  4G68 A;  2FA7 A;  3EKI A;  4JVD A;  4JWO A;  2Y5K A;  2F3D A;  1URG A;  3UGW A;  3M8U A;  2HXW A;  4R9F A;  5I57 B;  2WYK A;  4ELP A;  1AWB A;  1IXG A;  3C9H A;  1VFD A;  4ZZE A;  2D5W A;  3DP6 A;  4UA8 A;  4MLV A;  2WKY A;  1FTA A;  1OQH A;  4F29 A;  1AIV A;  1IIW A;  1RYX A;  1ZMG A;  5CBS A;  4Z7E A;  3Q29 A;  2V84 A;  3H6W A;  4IGT A;  1G0H A;  3VXB A;  2F97 A;  3GZG A;  2HQ0 A;  1RDX A;  1IZ1 A;  1IMF A;  1PDA A;  4LON B;  5LTC A;  4XIG Q;  1BKA A;  1LFI A;  4R73 A;  3VDF A;  4MCO A;  4QFO A;  4YKJ A;  2Z22 A;  5I57 A;  3PUV E;  5T3J A;  2FBP A;  1D3K A;  1LAF E;  1LGB C;  4YZZ A;  5B70 A;  2V93 A;  2I4C A;  4BLA A;  1QUL A;  2DXR A;  4P56 A;  1FPL A;  4GVO A;  4RPN A;  3V5A A;  1NV1 A;  1ZLQ A;  1NNP A;  3IOW A;  2I6E A;  2DDK A;  4O7M A;  1LBB A;  4P1L A;  1JEV A;  4U4S A;  4QHQ A;  2OWZ A;  4I1D A;  4NHB A;  5FTI A;  4QFP A;  4F2Q A;  1KZ8 A;  4GD5 A;  4HW8 A;  2L5V A;  3O97 A;  4LA9 A;  3ILT B;  3OXN A;  4G77 A;  1NUY A;  5KCJ B;  4P3L A;  3EPE A;  2BJJ X;  3PPN A;  3ISP A;  2GRV A;  1FPJ A;  4ELQ A;  5IKB A;  1BLF A;  3M3F A;  2D3I A;  3C35 A;  2Z8D A;  3MPL A;  3K6U A;  1H76 A;  3MZ1 A;  3A29 A;  1QUJ A;  4U22 A;  4GBV A;  4MF3 A;  1P99 A;  2QVU A;  2R9J A;  1FBG A;  1JEU A;  2OLB A;  1GVC A;  2BJI A;  3T22 A;  1R6Z A;  3EQ1 A;  2DE3 A;  2XWO A;  5DVJ A;  4LN5 A;  5LOM A;  4F1U A;  2QS1 A;  1Q35 A;  4H1X A;  3RY3 A;  4QFN A;  1KWH A;  5LDZ A;  1RDZ A;  1B4Z A;  1N76 A;  3C36 A;  3RTW B;  3TCH A;  5FBP A;  3C33 A;  1B32 A;  5KDT A;  4AQ4 A;  3MVY A;  2OCU A;  1M5D A;  2O1L A;  5I58 B;  3VE1 B;  4POW A;  1B4H A;  2O1M A;  4OEN A;  2F78 A;  1CNQ A;  3PGF A;  4P0I A;  3TTL A;  4F1V A;  1OVT A;  1B9J A;  4PFU A;  1BTJ A;  3T9V A;  3RN8 A;  2HXR A;  5ELV A;  2O84 X;  4PQJ A;  4NED A;  4X1D A;  4KHZ E;  4PBH A;  5CMM A;  3BFU A;  1I6B A;  5DVI A;  5ET5 A;  1MXZ A;  2M8C A;  2ZYO A;  1FTJ A;  5H8F B;  3TCF A;  4X48 A;  4C1U A;  2XXI A;  4O94 A;  4DXB A;  4G61 A;  3N6T A;  4H46 A;  5ET8 A;  2UVH A;  3A3U A;  4OER A;  4OEU A;  4F1Y A;  4F3P A;  3S9L C;  2GHB A;  3TKD A;  4AS4 A;  3RPW A;  3C32 A;  5A5X B;  1SYI A;  5AA2 D;  3LUZ A;  2ZMB A;  1FJ6 A;  4NAP A;  3V89 B;  1D9V A;  5ITO A;  3S2V A;  4P11 A;  1NV6 A;  3UIF A;  4DXC A;  1NI9 A;  1Y4C A;  4QSD A;  1IXH A;  3K01 A;  2O7U A;  2VGQ A;  1DPE A;  4OMB A;  3H6T A;  2Q2C A;  1N04 A;  4N6P A;  2WX9 A;  1FBP A;  1OLA A;  1P1O A;  2ONR A;  1LCT A;  3VLU A;  3C31 A;  3SER A;  1TFD A;  4TQU Q;  2XXP A;  1DMB A;  2XXV A;  4O8M A;  4AS5 A;  2ABH A;  1IMD A;  4F19 A;  3RPL B;  3PMX A;  4JB7 A;  3E79 A;  1JVX A;  2DSF A;  1EZP A;  2IEE A;  3CVG A;  1UIU A;  3PUX E;  4BDQ A;  1B7H A;  4TLM B;  5BWJ A;  3SET A;  4JDF A;  3RNN A;  3TOD A;  4R74 A;  3KBZ A;  3M3L A;  2XXK A;  5AA1 A;  3S9M C;  2F3B A;  2DVZ A;  4YMA A;  4MH5 A;  3G3K A;  4GWZ A;  5H8F A;  3KOT A;  1FPF A;  4OVP A;  1M5C A;  4PAK A;  5DEX A;  4R2F A;  2Q88 A;  1B51 A;  3G3G A;  1FQB A;  2KR0 A;  2Z8E A;  5DEX B;  3S9N C;  2UVG A;  4KPT A;  5ITP A;  3UA8 A;  5CRY A;  2YJP A;  1OVB A;  2XWV A;  1UTB B;  3FZV A;  2Y7W A;  1L5T A;  1H44 A;  1LLS A;  4LZ5 A;  3VXC A;  4N6D A;  2Y5L A;  4PCD A;  4P8B A;  1SW2 A;  3IOU A;  5CMK A;  3ODB A;  2R8T A;  2Q9T A;  4R72 A;  1QVS A;  3W15 C;  4NF4 B;  5F7V A;  1MY0 A;  3W9W A;  3H7M A;  1N3W A;  4OA4 A;  3HO7 A;  3TTM A;  3IB1 A;  5L8D A;  1NV5 A;  4EDP A;  3RYD A;  4GWU A;  1UTH A;  3TTN A;  1DTZ A;  1MY3 A;  1MM6 A;  3FVG A;  4I8C A;  4OFL A;  4N91 A;  4C0R A;  5CBR A;  1P1W A;  4G2Z A;  1Y3P A;  2XXR A;  4PAI A;  4U4X A;  4YB6 A;  4EQB A;  4NQ8 A;  3H06 B;  2VD2 A;  3KSX A;  4EF2 A;  4N15 A;  1MXW A;  3RLF E;  1IMC A;  2ZYN A;  4OVS A;  4N8Y A;  2RCB A;  2NUV A;  4GIZ A;  1FPK A;  1NUX A;  2F6P A;  4EQ7 A;  4AB6 A;  4ISU A;  4H67 A;  4TLL B;  3QYT A;  3CRB A;  1FTK A;  2VD3 A;  4KYE A;  3VFJ A;  4RJZ A;  4H8J A;  1P1N A;  5I2N A;  3IJX B;  5ET7 A;  3R6U A;  1LB9 A;  4F2O A;  3TTR A;  2NXO A;  3T0J A;  2PYY A;  2FNC A;  3LC8 A;  4QFK A;  4G4P A;  1N7W A;  1XS5 A;  3MQ9 A;  4XKQ A;  1CE2 A;  1QUI A;  2XHD A;  4L17 A;  4K3F A;  1P1U A;  4F18 A;  1SD3 A;  2ZNU A;  1B40 A;  5FHN A;  4GFR A;  4RY1 A;  2PBW A;  3UP9 A;  1FRP A;  3O66 A;  3LUY A;  3R7X A;  3E4R A;  1B0H A;  5EQ7 A;  5IZZ A;  4NE4 A;  3UN6 A;  1G0I A;  3LSF B;  2ZNT A;  4N07 A;  4LP2 B;  1B5I A;  4PFW A;  4I40 A;  4GX6 A;  3G3I A;  3VVF A;  3IB0 A;  1MH3 A;  2GQ1 A;  4E0X A;  3PV0 E;  4OTE A;  3PPR A;  1B2H A;  1HSJ A;  2DXY A;  4KFQ A;  1TT1 A;  1IIT A;  2RKM A;  1Q9D A;  3ECR A;  2P3V A;  4GXA A;  1NH7 A;  4X9T A;  1S7Y A;  3IOT A;  2FYI A;  3TQL A;  4WEP A;  2ANJ A;  1DOT A;  5ICT A;  4PE3 A;  5B7D A;  2QJE A;  5IM2 A;  2E0S A;  1Y3Q A;  4MJO A;  3K6X A;  4THI A;  5H8H B;  5CMC A;  3DM0 A;  3GXA A;  1VDW A;  3E3K A;  3B50 A;  3MVW A;  5IZ3 A;  5I5P A;  1JQF A;  3HHG A;  4X8R A;  5FTH A;  1LAX A;  4OYV A;  3H6U A;  1AOV A;  1MXX A;  2KLF A;  2YLN A;  1OQG A;  3PD8 A;  3UOR A;  4YMB A;  1YZ0 A;  2UVI A;  2DS9 A;  1MY4 A;  4RNS A;  3CR9 A;  4RPO A;  1TXF A;  4NMY A;  4PAF A;  2OPE A;  3HPI A;  3A09 A;  5I56 B;  4YU0 A;  2CZH A;  2HAU A;  5A5L A;  1NH8 A;  2QS4 A;  5AE4 A;  1LBW A;  4JXI A;  4WED A;  3H4Z A;  3FBP A;  1NUW A;  1TFA A;  1B5J A;  1YAE A;  5CM6 A;  4KQP A;  3CG3 A;  4GL0 A;  1UQW A;  3F11 A;  4N4U A;  2VHA A;  3PUZ E;  1SBP A;  1R9L A;  4MMP A;  2D21 A;  2PFZ A;  4Q30 B;  4YIC A;  3V8X B;  1EZ9 A;  1K9Y A;  1UTH B;  1Z7M E;  1CB6 A;  3CI8 A;  1NV3 A;  1B0L A;  3GBB A;  3CFL A;  1MY1 A;  3IOV A;  1B5H A;  3KBR A;  2I49 A;  2I0C A;  1MPC A;  2VPN A;  2FHY A;  2XD3 A;  4G8H A;  2I4B A;  2WBB A;  4KI0 E;  3T96 B;  3KOS A;  3OD7 A;  3SEY A;  1FQE A;  1INP A;  4PFT A;  3SKP A;  1NV2 A;  3O2A A;  1FQF A;  2DWJ A;  4NF8 A;  3KGC A;  4LZ8 A;  2DYX A;  3FXQ A;  1N7X A;  2MKZ A;  4FED A;  2XXQ A;  1VR5 A;  4FJP A;  5DYH A;  2HFB A;  1QW0 A;  3IX1 A;  4ZED A;  1LEV A;  1B3F A;  4U1O A;  3K0V A;  3N94 A;  4DLD A;  1D4N A;  1YTV A;  1BIY A;  3D4G A;  1FW0 A;  4P1E A;  2H99 A;  3DEL B;  4FEC A;  4I3E A;  3SEU A;  4MEV A;  2HPG A;  1FBH A;  4NF6 A;  4P9K A;  3ILU B;  1B6H A;  4OZ9 A;  1PC3 A;  1PB7 A;  3D1R A;  3LV0 A;  1ZBM A;  3IOR A;  3MVX A;  1P1Q A;  5L9M A;  3K1N A;  3OEN A;  5IZ1 A;  2PMS A;  5H8Q A;  1USY E;  5AA4 A;  1MXV A;  3LSW A;  2DVC A;  3MJN A;  1FPB A;  3B6T A;  3KN3 A;  3HST A;  4AB5 A;  2DWA A;  3HFU A;  5I7I A;  2P3N A;  5H8N B;  2B65 A;  1UIV A;  1Y1Z A;  5I2K B;  2VPO A;  3ZKK A;  2I3V A;  2B3F A;  5EYG A;  3P7I A;  3DP8 A;  2GH9 A;  2Q2A A;  1SW5 A;  4BDN A;  4ZEK A;  3PPP A;  4MNP A;  5H8N A;  2LAO A;  1I6A A;  1FBE A;  4QXD A;  1R1N A;  4NF5 B;  1SW4 A;  4ELR A;  1Y3N A;  2OX3 A;  1JVY A;  2Z23 A;  2H98 A;  4EXL A;  4MHF A;  4NGU A;  1II5 A;  2QMW A;  4RYA A;  3OO9 A;  3QK6 A;  3PTY A;  5A5X A;  2VP1 A;  1EYI A;  3MAM A;  4DI4 B;  1MQD A;  3CIJ A;  4GQO A;  2R71 A;  5DVF A;  1FTL A;  5I59 B;  1HSE A;  3CHG A;  4FIM A;  2WBD A;  1I69 A;  2OWS A;  4JSD A;  3FVO A;  4HE0 A;  4G8M A;  4GWS A;  3MW0 A;  2F5X A;  1LAG E;  5KCJ A;  3FVN A; 
#chains in the Genus database with same CATH homology
 2QFL A;  5F24 A;  1DK4 A;  4NX1 A;  5A5L A;  4N8G A;  2QVU A;  5IZ1 A;  1RDX A;  1IMF A;  4AS4 A;  1NUZ A;  5EQ8 A;  4PC9 A;  1FPG A;  1BK4 A;  4XEQ A;  1LBW A;  3LUZ A;  3QMF A;  5EQ7 A;  1FJ6 A;  1QGX A;  4NAP A;  3FBP A;  1NUW A;  5IZZ A;  1FBG A;  2KQZ A;  5LTC A;  5IZ3 B;  2Y5L A;  4MIJ A;  4N6D A;  4PCD A;  5CM6 A;  4KXP A;  4NN3 A;  4P8B A;  4N6K A;  2BJI A;  1G0I A;  1DBZ A;  1NV6 A;  2DE3 A;  4MCO A;  1IME A;  4GWW A;  2PCR A;  2B4L A;  3MST A;  1FBF A;  4N4U A;  2XWO A;  1D9Q A;  1NI9 A;  1FPB A;  4XF5 A;  4PFB A;  5IGA A;  2R8T A;  4IR8 A;  4LN5 A;  2Q9T A;  2ZZX A;  3T1B A;  4I40 A;  5T3J A;  4GX6 A;  2FBP A;  4QBA A;  2V3Q A;  4GX3 A;  4MMP A;  4F1U A;  2GQ1 A;  2PFZ A;  3HFU A;  4YIC A;  2P3N A;  5I7I A;  4GWX A;  2QPQ A;  4YZZ A;  4GBW A;  5ESY A;  4JVI A;  3IFA A;  1EYJ A;  5DW8 A;  3W9W A;  4OVT A;  1K9Y A;  3B8B A;  5JK4 A;  4OA4 A;  2VPO A;  2Q8M A;  3GYY A;  4PF8 A;  4P56 A;  1DCU A;  3MYU A;  1EYK A;  1FBC A;  1FPL A;  1NV3 A;  1NV5 A;  2Q74 A;  2WEF A;  5LDZ A;  1Q9D A;  2XA5 A;  4HCW A;  1RDZ A;  3RYD A;  4GWU A;  2WX9 A;  1NV1 A;  1FBD A;  1NV4 A;  4GX4 A;  2HZK A;  1FBP A;  3ROJ A;  4X04 A;  2P3V A;  3KC0 A;  1FPD A;  4PTK A;  5EYG A;  4N91 A;  4GWY A;  1FPI A;  2DDK A;  2QVV A;  3RPL A;  5FBP A;  2ZZV A;  2DE2 A;  4PAI A;  1SPI A;  1JP4 A;  4M1V A;  4OVR A;  4MNI A;  4OVQ A;  4NQ8 A;  4N81 A;  2CZI A;  4O7I A;  3KC1 A;  2VPN A;  1KA0 A;  2FHY A;  4N15 A;  4O7M A;  5EQA A;  4O8M A;  4P1L A;  4AS5 A;  4PBQ A;  4XFE A;  1IMD A;  4MNP A;  2WBB A;  3IFC A;  2V4C A;  1LBZ A;  1IMC A;  4HE2 A;  2XWK A;  4UAB A;  2OWZ A;  4OVS A;  3FXB A;  5ET6 A;  3RPL B;  2CEX A;  4PE3 A;  1LBY A;  4F19 A;  4NHB A;  2QVR A;  5IM2 A;  1FBE A;  4N17 A;  3E79 A;  4H45 A;  4N8Y A;  1INP A;  4QXD A;  4HXV A;  4PET A;  1FPK A;  1LBX A;  1NUX A;  1KZ8 A;  1NV2 A;  1K9Z A;  4HE1 A;  2JJK A;  4MJO A;  1YYZ A;  2FIX A;  3NOH A;  3E78 A;  1NV0 A;  2MKZ A;  1VDW A;  2L5V A;  4OAN A;  4PGN A;  2OX3 A;  3BIH A;  1IMB A;  2DE4 A;  4MNC A;  4NG7 A;  2PFY A;  1CNQ A;  1RDY A;  3B50 A;  1FSA A;  5IZ3 A;  3EKI A;  5EQ9 A;  4JVD A;  5I5P A;  4MHF A;  4I3Y A;  4NGU A;  1LEV A;  3W9V A;  1YXI A;  2Y5K A;  4PFI A;  2VT5 A;  4X8R A;  4F1V A;  1NUY A;  3PTY A;  2F3D A;  2B4M A;  4P3L A;  1EYI A;  2HZL A;  2HXR A;  1LBV A;  4DI4 B;  3KBZ A;  5I3S A;  5ET7 A;  2XXK A;  3ISP A;  4P1E A;  2F3B A;  1FPJ A;  4GBV A;  2DVZ A;  2WYK A;  4P47 A;  1AWB A;  1FJ9 A;  1KA1 A;  1NV7 A;  3T0J A;  4MX6 A;  4DI3 D;  4GWZ A;  4I3E A;  4PFR A;  4JVC A;  4HCY A;  4PBH A;  4MEV A;  1FPF A;  2HPG A;  3CHG A;  2WYP A;  1FBH A;  4OVP A;  4PAK A;  4PDH A;  4P9K A;  4MAG A;  2CZK A;  2WBD A;  1FPE A;  4PF6 A;  1IMA A;  3U65 A;  5ET5 A;  1YZ0 A;  2KR0 A;  3D1R A;  4FBP A;  2ZZW A;  4PGP A;  1FTA A;  4HE0 A;  4O94 A;  4G61 A;  2FIE A;  3LV0 A;  2HHM A;  3A29 A;  4H46 A;  5ET8 A;  1XI6 A;  3BIG A;  4GWS A;  4NF0 A;  4F18 A;  2F5X A;  4X9T A;  5EYH A;  4PAF A;  3SZP A;  2FVZ A;  5J1D A;  5J16 A;  2CEY A;  4PDD A;  1G0H A;  2CZH A;  2XWI A;  2XWV A;  1FRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...