2P3VA

Thermotoga maritima impase tm1415
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MDRLDFSIKLLRKVGHLLMIHWGRVDNVEKKTGFKDIVTEIDREAQRMIVDEIRKFFPDENIMAEEGIFEKGDRLWIIDPIDGTINFVHGLPNFSISLAYVENGEVKLGVVHAPALNETLYAEEGSGAFFNGERIRVSENASLEECVGSTGSYVDFTGKFIERMEKRTRRIRILGSAALNAAYVGAGRVDFFVTWRINPWDIAAGLIIVKEAGGMVTDFSGKEANAFSKNFIFSNGLIHDEVVKVVNEVVEEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the tetrameric inositol 1-phosphate phosphatase (TM1415) from the hyperthermophile, Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Inositol-1-monophosphatase
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2p3vA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2p3vA02
3IFCA 4I3YA 1IMCA 5IZ3A 3FBPA 2F3BA 4KXPA 5I3SA 1FPDA 3T0JA 2Y5LA 1NUXA 1JP4A 4GWWA 1FPIA 2JJKA 4I40A 1LBXA 5IZ1A 5IZ3B 4GX4A 3RPLB 1EYJA 3D1RA 4FBPA 2OX3A 5EQ9A 1IMEA 2PCRA 4G61A 2FIXA 2CZHA 1RDXA 2DDKA 1RDYA 4I3EA 2FBPA 2P3VA 1AWBA 1FPFA 1FPBA 2WEFA 3RPLA 4PTKA 5EYGA 2WBDA 4O7IA 1YYZA 1BK4A 5T3JA 1NUZA 3KBZA 2P3NA 5F24A 1SPIA 1NV2A 2QVRA 4H46A 2HHMA 1LBWA 1NV1A 4GWSA 4QXDA 1FJ6A 5EYHA 5ET8A 4AS4A 1KA0A 1K9ZA 4MJOA 1FPJA 2QVUA 1FPKA 1XI6A 5LDZA 1IMBA 5EQ8A 1FBHA 1NV0A 2VT5A 1NV4A 2Q8MA 4HE1A 3KC0A 1NV3A 2OWZA 1FPGA 3BIGA 5ESYA 3RYDA 1G0HA 3BIHA 2F3DA 1NUWA 1Q9DA 2R8TA 4HE0A 4GWYA 1DK4A 1LBZA 4GX3A 3QMFA 1CNQA 2Y5KA 1RDZA 1FBCA 2FVZA 1INPA 5ET5A 4N81A 2FIEA 1VDWA 5EQAA 2GQ1A 1FTAA 1G0IA 4AS5A 2CZKA 3B8BA 1IMAA 3A29A 1DCUA 1DBZA 5ET7A 5ET6A 4GWUA 2Q74A 1LBYA 1YXIA 1KA1A 1NV5A 3IFAA 1EYIA 1QGXA 1LBVA 1FBGA 4H45A 5EQ7A 1NUYA 2QFLA 5DW8A 4GX6A 1EYKA 4HE2A 1FBDA 1LEVA 3KC1A 1FPEA 2WBBA 4GWXA 1FJ9A 3LV0A 1FBPA 1YZ0A 1D9QA 3ROJA 2CZIA 1NI9A 4GBWA 1NV7A 1K9YA 4GBVA 1FBEA 2FHYA 1IMFA 1KZ8A 5A5LA 5J16A 1FSAA 1FPLA 1IMDA 2QVVA 1FRPA 3LUZA 4GWZA 4IR8A 4HXVA 2BJIA 1NV6A 5FBPA 1FBFA
chains in the Genus database with same CATH superfamily
4OERA 2XA5A 5AA2A 1FPDA 2ZZXA 1MY2A 3KEIA 3RPLB 2WYKA 2QS4A 1P1OA 4KR5A 2DXYA 3Q25A 1AWBA 4MHFA 4GL0A 5HPQA 1LAHE 1Y3QA 5F24A 2E0SA 1LBWA 1MXZA 4IB2A 5EYHA 3LSWA 1TFDA 4AS4A 5DVJA 4DCXA 3JZJA 4R75A 4OMBA 3LBSA 4TQUQ 4BDLA 1NV0A 2QMWA 1CE2A 2XXKA 4HE1A 3K6XA 1B58A 2P1SA 3MUQA 1Q9DA 1N0TA 3VVFA 5H8FA 2XXYA 3O6HA 4KI0E 5F7VA 5ET5A 2ZNSA 1ZLQA 3TPAA 2GFEA 4P1EA 4DXCA 4U4XA 2YLNA 1FTAA 2HXWA 3OSQA 1G0IA 4PP0A 4DIGA 3LSLA 1TWYA 4KCDA 4NEDA 5ITPA 3C31A 2B4LA 3IJOB 4YB7A 4RYAA 1LEVA 4MH5A 4PCDA 2VD3A 4QFNA 2GHAA 1D9QA 1S9TA 1NV7A 1K9YA 2V25A 4GIZA 4ZE9A 2ONKE 4XTCQ 4H8IA 3FASA 4IO2A 4XF5A 5I2NA 4FATA 1EZ9A 4U1OA 3E13X 1LLSA 1SW5A 4JSOA 1B3LA 3IFCA 1T0KA 3T0JA 1M5CA 3SESA 4MAGA 1B51A 4BDOA 4C1UA 5F1QA 3K1NA 4TLMB 3D4CA 2QS1A 3ZSFA 4QF9A 4NMYA 3HSTA 5I59B 1YAEA 4NF6A 4GRKA 1FBHA 1I6BA 4YKPA 3BIGA 3E3KA 3RY3A 4GWYA 1DK4A 3Q26A 2ONSA 4RY1A 2FVZA 3C36A 4PDHA 1A55A 1B1XA 5M2VA 5JTYB 5I5PA 3BFUA 1R1NA 2XXRA 4HW8A 1B3EA 1H45A 4ISUA 4FEBA 1BIYA 4JBZA 4PFBA 5I57A 5DW8A 3E4RA 3NOHA 1POTA 2F5XA 4YAHX 3GBBA 2UYFA 3TTMA 4XEQA 2H25A 1MDP1 3CR9A 3ILTB 3V8XB 2CEYA 4PF8A 1MS7A 5KDTA 1ZMGA 3N94A 1MG1A 2A5TB 2F6PA 4ELPA 4U4SA 4G68A 2DWHA 1BTJA 2QVVA 1XVXA 3OO6A 3C34A 4GF8A 3UP9A 5KDTB 4PE5B 4KYEA 4GD5A 1NUXA 2F97A 2Y7RA 5CBRA 4MLVA 2OX3A 4L17A 3IO6A 3PPPA 1LCFA 4Q8RA 2XXTA 4F3GA 2B65A 5EYGA 1B5JA 3TEPA 2DWIA 4NG7A 1O7TA 3MBPA 4O3AA 2OWTA 1GV8A 5FHNA 4NF4B 4F3BA 1YTVA 3MZ9A 1FTOA 1POY1 1USYE 4POXA 3KC0A 3PPNA 1NH7A 1FPGA 2ZZVA 5HBCA 1MM6A 5A5XB 3S4UA 4H67A 1IXCA 2IA4A 1VFDA 5IGAA 3RTFB 2FIEA 4OVJA 5AA3A 5IM2A 1TFAA 4PQJA 2G93A 2Z23A 1LBCA 1MQJA 2UVIA 3B8BA 3TTKA 5ET6A 3A09A 4P1LA 5H8NA 2G29A 5CBSA 1LB8A 3H7MA 3N6TA 2QS2A 4FIMA 2R71A 3PGFA 3QXMA 4KHZE 3MC2A 5I56B 4YB6A 2H5YA 1GVCA 1D3KA 1MXYA 2ZMBA 1B0HA 2KLFA 1SW4A 4OANA 4OFJA 4PAKA 3MVZA 3UGWA 3IO4A 3H06B 1Y1MA 1P1NA 4YICA 2I6EA 3VFJA 2THIA 1DSNA 1AH5A 4F3PA 1B1HA 2FA7A 5CMCA 2CZHA 5L9MA 1FPFA 3QAXA 1FPBA 3BKIB 4PETA 4PTKA 2Y7KA 1Z7NE 2QVRA 4H46A 4NGUA 4R6HA 4EQBA 4PFWA 4U1ZA 3O97A 4JVDA 4MJOA 3KFMA 2F36A 2ABHA 1EZOA 4H6DA 5CMKA 3V5AA 3ONMA 1MXUA 4EXKA 4Q30B 3RNNA 3FVGA 5I84A 4MFIA 2ANJA 1IITA 2CEXA 3OO9A 4P0IA 2GQ1A 1IEJA 3S2VA 2O7UA 3PUVE 5AE4A 4XFEA 4BDNA 1JW5A 2RCAA 1FBGA 3VXCA 4FE8A 4QRZA 4ZE8A 4GWXA 4OETA 4ZEBA 3TCGA 3T96B 5A5LA 1FSAA 1FPLA 2V93A 1FTKA 4DI3D 1SW2A 4GWZA 4I62A 4I9DA 3H03A 4QFPA 4HXVA 1Z7ME 2NUVA 3L6HA 2GRVA 2XXUA 4NF6B 3U92A 5I3SA 3R7XA 2B3FA 1NNPA 1JEVA 3MP8A 1OLAA 3T22A 4TOZA 1MQDA 4RXLA 2YPNA 2FIXA 3I5OA 1RDYA 2HAUA 2V3TA 1GGGA 4NF0A 1VSOA 1ZTYA 3MAMA 2WBDA 4RK9A 2O1LA 1NUZA 3W9WA 1OVBA 3CHGA 4QHQA 1DTGA 2V4CA 1FJ6A 1D4NA 5ET8A 3MZ1A 3PMVA 3HPIA 4N8YA 3QYTA 2PMSA 1NV4A 3IOVA 4OTEA 1XVYA 4H0WA 3KN7A 4RK2A 3CRBA 3GYYA 3TFLA 2REGA 3UORA 3FJMA 1INPA 1SI1A 1JW1A 2UXAA 4PC9A 4E0WA 5IZZA 3VE1B 2R6GE 4GQOA 4C0RA 2R9JA 3OO8A 4U21A 5ET7A 4IGTA 5TP9B 1UTHB 4EUOA 1FQFA 3OMBA 4NE4A 1H43A 3IR1A 4U23A 3PUXE 4GX6A 4MBPA 2HZKA 5L9SA 4OYVA 1MQIA 3IB0A 2D21A 2RF1A 2HAVA 3CSBA 4F29A 3FXUA 1S50A 5B7DA 4XKNA 1UIUA 1AL3A 3K01A 1US5A 4OEUA 4X1DA 4PF6A 4U2RA 4MNIA 1MPBA 4IR8A 3TKDA 3KOTA 2CZLA 4P3LA 3EN3A 4ZEDA 2D5WA 2UVHA 3FBPA 2F3BA 2F35A 1OVTA 4N07A 3UA8A 4GWWA 2XWIA 3LSXA 4DCYA 2I3VA 2ZNTA 1R9QA 2DDKA 1PEBA 3FV1A 4NQ8A 3VXBA 3OO7A 1QKBA 3H3GA 1UTHA 2F7AA 2Q9TA 1BP5A 3CFXA 5DEXB 1P99A 4X9TA 3PUWE 2X26A 4PFIA 1URSA 1KWHA 4YMAA 2DE4A 3SEWA 1K9ZA 3PPRA 5DTBA 1ELJA 4P9KA 5K2XA 5HM4B 1JW4A 4KYDA 1LSTA 4M4GA 5TPAB 1I69A 4FECA 4O3BA 4X8RA 4NF8A 4G68C 1LBZA 4EF1A 4PE3A 3HV1A 3GZGA 3OELA 4EQ9A 3S9NC 1ZIUA 1QKAA 2DXRA 4H1XA 1NV5A 1XHYA 1F9BA 3B6QA 4U22A 4ZZAA 3G3FA 4QFLA 2WBBA 3R26A 4JB7A 2QL3A 4Z0IA 5A5XA 4JWOA 4NF5A 4GBVA 1B0LA 3FXQA 1FBEA 2D3IA 5JTYA 3L6GA 1LFIA 1MH3A 3DM0A 3PTYA 1M5EA 4R2BA 4Q5TA 3F11A 4H65A 1N76A 1QJMA 3IB2A 3SERA 4LATA 4YB5A 1DPPA 4I3YA 4IO5A 4KXPA 1WVJA 2JJKA 5IZ1A 5IZ3B 1B5IA 1D9VA 3C32A 5I2KA 3N5LA 3FVKA 1JETA 1EZPA 1RKMA 4R2FA 2E1SA 3UN6A 1ANFA 2GHBA 2XX7A 4MIJA 2WEFA 3FZVA 5I59A 1BK4A 3K1MA 1Y20A 3TUSA 2PFZA 4R72A 1KA0A 2Y84A 1N3WA 3U94A 1NNKA 4N4UA 2Q2AA 2A5TA 3ISPA 1G0HA 1S7YA 2I58A 4G8MA 2M8CA 4KFQA 4F1UA 1R6ZA 4XXUA 1RDZA 1FBCA 4XKQA 5CMMA 3KG2A 1B46A 2XWKA 4O94A 3K02A 2O84X 3U93A 4RNSA 3IFAA 4MEVA 2XXPA 4OVQA 4R73A 4G2ZA 3MVWA 5DT6A 5FHOA 1FCKA 4N6DA 2H4IA 2WYPA 2BJJX 1IUDA 3PD9A 4LA9A 5FTIA 4OVPA 4EQ7A 1IXIA 5JEIA 4ZEKA 4HCYA 4PFRA 4F2QA 5TU0A 3TQWA 5IZ3A 3VLVA 4LVQA 2PFYA 3UIFA 3HHGA 3O9PA 3B6TA 2HZLA 5EQ9A 5L8DA 1AMFA 2VP1A 4F3SA 3FJGA 2WX9A 4OQOA 2XWOA 2Q88A 1N7XA 2AL5A 4G8NA 3RT6B 2P3NA 5LOMA 1Q1KA 2DP8A 2DVCA 2QPQA 1XS5A 3LUYA 1YCJA 4JVCA 2AYSA 3M8UA 3PU5A 2I48A 1BLFA 1XT8A 2DQVA 4H5GA 5AA2B 1LAGE 4PAIA 1FQDA 1O63A 3RT8A 2REJA 1NMUA 2UYEA 1IQ7A 4P0GA 1JQFA 2Y7PA 3CFLA 4OFLA 2XXIA 4AS5A 2CZKA 2UVGA 1IMAA 3EHUA 4POWA 4PBHA 2Q74A 2WKYA 3O66A 4YKKA 1SYIA 3RN8A 3VV5A 1LBVA 4PBQA 4GVOA 2I0CA 5IAIA 2DWJA 4THIA 1QUJA 1N04A 1TT1A 4EF2A 3U8QA 1Y3NA 1MDQA 5IKBA 4LZ8A 1IMDA 3KJTA 3VLUA 2PX1A 3GLBA 3MWBA 1PBPA 3CFZA 2KQZA 3Q29A 2LAOA 4NHBA 1MXXA 1FPIA 1M5FA 4JWXA 5LTCA 2ZZWA 3RQTA 4YMBA 1XC1A 3ODBA 2OPDA 1FQBA 3FGSA 1OIBA 2W7YA 4Z7EA 1NV2A 2B3BA 2ONRA 2B4MA 3K0VA 4NX1A 1FPKA 1XI6A 5LDZA 4OEVA 4PFYA 3SEYA 3BIHA 1FQEA 1JEUA 3LC8A 4LQ5A 5I7IA 1CNQA 1B2HA 4H8JA 1MY4A 2RINA 1A8EA 2H99A 3A29A 2V84A 1WODA 4PDDA 2HFBA 1YXIA 3ILUB 1EYIA 2RC9A 4MMPA 4QSEA 5I56A 2PT1A 3Q27A 3JYRA 2VOZA 2QS3A 4F18A 3WAFA 4JXIA 4WEPA 1SD3A 1PDAA 4GBWA 3B50A 3IOUA 1KZ8A 3CG3A 3HHFA 1P1WA 1N84A 4UACA 1ZKBA 5AA4B 2HCAA 3K4UA 1NV6A 4AB6A 5DVFA 5TP9A 2DE3A 1QVSA 5CI5A 2ZXTA 4I40A 1FTJA 1EU8A 1I6QA 1R9LA 4GXSB 3OOAA 3RPLA 2Q8JA 3H6VA 1NL5A 1II5A 1M5BA 4LUBA 2I49A 3SZPA 2XXXA 2VD2A 3G3IA 1NV1A 1IXGA 2XXWA 2RC7A 4OZ9A 3EPEA 3PUYE 5AA4A 3DP8A 1FPJA 5EQ8A 3GBAA 4DLDA 1SYHA 3KSXA 1SVXB 1NV3A 3RYDA 1M5DA 2P2AA 2XHDA 2X7QA 3BFTA 5ITOA 1Y3PA 4GX3A 3FVNA 3H6WA 2Y5KA 2DOJA 1MH4A 1QUIA 4ELQA 5AA2D 4DE8A 3FJ7A 4X04A 4KD5A 5EQAA 5H8HB 3ZKLA 1DBZA 4QSDA 1B7UA 3SETA 2OWSA 1NH8A 4BLAA 4G77A 4N17A 4YKJA 4DI4B 1DOTA 4GLIA 1US4A 2I0BA 1FBPA 2F8DA 1MPCA 3ROJA 4IY6A 4ESXA 2QJEA 4IGRA 1Y4TA 3MSTA 4RPNA 1SBPA 1ZU0A 2O6AA 1FTLA 2OZZA 1ATGA 3USDA 5H8QA 4NWDA 3FUZA 3TTRA 5L9OA 1DMBA 2HQ0A 2Q2CA 3PPOA 3C35A 3CI8A 1B3FA 4IO4A 3A3CA 3RPWA 4KQPA 1VR5A 4MF3A 4BDMA 1YPNA 4WXJA 4I3EA 3SEVA 3M3KA 5CMBA 1B6HA 3MW0A 3V89B 3IL1B 4G68B 2O7IA 3W15C 3IORA 5EYFA 1SPIA 3TTNA 1J1NA 3S9EA 4FEDA 4QXDA 3G3KA 4HS7A 3CIJA 3H6UA 3KN3A 2H9BA 4DZ1A 1IMBA 1MY0A 4PGPA 2Q89A 4LN5A 5I58B 3M3FA 3MYUA 2F3DA 2ZYMA 4E0XA 3DELB 5ICQA 3DLNA 3K1PA 3K6UA 3TAJA 4FAJA 2H98A 3FATA 3TCHA 3G7WA 4X48A 3B6WA 5EHMA 4N8GA 3T93B 1LBYA 3MJNA 1GR2A 1N7WA 2OBGA 1EH3A 3FVOA 1FPEA 1MPDA 5ICTA 4NAPA 1YZ0A 4WEDA 3SEXA 3OD7A 1RYXA 4IO6A 3P7IA 1IZ1A 1UTBA 3PV0E 3DP6A 3CSGA 3GXAA 2VHAA 3LUZA 1A8FA 4OVSA 1IIWA 5K2YA 4ZECA 1B5HA 1FBFA 4GXAA 3TODA 3VVDA 4DDDA 2O51A 4JVIA 4MCOA 1JP4A 1DTZA 3T9HB 4ECFA 2PCRA 3FD3A 4MNPA 4LZ5A 1RDXA 4XKPA 1LFGA 1VE4A 4JDFA 3PMWA 3QUJA 1ZJLA 3T9XB 2RCBA 3C4MA 3Q28A 3AXFA 4DXBA 4ZEFA 2NWJA 5CRYA 2OK2A 5ELVA 5ISUA 1URDA 4RPOA 3KOSA 1B9JA 1A40A 1BKAA 4HTGA 1TXFA 2VT5A 2X7PA 3M3LA 5I2KB 2OWZA 3SEUA 4X1BA 1MXVA 1OQHA 2PYYA 4WKMA 4RJZA 3QMFA 3O28A 3H4ZA 2DSFA 3H6TA 1H3DA 4JWYA 2HPGA 1N3XA 4FORA 1LBBA 1VFEA 4R74A 1MY1A 4F22A 1LAXA 4P47A 4K3FA 1PBQA 1LAFE 5EQ7A 1MM7A 4ONYA 3C9HA 4OA4A 4HE2A 4R9GA 1I6AA 2GH9A 4ELOA 3EF7A 1URGA 3S9MC 3SDFA 4AB5A 2CZIA 3T1BA 3LR1A 2XX9A 2O69A 3N26A 1MXWA 2F78A 3IB1A 1FRPA 4F31B 4NN3A 2Y7WA 3PMXA 3IX1A 2I4CA 3MZBA 4QSCA 2Y5LA 4O8MA 4N6PA 3W9VA 1NFTA 1IMEA 3WAEA 4G61A 4GOTA 4C1TA 3LSFB 2F6GA 1H76A 5J1DA 2FBPA 2P3VA 1PB9A 3TELA 2XXVA 1AIVA 1YYZA 5T3JA 3R6UA 4ESWA 1LCTA 4HCWA 3KBRA 1LFHA 4OENA 2V3QA 1B4ZA 3HN0A 3KZGA 4QFOA 3N6UA 2A5SA 1HSJA 5FHMA 4OESA 1JNFA 4HE0A 1UQWA 3CG1A 4BDRA 3JV9A 3MPKA 1MY3A 4GWOA 4IO3A 2F34A 4QFKA 2OCUA 3OSRA 1FW0A 1B7HA 5JK4A 1ZBMA 4YZZA 1DCUA 3E79A 4P11A 4F1VA 1SDXA 3C33A 4FJPA 3D4GA 4H45A 1NUYA 3DP4A 4LONB 3HCQA 5I57B 5KCJA 3TDJA 1FJ9A 3LV0A 3V83A 1UTBB 3K6VA 4N15A 3KJ7A 3TCFA 2NVUB 1DPEA 2DVZA 1SQYA 3I6VA 2FHYA 4XKRA 3T66A 4NTLA 3OEKA 1UIVA 3G3GA 2HEUA 1P1QA 1SW1A 4F19A 2F7BA 4F1YA 1IMCA 5H8FB 4F2OA 4O3CA 2PVUA 3K2DA 1JVXA 2V3UA 1B05A 2ZYOA 5KCJB 3D1RA 2XXQA 1QW0A 3K00A 1Q35A 3PD8A 1FQCA 5CC2A 3TYHA 1OQGA 3MVYA 4R9FA 2Z8DA 3U72A 4UABA 1L5TA 3B7DA 4PFUA 3G3JA 2QVUA 1USYH 3OXNA 4MLQA 4ZZEA 2NXOA 3MPLA 2OJTA 1QUKA 3RLFE 2OPEA 4PAFA 1NUWA 4I8CA 2Z8FA 4PGNA 2DE2A 3E78A 3O6IA 1RYOA 4LQ2A 1MRPA 1SI0A 4PFTA 4QBAA 5KZTA 1P1UA 1MQGA 2O1MA 3T9VA 2AIXA 3FIRA 2QSXA 4GWUA 4NF8B 2RC8A 2I3WA 3A3UA 1FQAA 4OVRA 4DXUA 2QFLA 4MNCA 3PPQA 1EYKA 2QRYA 1NNFA 4ZS9A 3FV2A 3VLWA 2FNCA 5CM6A 1D9YA 2FYIA 1B3HA 1NI9A 5DEXA 1A99A 1B4HA 5H8HA 4XIGQ 4JSDA 3O2AA 2DWAA 5BWJA 3MP6A 4RA1A 1CB6A 4OWDA 4OHNA 2QMXA 3U1OA 1Y1ZA 3VVEA 2ESNA 4R6YA 5AA1A 1Y9UA 5B70A 5H8NB 4GX4A 1H44A 2XD2A 1EYJA 1PC3A 5FTHA 3SKPA 1PB7A 2PBWA 4EXLA 2RKMA 4YKIA 1NNTA 2ZYNA 1PB8A 2AL4A 4KPTA 3TMGA 1OMPA 2XWVA 4N91A 1MQHA 3QSLA 2HHMA 3TTLA 4GWSA 1WDNA 1Y4CA 4OFOA 3IK6B 3O29A 3ZKKA 2ALUA 5DYHA 3QUFA 3MVXA 3PUZE 4OXVA 3EKIA 3UK4A 4BDQA 2CMOA 5H8QB 4ZDMA 4AQ4A 4N81A 5BUUA 1JVYA 1VDWA 4ELRA 1AOVA 5DVIA 4P8BA 2MKZA 3K6WA 3EHTA 4GFRA 3S9LC 4P56A 4YU0A 1FTMA 2IEEA 3HO7A 3VDFA 2Z22A 2UVJA 4N13A 3CVGA 4ZEIA 2PT2A 2YJPA 2P0SA 3FXBA 3RUMA 4NF5B 1XOCA 4LP2B 1A54A 3HFUA 3THIA 4N6KA 1IMFA 3FXRA 3KN8A 3MQ9A 1HSLA 2HXRA 4O7MA 2XD3A 3IAZA 2BJIA 5FBPA 4TLLB 4UA8A 2VPOA 4LZ7A 3G3HA 4R6KA 1A7LA 1LBXA 3EHSA 4FBPA 1B3GA 2VGQA 2VPNA 3ECRA 4Q0CA 2NOOA 3OENA 4O7IA 3I3VA 4NF4A 3KBZA 1OLCA 3RTWB 5TPAA 1GTKA 4ND9A 1B7ZA 3U65A 4I1DA 3ZS6A 3IJXB 3KGCA 2ZNUA 5H8SA 3QIMA 2Q8MA 4OVTA 2Z8EA 1NKXA 1B40A 4M1VA 5ESYA 3EQ1A 2KR0A 2R8TA 4EDPA 4KCCA 4H5FA 4GL8A 5EHSA 2I4BA 1B32A 3QK6A 1LGBC 1O64A 1HSEA 2ZYKA 2DS9A 4G4PA 1B52A 3O6GA 2XX8A 1IXHA 5I58A 4IO7A 4NWCA 3BBRA 3OEMA 2Y7IA 1KA1A 2O68A 3IOTA 1QGXA 1LB9A 2OLBA 3TQLA 4KYSA 4MX6A 1FBDA 3KC1A 3IOWA 3RGYA 3TZAA 5I2NB 1QULA 3T9UA 3KSJA 4G8HA 3E9XA 2XXHA 3MP1A 4IY5A 5J16A 2DYXA 2L5VA 2F7CA 4F39A
chains in the Genus database with same CATH topology
3IFCA 4I3YA 1IMCA 5IZ3A 3FBPA 2F3BA 4KXPA 5I3SA 2VPOA 2XA5A 4NHBA 4YICA 1FPDA 3T0JA 2Y5LA 2PFYA 2DE3A 1NUXA 2ZZXA 4JVIA 1JP4A 4GWWA 1FPIA 2JJKA 4I40A 1LBXA 5IZ1A 5IZ3B 4GX4A 2XWIA 3W9VA 3RPLB 4MAGA 1EYJA 3D1RA 4FBPA 2WYKA 2HZLA 2OX3A 5EQ9A 2VPNA 1IMEA 2PCRA 2ZZWA 5I5PA 5LTCA 4G61A 4MNPA 2FIXA 2CZHA 1RDXA 2DDKA 1RDYA 4I3EA 5J1DA 2FBPA 2P3VA 4NQ8A 1AWBA 1FPFA 4MIJA 1FPBA 2WEFA 3RPLA 4NF0A 4PETA 4PTKA 5EYGA 2WBDA 4O7IA 2WX9A 2XWOA 4MHFA 1YYZA 1BK4A 2Q9TA 5T3JA 1NUZA 4UABA 3KBZA 2P3NA 2XWVA 4NG7A 4N91A 3SZPA 3W9WA 5F24A 1SPIA 1NV2A 2QVRA 4H46A 2HHMA 3CHGA 4NGUA 1LBWA 1NV1A 2PFZA 4X9TA 4GWSA 2B4MA 2V4CA 4PFIA 4QXDA 1FJ6A 5EYHA 5ET8A 4X8RA 4AS4A 2DE4A 2QPQA 4NX1A 1KA0A 1K9ZA 4HCWA 4MJOA 1FPJA 2QVUA 4JVDA 1FPKA 1XI6A 5LDZA 4JVCA 3U65A 4N8YA 4P9KA 1IMBA 2V3QA 4PGPA 5EQ8A 1FBHA 1NV0A 4YZZA 2VT5A 1NV4A 2Q8MA 2XXKA 4HE1A 4N4UA 4OVTA 3KC0A 4LN5A 1NV3A 2OWZA 1FPGA 3BIGA 5ESYA 3RYDA 1G0HA 2ZZVA 3ISPA 3BIHA 4M1VA 2KR0A 2F3DA 1NUWA 1Q9DA 2R8TA 3MYUA 4PAFA 4HE0A 4GWYA 1DK4A 1LBZA 3EKIA 3GYYA 4GX3A 4PAIA 4PGNA 3QMFA 4PE3A 5I7IA 1CNQA 2DE2A 2Y5KA 3E78A 1RDZA 1FBCA 2FVZA 1INPA 5ET5A 4F1UA 5IGAA 4N81A 2HPGA 2FIEA 4PC9A 1VDWA 4PDHA 2CEXA 5IZZA 4P1EA 4X04A 4P8BA 4QBAA 5EQAA 2GQ1A 1FTAA 2MKZA 2XWKA 5IM2A 5JK4A 1G0IA 4AS5A 4MCOA 4O94A 2CZKA 4P56A 3B8BA 1IMAA 3A29A 4O8MA 1DCUA 1DBZA 5ET7A 3E79A 5ET6A 4XFEA 4F1VA 4HCYA 4GWUA 4P47A 4PDDA 4N8GA 4PBHA 4P1LA 2Q74A 1LBYA 1YXIA 1KA1A 1NV5A 3IFAA 4MEVA 1EYIA 1QGXA 1LBVA 1FBGA 4H45A 5EQ7A 1NUYA 4OVRA 4OVQA 4MMPA 2B4LA 4N17A 2QFLA 4PFBA 5DW8A 4MNCA 4DI4B 4GX6A 4PBQA 1EYKA 4OA4A 4HE2A 2HZKA 2F5XA 3NOHA 1FBDA 1LEVA 3KC1A 4MX6A 1FPEA 4PCDA 2WBBA 4GWXA 4N6DA 4XEQA 2WYPA 1FJ9A 3LV0A 3FXBA 4F18A 1FBPA 4NAPA 1YZ0A 4N15A 2CEYA 4PF8A 1D9QA 5CM6A 3ROJA 2CZIA 1NI9A 4GBWA 3HFUA 3T1BA 2DVZA 3B50A 1NV7A 1K9YA 4GBVA 4N6KA 4OVPA 1FBEA 2FHYA 3MSTA 1IMFA 1KZ8A 5A5LA 4OANA 5J16A 4XF5A 1FSAA 4PF6A 1FPLA 1IMDA 2QVVA 2L5VA 1FRPA 3PTYA 4DI3D 3LUZA 4OVSA 4GWZA 4NN3A 2HXRA 4MNIA 4O7MA 4IR8A 4HXVA 4PAKA 4P3LA 2BJIA 1NV6A 5FBPA 1FBFA 4PFRA 4F19A 2KQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFC A;  4I3Y A;  1IMC A;  5IZ3 A;  3FBP A;  2F3B A;  4KXP A;  5I3S A;  1FPD A;  3T0J A;  2Y5L A;  1NUX A;  1JP4 A;  4GWW A;  1FPI A;  2JJK A;  4I40 A;  1LBX A;  5IZ1 A;  5IZ3 B;  4GX4 A;  3RPL B;  1EYJ A;  3D1R A;  4FBP A;  2OX3 A;  5EQ9 A;  1IME A;  2PCR A;  4G61 A;  2FIX A;  2CZH A;  1RDX A;  2DDK A;  1RDY A;  4I3E A;  2FBP A;  2P3V A;  1AWB A;  1FPF A;  1FPB A;  2WEF A;  3RPL A;  4PTK A;  5EYG A;  2WBD A;  4O7I A;  1YYZ A;  1BK4 A;  5T3J A;  1NUZ A;  3KBZ A;  2P3N A;  5F24 A;  1SPI A;  1NV2 A;  2QVR A;  4H46 A;  2HHM A;  1LBW A;  1NV1 A;  4GWS A;  4QXD A;  1FJ6 A;  5EYH A;  5ET8 A;  4AS4 A;  1KA0 A;  1K9Z A;  4MJO A;  1FPJ A;  2QVU A;  1FPK A;  1XI6 A;  5LDZ A;  1IMB A;  5EQ8 A;  1FBH A;  1NV0 A;  2VT5 A;  1NV4 A;  2Q8M A;  4HE1 A;  3KC0 A;  1NV3 A;  2OWZ A;  1FPG A;  3BIG A;  5ESY A;  3RYD A;  1G0H A;  3BIH A;  2F3D A;  1NUW A;  1Q9D A;  2R8T A;  4HE0 A;  4GWY A;  1DK4 A;  1LBZ A;  4GX3 A;  3QMF A;  1CNQ A;  2Y5K A;  1RDZ A;  1FBC A;  2FVZ A;  1INP A;  5ET5 A;  4N81 A;  2FIE A;  1VDW A;  5EQA A;  2GQ1 A;  1FTA A;  1G0I A;  4AS5 A;  2CZK A;  3B8B A;  1IMA A;  3A29 A;  1DCU A;  1DBZ A;  5ET7 A;  5ET6 A;  4GWU A;  2Q74 A;  1LBY A;  1YXI A;  1KA1 A;  1NV5 A;  3IFA A;  1EYI A;  1QGX A;  1LBV A;  1FBG A;  4H45 A;  5EQ7 A;  1NUY A;  2QFL A;  5DW8 A;  4GX6 A;  1EYK A;  4HE2 A;  1FBD A;  1LEV A;  3KC1 A;  1FPE A;  2WBB A;  4GWX A;  1FJ9 A;  3LV0 A;  1FBP A;  1YZ0 A;  1D9Q A;  3ROJ A;  2CZI A;  1NI9 A;  4GBW A;  1NV7 A;  1K9Y A;  4GBV A;  1FBE A;  2FHY A;  1IMF A;  1KZ8 A;  5A5L A;  5J16 A;  1FSA A;  1FPL A;  1IMD A;  2QVV A;  1FRP A;  3LUZ A;  4GWZ A;  4IR8 A;  4HXV A;  2BJI A;  1NV6 A;  5FBP A;  1FBF A; 
#chains in the Genus database with same CATH topology
 4OER A;  2XA5 A;  5AA2 A;  1FPD A;  2ZZX A;  1MY2 A;  3KEI A;  3RPL B;  2WYK A;  2QS4 A;  1P1O A;  4KR5 A;  2DXY A;  3Q25 A;  1AWB A;  4MHF A;  4GL0 A;  5HPQ A;  1LAH E;  1Y3Q A;  5F24 A;  2E0S A;  1LBW A;  1MXZ A;  4IB2 A;  5EYH A;  3LSW A;  1TFD A;  4AS4 A;  5DVJ A;  4DCX A;  3JZJ A;  4R75 A;  4OMB A;  3LBS A;  4TQU Q;  4BDL A;  1NV0 A;  2QMW A;  1CE2 A;  2XXK A;  4HE1 A;  3K6X A;  1B58 A;  2P1S A;  3MUQ A;  1Q9D A;  1N0T A;  3VVF A;  5H8F A;  2XXY A;  3O6H A;  4KI0 E;  5F7V A;  5ET5 A;  2ZNS A;  1ZLQ A;  3TPA A;  2GFE A;  4P1E A;  4DXC A;  4U4X A;  2YLN A;  1FTA A;  2HXW A;  3OSQ A;  1G0I A;  4PP0 A;  4DIG A;  3LSL A;  1TWY A;  4KCD A;  4NED A;  5ITP A;  3C31 A;  2B4L A;  3IJO B;  4YB7 A;  4RYA A;  1LEV A;  4MH5 A;  4PCD A;  2VD3 A;  4QFN A;  2GHA A;  1D9Q A;  1S9T A;  1NV7 A;  1K9Y A;  2V25 A;  4GIZ A;  4ZE9 A;  2ONK E;  4XTC Q;  4H8I A;  3FAS A;  4IO2 A;  4XF5 A;  5I2N A;  4FAT A;  1EZ9 A;  4U1O A;  3E13 X;  1LLS A;  1SW5 A;  4JSO A;  1B3L A;  3IFC A;  1T0K A;  3T0J A;  1M5C A;  3SES A;  4MAG A;  1B51 A;  4BDO A;  4C1U A;  5F1Q A;  3K1N A;  4TLM B;  3D4C A;  2QS1 A;  3ZSF A;  4QF9 A;  4NMY A;  3HST A;  5I59 B;  1YAE A;  4NF6 A;  4GRK A;  1FBH A;  1I6B A;  4YKP A;  3BIG A;  3E3K A;  3RY3 A;  4GWY A;  1DK4 A;  3Q26 A;  2ONS A;  4RY1 A;  2FVZ A;  3C36 A;  4PDH A;  1A55 A;  1B1X A;  5M2V A;  5JTY B;  5I5P A;  3BFU A;  1R1N A;  2XXR A;  4HW8 A;  1B3E A;  1H45 A;  4ISU A;  4FEB A;  1BIY A;  4JBZ A;  4PFB A;  5I57 A;  5DW8 A;  3E4R A;  3NOH A;  1POT A;  2F5X A;  4YAH X;  3GBB A;  2UYF A;  3TTM A;  4XEQ A;  2H25 A;  1MDP 1;  3CR9 A;  3ILT B;  3V8X B;  2CEY A;  4PF8 A;  1MS7 A;  5KDT A;  1ZMG A;  3N94 A;  1MG1 A;  2A5T B;  2F6P A;  4ELP A;  4U4S A;  4G68 A;  2DWH A;  1BTJ A;  2QVV A;  1XVX A;  3OO6 A;  3C34 A;  4GF8 A;  3UP9 A;  5KDT B;  4PE5 B;  4KYE A;  4GD5 A;  1NUX A;  2F97 A;  2Y7R A;  5CBR A;  4MLV A;  2OX3 A;  4L17 A;  3IO6 A;  3PPP A;  1LCF A;  4Q8R A;  2XXT A;  4F3G A;  2B65 A;  5EYG A;  1B5J A;  3TEP A;  2DWI A;  4NG7 A;  1O7T A;  3MBP A;  4O3A A;  2OWT A;  1GV8 A;  5FHN A;  4NF4 B;  4F3B A;  1YTV A;  3MZ9 A;  1FTO A;  1POY 1;  1USY E;  4POX A;  3KC0 A;  3PPN A;  1NH7 A;  1FPG A;  2ZZV A;  5HBC A;  1MM6 A;  5A5X B;  3S4U A;  4H67 A;  1IXC A;  2IA4 A;  1VFD A;  5IGA A;  3RTF B;  2FIE A;  4OVJ A;  5AA3 A;  5IM2 A;  1TFA A;  4PQJ A;  2G93 A;  2Z23 A;  1LBC A;  1MQJ A;  2UVI A;  3B8B A;  3TTK A;  5ET6 A;  3A09 A;  4P1L A;  5H8N A;  2G29 A;  5CBS A;  1LB8 A;  3H7M A;  3N6T A;  2QS2 A;  4FIM A;  2R71 A;  3PGF A;  3QXM A;  4KHZ E;  3MC2 A;  5I56 B;  4YB6 A;  2H5Y A;  1GVC A;  1D3K A;  1MXY A;  2ZMB A;  1B0H A;  2KLF A;  1SW4 A;  4OAN A;  4OFJ A;  4PAK A;  3MVZ A;  3UGW A;  3IO4 A;  3H06 B;  1Y1M A;  1P1N A;  4YIC A;  2I6E A;  3VFJ A;  2THI A;  1DSN A;  1AH5 A;  4F3P A;  1B1H A;  2FA7 A;  5CMC A;  2CZH A;  5L9M A;  1FPF A;  3QAX A;  1FPB A;  3BKI B;  4PET A;  4PTK A;  2Y7K A;  1Z7N E;  2QVR A;  4H46 A;  4NGU A;  4R6H A;  4EQB A;  4PFW A;  4U1Z A;  3O97 A;  4JVD A;  4MJO A;  3KFM A;  2F36 A;  2ABH A;  1EZO A;  4H6D A;  5CMK A;  3V5A A;  3ONM A;  1MXU A;  4EXK A;  4Q30 B;  3RNN A;  3FVG A;  5I84 A;  4MFI A;  2ANJ A;  1IIT A;  2CEX A;  3OO9 A;  4P0I A;  2GQ1 A;  1IEJ A;  3S2V A;  2O7U A;  3PUV E;  5AE4 A;  4XFE A;  4BDN A;  1JW5 A;  2RCA A;  1FBG A;  3VXC A;  4FE8 A;  4QRZ A;  4ZE8 A;  4GWX A;  4OET A;  4ZEB A;  3TCG A;  3T96 B;  5A5L A;  1FSA A;  1FPL A;  2V93 A;  1FTK A;  4DI3 D;  1SW2 A;  4GWZ A;  4I62 A;  4I9D A;  3H03 A;  4QFP A;  4HXV A;  1Z7M E;  2NUV A;  3L6H A;  2GRV A;  2XXU A;  4NF6 B;  3U92 A;  5I3S A;  3R7X A;  2B3F A;  1NNP A;  1JEV A;  3MP8 A;  1OLA A;  3T22 A;  4TOZ A;  1MQD A;  4RXL A;  2YPN A;  2FIX A;  3I5O A;  1RDY A;  2HAU A;  2V3T A;  1GGG A;  4NF0 A;  1VSO A;  1ZTY A;  3MAM A;  2WBD A;  4RK9 A;  2O1L A;  1NUZ A;  3W9W A;  1OVB A;  3CHG A;  4QHQ A;  1DTG A;  2V4C A;  1FJ6 A;  1D4N A;  5ET8 A;  3MZ1 A;  3PMV A;  3HPI A;  4N8Y A;  3QYT A;  2PMS A;  1NV4 A;  3IOV A;  4OTE A;  1XVY A;  4H0W A;  3KN7 A;  4RK2 A;  3CRB A;  3GYY A;  3TFL A;  2REG A;  3UOR A;  3FJM A;  1INP A;  1SI1 A;  1JW1 A;  2UXA A;  4PC9 A;  4E0W A;  5IZZ A;  3VE1 B;  2R6G E;  4GQO A;  4C0R A;  2R9J A;  3OO8 A;  4U21 A;  5ET7 A;  4IGT A;  5TP9 B;  1UTH B;  4EUO A;  1FQF A;  3OMB A;  4NE4 A;  1H43 A;  3IR1 A;  4U23 A;  3PUX E;  4GX6 A;  4MBP A;  2HZK A;  5L9S A;  4OYV A;  1MQI A;  3IB0 A;  2D21 A;  2RF1 A;  2HAV A;  3CSB A;  4F29 A;  3FXU A;  1S50 A;  5B7D A;  4XKN A;  1UIU A;  1AL3 A;  3K01 A;  1US5 A;  4OEU A;  4X1D A;  4PF6 A;  4U2R A;  4MNI A;  1MPB A;  4IR8 A;  3TKD A;  3KOT A;  2CZL A;  4P3L A;  3EN3 A;  4ZED A;  2D5W A;  2UVH A;  3FBP A;  2F3B A;  2F35 A;  1OVT A;  4N07 A;  3UA8 A;  4GWW A;  2XWI A;  3LSX A;  4DCY A;  2I3V A;  2ZNT A;  1R9Q A;  2DDK A;  1PEB A;  3FV1 A;  4NQ8 A;  3VXB A;  3OO7 A;  1QKB A;  3H3G A;  1UTH A;  2F7A A;  2Q9T A;  1BP5 A;  3CFX A;  5DEX B;  1P99 A;  4X9T A;  3PUW E;  2X26 A;  4PFI A;  1URS A;  1KWH A;  4YMA A;  2DE4 A;  3SEW A;  1K9Z A;  3PPR A;  5DTB A;  1ELJ A;  4P9K A;  5K2X A;  5HM4 B;  1JW4 A;  4KYD A;  1LST A;  4M4G A;  5TPA B;  1I69 A;  4FEC A;  4O3B A;  4X8R A;  4NF8 A;  4G68 C;  1LBZ A;  4EF1 A;  4PE3 A;  3HV1 A;  3GZG A;  3OEL A;  4EQ9 A;  3S9N C;  1ZIU A;  1QKA A;  2DXR A;  4H1X A;  1NV5 A;  1XHY A;  1F9B A;  3B6Q A;  4U22 A;  4ZZA A;  3G3F A;  4QFL A;  2WBB A;  3R26 A;  4JB7 A;  2QL3 A;  4Z0I A;  5A5X A;  4JWO A;  4NF5 A;  4GBV A;  1B0L A;  3FXQ A;  1FBE A;  2D3I A;  5JTY A;  3L6G A;  1LFI A;  1MH3 A;  3DM0 A;  3PTY A;  1M5E A;  4R2B A;  4Q5T A;  3F11 A;  4H65 A;  1N76 A;  1QJM A;  3IB2 A;  3SER A;  4LAT A;  4YB5 A;  1DPP A;  4I3Y A;  4IO5 A;  4KXP A;  1WVJ A;  2JJK A;  5IZ1 A;  5IZ3 B;  1B5I A;  1D9V A;  3C32 A;  5I2K A;  3N5L A;  3FVK A;  1JET A;  1EZP A;  1RKM A;  4R2F A;  2E1S A;  3UN6 A;  1ANF A;  2GHB A;  2XX7 A;  4MIJ A;  2WEF A;  3FZV A;  5I59 A;  1BK4 A;  3K1M A;  1Y20 A;  3TUS A;  2PFZ A;  4R72 A;  1KA0 A;  2Y84 A;  1N3W A;  3U94 A;  1NNK A;  4N4U A;  2Q2A A;  2A5T A;  3ISP A;  1G0H A;  1S7Y A;  2I58 A;  4G8M A;  2M8C A;  4KFQ A;  4F1U A;  1R6Z A;  4XXU A;  1RDZ A;  1FBC A;  4XKQ A;  5CMM A;  3KG2 A;  1B46 A;  2XWK A;  4O94 A;  3K02 A;  2O84 X;  3U93 A;  4RNS A;  3IFA A;  4MEV A;  2XXP A;  4OVQ A;  4R73 A;  4G2Z A;  3MVW A;  5DT6 A;  5FHO A;  1FCK A;  4N6D A;  2H4I A;  2WYP A;  2BJJ X;  1IUD A;  3PD9 A;  4LA9 A;  5FTI A;  4OVP A;  4EQ7 A;  1IXI A;  5JEI A;  4ZEK A;  4HCY A;  4PFR A;  4F2Q A;  5TU0 A;  3TQW A;  5IZ3 A;  3VLV A;  4LVQ A;  2PFY A;  3UIF A;  3HHG A;  3O9P A;  3B6T A;  2HZL A;  5EQ9 A;  5L8D A;  1AMF A;  2VP1 A;  4F3S A;  3FJG A;  2WX9 A;  4OQO A;  2XWO A;  2Q88 A;  1N7X A;  2AL5 A;  4G8N A;  3RT6 B;  2P3N A;  5LOM A;  1Q1K A;  2DP8 A;  2DVC A;  2QPQ A;  1XS5 A;  3LUY A;  1YCJ A;  4JVC A;  2AYS A;  3M8U A;  3PU5 A;  2I48 A;  1BLF A;  1XT8 A;  2DQV A;  4H5G A;  5AA2 B;  1LAG E;  4PAI A;  1FQD A;  1O63 A;  3RT8 A;  2REJ A;  1NMU A;  2UYE A;  1IQ7 A;  4P0G A;  1JQF A;  2Y7P A;  3CFL A;  4OFL A;  2XXI A;  4AS5 A;  2CZK A;  2UVG A;  1IMA A;  3EHU A;  4POW A;  4PBH A;  2Q74 A;  2WKY A;  3O66 A;  4YKK A;  1SYI A;  3RN8 A;  3VV5 A;  1LBV A;  4PBQ A;  4GVO A;  2I0C A;  5IAI A;  2DWJ A;  4THI A;  1QUJ A;  1N04 A;  1TT1 A;  4EF2 A;  3U8Q A;  1Y3N A;  1MDQ A;  5IKB A;  4LZ8 A;  1IMD A;  3KJT A;  3VLU A;  2PX1 A;  3GLB A;  3MWB A;  1PBP A;  3CFZ A;  2KQZ A;  3Q29 A;  2LAO A;  4NHB A;  1MXX A;  1FPI A;  1M5F A;  4JWX A;  5LTC A;  2ZZW A;  3RQT A;  4YMB A;  1XC1 A;  3ODB A;  2OPD A;  1FQB A;  3FGS A;  1OIB A;  2W7Y A;  4Z7E A;  1NV2 A;  2B3B A;  2ONR A;  2B4M A;  3K0V A;  4NX1 A;  1FPK A;  1XI6 A;  5LDZ A;  4OEV A;  4PFY A;  3SEY A;  3BIH A;  1FQE A;  1JEU A;  3LC8 A;  4LQ5 A;  5I7I A;  1CNQ A;  1B2H A;  4H8J A;  1MY4 A;  2RIN A;  1A8E A;  2H99 A;  3A29 A;  2V84 A;  1WOD A;  4PDD A;  2HFB A;  1YXI A;  3ILU B;  1EYI A;  2RC9 A;  4MMP A;  4QSE A;  5I56 A;  2PT1 A;  3Q27 A;  3JYR A;  2VOZ A;  2QS3 A;  4F18 A;  3WAF A;  4JXI A;  4WEP A;  1SD3 A;  1PDA A;  4GBW A;  3B50 A;  3IOU A;  1KZ8 A;  3CG3 A;  3HHF A;  1P1W A;  1N84 A;  4UAC A;  1ZKB A;  5AA4 B;  2HCA A;  3K4U A;  1NV6 A;  4AB6 A;  5DVF A;  5TP9 A;  2DE3 A;  1QVS A;  5CI5 A;  2ZXT A;  4I40 A;  1FTJ A;  1EU8 A;  1I6Q A;  1R9L A;  4GXS B;  3OOA A;  3RPL A;  2Q8J A;  3H6V A;  1NL5 A;  1II5 A;  1M5B A;  4LUB A;  2I49 A;  3SZP A;  2XXX A;  2VD2 A;  3G3I A;  1NV1 A;  1IXG A;  2XXW A;  2RC7 A;  4OZ9 A;  3EPE A;  3PUY E;  5AA4 A;  3DP8 A;  1FPJ A;  5EQ8 A;  3GBA A;  4DLD A;  1SYH A;  3KSX A;  1SVX B;  1NV3 A;  3RYD A;  1M5D A;  2P2A A;  2XHD A;  2X7Q A;  3BFT A;  5ITO A;  1Y3P A;  4GX3 A;  3FVN A;  3H6W A;  2Y5K A;  2DOJ A;  1MH4 A;  1QUI A;  4ELQ A;  5AA2 D;  4DE8 A;  3FJ7 A;  4X04 A;  4KD5 A;  5EQA A;  5H8H B;  3ZKL A;  1DBZ A;  4QSD A;  1B7U A;  3SET A;  2OWS A;  1NH8 A;  4BLA A;  4G77 A;  4N17 A;  4YKJ A;  4DI4 B;  1DOT A;  4GLI A;  1US4 A;  2I0B A;  1FBP A;  2F8D A;  1MPC A;  3ROJ A;  4IY6 A;  4ESX A;  2QJE A;  4IGR A;  1Y4T A;  3MST A;  4RPN A;  1SBP A;  1ZU0 A;  2O6A A;  1FTL A;  2OZZ A;  1ATG A;  3USD A;  5H8Q A;  4NWD A;  3FUZ A;  3TTR A;  5L9O A;  1DMB A;  2HQ0 A;  2Q2C A;  3PPO A;  3C35 A;  3CI8 A;  1B3F A;  4IO4 A;  3A3C A;  3RPW A;  4KQP A;  1VR5 A;  4MF3 A;  4BDM A;  1YPN A;  4WXJ A;  4I3E A;  3SEV A;  3M3K A;  5CMB A;  1B6H A;  3MW0 A;  3V89 B;  3IL1 B;  4G68 B;  2O7I A;  3W15 C;  3IOR A;  5EYF A;  1SPI A;  3TTN A;  1J1N A;  3S9E A;  4FED A;  4QXD A;  3G3K A;  4HS7 A;  3CIJ A;  3H6U A;  3KN3 A;  2H9B A;  4DZ1 A;  1IMB A;  1MY0 A;  4PGP A;  2Q89 A;  4LN5 A;  5I58 B;  3M3F A;  3MYU A;  2F3D A;  2ZYM A;  4E0X A;  3DEL B;  5ICQ A;  3DLN A;  3K1P A;  3K6U A;  3TAJ A;  4FAJ A;  2H98 A;  3FAT A;  3TCH A;  3G7W A;  4X48 A;  3B6W A;  5EHM A;  4N8G A;  3T93 B;  1LBY A;  3MJN A;  1GR2 A;  1N7W A;  2OBG A;  1EH3 A;  3FVO A;  1FPE A;  1MPD A;  5ICT A;  4NAP A;  1YZ0 A;  4WED A;  3SEX A;  3OD7 A;  1RYX A;  4IO6 A;  3P7I A;  1IZ1 A;  1UTB A;  3PV0 E;  3DP6 A;  3CSG A;  3GXA A;  2VHA A;  3LUZ A;  1A8F A;  4OVS A;  1IIW A;  5K2Y A;  4ZEC A;  1B5H A;  1FBF A;  4GXA A;  3TOD A;  3VVD A;  4DDD A;  2O51 A;  4JVI A;  4MCO A;  1JP4 A;  1DTZ A;  3T9H B;  4ECF A;  2PCR A;  3FD3 A;  4MNP A;  4LZ5 A;  1RDX A;  4XKP A;  1LFG A;  1VE4 A;  4JDF A;  3PMW A;  3QUJ A;  1ZJL A;  3T9X B;  2RCB A;  3C4M A;  3Q28 A;  3AXF A;  4DXB A;  4ZEF A;  2NWJ A;  5CRY A;  2OK2 A;  5ELV A;  5ISU A;  1URD A;  4RPO A;  3KOS A;  1B9J A;  1A40 A;  1BKA A;  4HTG A;  1TXF A;  2VT5 A;  2X7P A;  3M3L A;  5I2K B;  2OWZ A;  3SEU A;  4X1B A;  1MXV A;  1OQH A;  2PYY A;  4WKM A;  4RJZ A;  3QMF A;  3O28 A;  3H4Z A;  2DSF A;  3H6T A;  1H3D A;  4JWY A;  2HPG A;  1N3X A;  4FOR A;  1LBB A;  1VFE A;  4R74 A;  1MY1 A;  4F22 A;  1LAX A;  4P47 A;  4K3F A;  1PBQ A;  1LAF E;  5EQ7 A;  1MM7 A;  4ONY A;  3C9H A;  4OA4 A;  4HE2 A;  4R9G A;  1I6A A;  2GH9 A;  4ELO A;  3EF7 A;  1URG A;  3S9M C;  3SDF A;  4AB5 A;  2CZI A;  3T1B A;  3LR1 A;  2XX9 A;  2O69 A;  3N26 A;  1MXW A;  2F78 A;  3IB1 A;  1FRP A;  4F31 B;  4NN3 A;  2Y7W A;  3PMX A;  3IX1 A;  2I4C A;  3MZB A;  4QSC A;  2Y5L A;  4O8M A;  4N6P A;  3W9V A;  1NFT A;  1IME A;  3WAE A;  4G61 A;  4GOT A;  4C1T A;  3LSF B;  2F6G A;  1H76 A;  5J1D A;  2FBP A;  2P3V A;  1PB9 A;  3TEL A;  2XXV A;  1AIV A;  1YYZ A;  5T3J A;  3R6U A;  4ESW A;  1LCT A;  4HCW A;  3KBR A;  1LFH A;  4OEN A;  2V3Q A;  1B4Z A;  3HN0 A;  3KZG A;  4QFO A;  3N6U A;  2A5S A;  1HSJ A;  5FHM A;  4OES A;  1JNF A;  4HE0 A;  1UQW A;  3CG1 A;  4BDR A;  3JV9 A;  3MPK A;  1MY3 A;  4GWO A;  4IO3 A;  2F34 A;  4QFK A;  2OCU A;  3OSR A;  1FW0 A;  1B7H A;  5JK4 A;  1ZBM A;  4YZZ A;  1DCU A;  3E79 A;  4P11 A;  4F1V A;  1SDX A;  3C33 A;  4FJP A;  3D4G A;  4H45 A;  1NUY A;  3DP4 A;  4LON B;  3HCQ A;  5I57 B;  5KCJ A;  3TDJ A;  1FJ9 A;  3LV0 A;  3V83 A;  1UTB B;  3K6V A;  4N15 A;  3KJ7 A;  3TCF A;  2NVU B;  1DPE A;  2DVZ A;  1SQY A;  3I6V A;  2FHY A;  4XKR A;  3T66 A;  4NTL A;  3OEK A;  1UIV A;  3G3G A;  2HEU A;  1P1Q A;  1SW1 A;  4F19 A;  2F7B A;  4F1Y A;  1IMC A;  5H8F B;  4F2O A;  4O3C A;  2PVU A;  3K2D A;  1JVX A;  2V3U A;  1B05 A;  2ZYO A;  5KCJ B;  3D1R A;  2XXQ A;  1QW0 A;  3K00 A;  1Q35 A;  3PD8 A;  1FQC A;  5CC2 A;  3TYH A;  1OQG A;  3MVY A;  4R9F A;  2Z8D A;  3U72 A;  4UAB A;  1L5T A;  3B7D A;  4PFU A;  3G3J A;  2QVU A;  1USY H;  3OXN A;  4MLQ A;  4ZZE A;  2NXO A;  3MPL A;  2OJT A;  1QUK A;  3RLF E;  2OPE A;  4PAF A;  1NUW A;  4I8C A;  2Z8F A;  4PGN A;  2DE2 A;  3E78 A;  3O6I A;  1RYO A;  4LQ2 A;  1MRP A;  1SI0 A;  4PFT A;  4QBA A;  5KZT A;  1P1U A;  1MQG A;  2O1M A;  3T9V A;  2AIX A;  3FIR A;  2QSX A;  4GWU A;  4NF8 B;  2RC8 A;  2I3W A;  3A3U A;  1FQA A;  4OVR A;  4DXU A;  2QFL A;  4MNC A;  3PPQ A;  1EYK A;  2QRY A;  1NNF A;  4ZS9 A;  3FV2 A;  3VLW A;  2FNC A;  5CM6 A;  1D9Y A;  2FYI A;  1B3H A;  1NI9 A;  5DEX A;  1A99 A;  1B4H A;  5H8H A;  4XIG Q;  4JSD A;  3O2A A;  2DWA A;  5BWJ A;  3MP6 A;  4RA1 A;  1CB6 A;  4OWD A;  4OHN A;  2QMX A;  3U1O A;  1Y1Z A;  3VVE A;  2ESN A;  4R6Y A;  5AA1 A;  1Y9U A;  5B70 A;  5H8N B;  4GX4 A;  1H44 A;  2XD2 A;  1EYJ A;  1PC3 A;  5FTH A;  3SKP A;  1PB7 A;  2PBW A;  4EXL A;  2RKM A;  4YKI A;  1NNT A;  2ZYN A;  1PB8 A;  2AL4 A;  4KPT A;  3TMG A;  1OMP A;  2XWV A;  4N91 A;  1MQH A;  3QSL A;  2HHM A;  3TTL A;  4GWS A;  1WDN A;  1Y4C A;  4OFO A;  3IK6 B;  3O29 A;  3ZKK A;  2ALU A;  5DYH A;  3QUF A;  3MVX A;  3PUZ E;  4OXV A;  3EKI A;  3UK4 A;  4BDQ A;  2CMO A;  5H8Q B;  4ZDM A;  4AQ4 A;  4N81 A;  5BUU A;  1JVY A;  1VDW A;  4ELR A;  1AOV A;  5DVI A;  4P8B A;  2MKZ A;  3K6W A;  3EHT A;  4GFR A;  3S9L C;  4P56 A;  4YU0 A;  1FTM A;  2IEE A;  3HO7 A;  3VDF A;  2Z22 A;  2UVJ A;  4N13 A;  3CVG A;  4ZEI A;  2PT2 A;  2YJP A;  2P0S A;  3FXB A;  3RUM A;  4NF5 B;  1XOC A;  4LP2 B;  1A54 A;  3HFU A;  3THI A;  4N6K A;  1IMF A;  3FXR A;  3KN8 A;  3MQ9 A;  1HSL A;  2HXR A;  4O7M A;  2XD3 A;  3IAZ A;  2BJI A;  5FBP A;  4TLL B;  4UA8 A;  2VPO A;  4LZ7 A;  3G3H A;  4R6K A;  1A7L A;  1LBX A;  3EHS A;  4FBP A;  1B3G A;  2VGQ A;  2VPN A;  3ECR A;  4Q0C A;  2NOO A;  3OEN A;  4O7I A;  3I3V A;  4NF4 A;  3KBZ A;  1OLC A;  3RTW B;  5TPA A;  1GTK A;  4ND9 A;  1B7Z A;  3U65 A;  4I1D A;  3ZS6 A;  3IJX B;  3KGC A;  2ZNU A;  5H8S A;  3QIM A;  2Q8M A;  4OVT A;  2Z8E A;  1NKX A;  1B40 A;  4M1V A;  5ESY A;  3EQ1 A;  2KR0 A;  2R8T A;  4EDP A;  4KCC A;  4H5F A;  4GL8 A;  5EHS A;  2I4B A;  1B32 A;  3QK6 A;  1LGB C;  1O64 A;  1HSE A;  2ZYK A;  2DS9 A;  4G4P A;  1B52 A;  3O6G A;  2XX8 A;  1IXH A;  5I58 A;  4IO7 A;  4NWC A;  3BBR A;  3OEM A;  2Y7I A;  1KA1 A;  2O68 A;  3IOT A;  1QGX A;  1LB9 A;  2OLB A;  3TQL A;  4KYS A;  4MX6 A;  1FBD A;  3KC1 A;  3IOW A;  3RGY A;  3TZA A;  5I2N B;  1QUL A;  3T9U A;  3KSJ A;  4G8H A;  3E9X A;  2XXH A;  3MP1 A;  4IY5 A;  5J16 A;  2DYX A;  2L5V A;  2F7C A;  4F39 A; 
#chains in the Genus database with same CATH homology
 3IFC A;  4I3Y A;  1IMC A;  5IZ3 A;  3FBP A;  2F3B A;  4KXP A;  5I3S A;  2VPO A;  2XA5 A;  4NHB A;  4YIC A;  1FPD A;  3T0J A;  2Y5L A;  2PFY A;  2DE3 A;  1NUX A;  2ZZX A;  4JVI A;  1JP4 A;  4GWW A;  1FPI A;  2JJK A;  4I40 A;  1LBX A;  5IZ1 A;  5IZ3 B;  4GX4 A;  2XWI A;  3W9V A;  3RPL B;  4MAG A;  1EYJ A;  3D1R A;  4FBP A;  2WYK A;  2HZL A;  2OX3 A;  5EQ9 A;  2VPN A;  1IME A;  2PCR A;  2ZZW A;  5I5P A;  5LTC A;  4G61 A;  4MNP A;  2FIX A;  2CZH A;  1RDX A;  2DDK A;  1RDY A;  4I3E A;  5J1D A;  2FBP A;  2P3V A;  4NQ8 A;  1AWB A;  1FPF A;  4MIJ A;  1FPB A;  2WEF A;  3RPL A;  4NF0 A;  4PET A;  4PTK A;  5EYG A;  2WBD A;  4O7I A;  2WX9 A;  2XWO A;  4MHF A;  1YYZ A;  1BK4 A;  2Q9T A;  5T3J A;  1NUZ A;  4UAB A;  3KBZ A;  2P3N A;  2XWV A;  4NG7 A;  4N91 A;  3SZP A;  3W9W A;  5F24 A;  1SPI A;  1NV2 A;  2QVR A;  4H46 A;  2HHM A;  3CHG A;  4NGU A;  1LBW A;  1NV1 A;  2PFZ A;  4X9T A;  4GWS A;  2B4M A;  2V4C A;  4PFI A;  4QXD A;  1FJ6 A;  5EYH A;  5ET8 A;  4X8R A;  4AS4 A;  2DE4 A;  2QPQ A;  4NX1 A;  1KA0 A;  1K9Z A;  4HCW A;  4MJO A;  1FPJ A;  2QVU A;  4JVD A;  1FPK A;  1XI6 A;  5LDZ A;  4JVC A;  3U65 A;  4N8Y A;  4P9K A;  1IMB A;  2V3Q A;  4PGP A;  5EQ8 A;  1FBH A;  1NV0 A;  4YZZ A;  2VT5 A;  1NV4 A;  2Q8M A;  2XXK A;  4HE1 A;  4N4U A;  4OVT A;  3KC0 A;  4LN5 A;  1NV3 A;  2OWZ A;  1FPG A;  3BIG A;  5ESY A;  3RYD A;  1G0H A;  2ZZV A;  3ISP A;  3BIH A;  4M1V A;  2KR0 A;  2F3D A;  1NUW A;  1Q9D A;  2R8T A;  3MYU A;  4PAF A;  4HE0 A;  4GWY A;  1DK4 A;  1LBZ A;  3EKI A;  3GYY A;  4GX3 A;  4PAI A;  4PGN A;  3QMF A;  4PE3 A;  5I7I A;  1CNQ A;  2DE2 A;  2Y5K A;  3E78 A;  1RDZ A;  1FBC A;  2FVZ A;  1INP A;  5ET5 A;  4F1U A;  5IGA A;  4N81 A;  2HPG A;  2FIE A;  4PC9 A;  1VDW A;  4PDH A;  2CEX A;  5IZZ A;  4P1E A;  4X04 A;  4P8B A;  4QBA A;  5EQA A;  2GQ1 A;  1FTA A;  2MKZ A;  2XWK A;  5IM2 A;  5JK4 A;  1G0I A;  4AS5 A;  4MCO A;  4O94 A;  2CZK A;  4P56 A;  3B8B A;  1IMA A;  3A29 A;  4O8M A;  1DCU A;  1DBZ A;  5ET7 A;  3E79 A;  5ET6 A;  4XFE A;  4F1V A;  4HCY A;  4GWU A;  4P47 A;  4PDD A;  4N8G A;  4PBH A;  4P1L A;  2Q74 A;  1LBY A;  1YXI A;  1KA1 A;  1NV5 A;  3IFA A;  4MEV A;  1EYI A;  1QGX A;  1LBV A;  1FBG A;  4H45 A;  5EQ7 A;  1NUY A;  4OVR A;  4OVQ A;  4MMP A;  2B4L A;  4N17 A;  2QFL A;  4PFB A;  5DW8 A;  4MNC A;  4DI4 B;  4GX6 A;  4PBQ A;  1EYK A;  4OA4 A;  4HE2 A;  2HZK A;  2F5X A;  3NOH A;  1FBD A;  1LEV A;  3KC1 A;  4MX6 A;  1FPE A;  4PCD A;  2WBB A;  4GWX A;  4N6D A;  4XEQ A;  2WYP A;  1FJ9 A;  3LV0 A;  3FXB A;  4F18 A;  1FBP A;  4NAP A;  1YZ0 A;  4N15 A;  2CEY A;  4PF8 A;  1D9Q A;  5CM6 A;  3ROJ A;  2CZI A;  1NI9 A;  4GBW A;  3HFU A;  3T1B A;  2DVZ A;  3B50 A;  1NV7 A;  1K9Y A;  4GBV A;  4N6K A;  4OVP A;  1FBE A;  2FHY A;  3MST A;  1IMF A;  1KZ8 A;  5A5L A;  4OAN A;  5J16 A;  4XF5 A;  1FSA A;  4PF6 A;  1FPL A;  1IMD A;  2QVV A;  2L5V A;  1FRP A;  3PTY A;  4DI3 D;  3LUZ A;  4OVS A;  4GWZ A;  4NN3 A;  2HXR A;  4MNI A;  4O7M A;  4IR8 A;  4HXV A;  4PAK A;  4P3L A;  2BJI A;  1NV6 A;  5FBP A;  1FBF A;  4PFR A;  4F19 A;  2KQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...