2P3VA

Thermotoga maritima impase tm1415
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
254
structure length
254
Chain Sequence
MDRLDFSIKLLRKVGHLLMIHWGRVDNVEKKTGFKDIVTEIDREAQRMIVDEIRKFFPDENIMAEEGIFEKGDRLWIIDPIDGTINFVHGLPNFSISLAYVENGEVKLGVVHAPALNETLYAEEGSGAFFNGERIRVSENASLEECVGSTGSYVDFTGKFIERMEKRTRRIRILGSAALNAAYVGAGRVDFFVTWRINPWDIAAGLIIVKEAGGMVTDFSGKEANAFSKNFIFSNGLIHDEVVKVVNEVVEEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Inositol-1-monophosphatase
publication title Crystal structure of the tetrameric inositol 1-phosphate phosphatase (TM1415) from the hyperthermophile, Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 76
structure length 254
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2007-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 2p3vA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2p3vA02
1FPLA 5EYGA 3LUZA 2R8TA 4I40A 1YZ0A 3RYDA 1IMAA 1FSAA 3B8BA 1KA1A 1SPIA 1IMBA 1INPA 1K9YA 2P3NA 1G0HA 1D9QA 4GX4A 1DBZA 4PTKA 1IMEA 5DW8A 2FIEA 1FPFA 1NUWA 4G61A 1FRPA 1BK4A 4HE1A 1YXIA 3A29A 4GX6A 5F24A 4I3YA 3BIGA 1FPIA 2QFLA 1LEVA 2F3BA 1FBDA 4GWSA 1NUZA 3T0JA 1QGXA 2PCRA 2OWZA 4GBWA 2CZIA 1FBCA 1FBFA 4O7IA 5EQ9A 5FBPA 1FJ9A 5T3JA 5IZ3B 3LV0A 1FBEA 4GWZA 4IR8A 2CZHA 2VT5A 5ET7A 1NUYA 1NV7A 1FPJA 5ET5A 1NV6A 4N81A 5IZ3A 1NV4A 1NUXA 4GWYA 2Q74A 4AS5A 4H45A 1NV0A 1NV1A 2BJIA 2FBPA 1K9ZA 3IFCA 2FIXA 1JP4A 1AWBA 2QVRA 4I3EA 1IMDA 3FBPA 1DK4A 5EQ7A 4GWXA 2Y5KA 1NV3A 1FBPA 1LBZA 1LBYA 3RPLB 2CZKA 1CNQA 5A5LA 3KBZA 1RDYA 1NV5A 5EYHA 1G0IA 2WBBA 3KC1A 1FBGA 3RPLA 4GWWA 2JJKA 1LBWA 4HXVA 2P3VA 1FPGA 5LDZA 2FVZA 1VDWA 3IFAA 1LBVA 1IMFA 4HE2A 2QVVA 5ET6A 1FJ6A 2OX3A 2QVUA 1NI9A 3QMFA 1FPBA 1FPKA 1FPEA 3ROJA 2F3DA 1KA0A 2HHMA 1XI6A 4FBPA 3D1RA 5J16A 2WEFA 1IMCA 2FHYA 2GQ1A 1YYZA 4GBVA 5EQ8A 1DCUA 4MJOA 5EQAA 1KZ8A 1FPDA 1RDXA 2Y5LA 1RDZA 5I3SA 1EYJA 2Q8MA 5IZ1A 4QXDA 4H46A 1Q9DA 4GWUA 5ET8A 4GX3A 5ESYA 1FBHA 2DDKA 3BIHA 1FTAA 3KC0A 4HE0A 1LBXA 1EYKA 2WBDA 4KXPA 1NV2A 4AS4A 1EYIA
chains in the Genus database with same CATH superfamily
4P8BA 4I40A 3EHUA 1JEUA 3OXNA 1B7ZA 3KG2A 5I56B 2NUVA 3UA8A 2DE3A 3H6TA 3OO8A 1P1UA 2RKMA 4DXBA 1M5EA 4MNPA 1QUJA 4G61A 1GV8A 2B3BA 3OO9A 3G3HA 1MXWA 2E0SA 3Q29A 4JDFA 3C32A 1BIYA 1SYHA 1Y1ZA 2VT5A 1NUYA 3TPAA 1M5FA 2HAUA 4IO5A 3RPWA 1ZTYA 4YKIA 1K9ZA 3LBSA 2PFYA 2FIXA 1NNTA 5I59B 1B4ZA 3F11A 3HN0A 1KWHA 3C36A 3FJ7A 5DEXB 1MH3A 5EYHA 3B6TA 1IQ7A 4JBZA 4ZE9A 4P0IA 2P3VA 3FXBA 3WAFA 4XKRA 3FGSA 3IFAA 1MG1A 5I2NA 2X7QA 4HE2A 1N3WA 1A55A 3N6TA 4KR5A 1XOCA 4XF5A 1JW4A 2L5VA 3KBRA 4H0WA 2OWSA 3FUZA 3TZAA 1VFEA 2Q2AA 2Y84A 2GQ1A 4OFJA 2Q88A 5TP9B 4F31B 1H76A 2XD2A 4ZECA 2VD3A 4PF6A 2PT1A 1EU8A 1LFGA 1LBXA 3CG1A 3HO7A 5AA2A 3USDA 1MQHA 1MQGA 3PTYA 2V93A 1ZLQA 4NF5A 4F3SA 4OHNA 2V4CA 3EPEA 1UQWA 2O1MA 4QSEA 3MW0A 1JQFA 1UTBB 4OXVA 1QGXA 3JZJA 4H5FA 4EQ7A 4KCCA 2I4CA 3FASA 4EQ9A 1FJ9A 1IEJA 3Q27A 2O6AA 3LV0A 4KYDA 4AB5A 3SESA 4BDNA 1A99A 3ZS6A 4YKKA 1H3DA 3O6HA 2DSFA 2FBPA 4F39A 2XX8A 3DELB 3H6UA 3HV1A 1P1WA 4MF3A 4F1YA 3LSXA 3B6WA 1IIWA 5EHSA 1N04A 4OESA 3OSRA 1AH5A 4GXSB 2HCAA 2FVZA 4PE3A 4AQ4A 5DT6A 2DWJA 2Y7PA 1M5BA 5L9MA 3VLVA 1BLFA 1LSTA 4PC9A 2R6GE 4JWYA 1URSA 1ZKBA 3UK4A 4QF9A 4MLQA 4YB5A 1YYZA 4F1VA 1MQDA 2O1LA 4L17A 5DYHA 3SERA 2OWTA 3E4RA 3B6QA 5IZZA 5H8QB 4YB6A 4DXUA 5K2YA 1FBHA 4BDOA 4PETA 1RYOA 3KFMA 5BUUA 3ODBA 4P0GA 4PCDA 1WDNA 4N6KA 3H03A 3LUZA 2Z8FA 3RYDA 3K2DA 5I58A 1SPIA 3PV0E 4N17A 1B46A 2V84A 1HSLA 3KN3A 2B3FA 3ECRA 2F78A 2FNCA 4GL0A 3IB2A 2XWKA 4I3YA 4F1UA 1P1NA 3N5LA 2R71A 1N84A 4G8NA 1B1HA 4RXLA 4C1UA 4GD5A 2LAOA 1LFHA 2O84X 4FEDA 1LB8A 3FJMA 5ET5A 4R9FA 3E13X 1RYXA 1S50A 1PB8A 1D9VA 1N7XA 3HFUA 2XXPA 3FXRA 3TTKA 4GWXA 3GYYA 3H6VA 3VLUA 5H8HA 2XWVA 4YKPA 4FE8A 1FQCA 2I58A 4NHBA 1N3XA 1IXIA 3V89B 5A5XB 4MX6A 3O28A 2JJKA 3RY3A 4OVPA 2FA7A 5M2VA 1AOVA 2XXXA 1D4NA 2I0BA 2AIXA 1IMFA 1FJ6A 1JVXA 2VOZA 4ISUA 4OMBA 1DSNA 1LCFA 4LZ5A 4P47A 4UACA 1URGA 4JSOA 2PBWA 5EQAA 3Q26A 1PB7A 4NF6B 2M8CA 4LONB 4XKPA 5ET8A 4F3GA 2DDKA 2HQ0A 3KC0A 4PDHA 4YMBA 5CI5A 1DPPA 4G4PA 3KOTA 5EYGA 3K02A 1FTMA 2R9JA 4KHZE 5EYFA 3M8UA 4KCDA 1NFTA 1B5IA 1IMEA 3MJNA 3S2VA 4P3LA 1FRPA 1BK4A 2ZMBA 1YXIA 4I8CA 5AE4A 4O7MA 1ZIUA 3VXBA 4LA9A 5AA3A 2HXWA 3H7MA 1SYIA 4NE4A 4GWZA 4TOZA 4AS5A 3U65A 3A3CA 3UP9A 1US5A 4ECFA 4F2OA 3T9UA 1AWBA 1IMDA 1DK4A 4X48A 2F36A 5A5LA 2QS2A 2HPGA 5L9SA 2WBBA 2YPNA 1Z7NE 3O66A 5ITPA 2A5TA 1Y4CA 1Y3NA 1YCJA 3IO4A 4JXIA 3RT6B 1P99A 2Z8EA 2O7IA 3SEWA 4DZ1A 1OQGA 3K6UA 2DWIA 4M1VA 4MHFA 1QUKA 4X04A 5LOMA 4YU0A 3PUXE 4ZE8A 3D1RA 1B0HA 1S7YA 4MJOA 1YPNA 4G68B 1H44A 1AMFA 4RPOA 1DOTA 4LP2B 4U21A 4GX3A 1LBBA 1MPBA 3KSXA 2Q89A 1CB6A 3I3VA 5F7VA 3LSFB 1Y4TA 2RF1A 4MIJA 4GQOA 2REGA 2O51A 4QFPA 1IMAA 5IM2A 3IB0A 4TLLB 1K9YA 1Y20A 1I6BA 3L6GA 5AA1A 2XXVA 2G93A 2F7CA 2VPNA 3A3UA 2DQVA 3OD7A 1URDA 1MDQA 1NUZA 2PCRA 3O6IA 1WODA 4OEUA 2WKYA 1IZ1A 3IJXB 4F3PA 2IEEA 1VE4A 1LB9A 4GIZA 1SW1A 2I4BA 3OEKA 4GWYA 3K0VA 1JW5A 3KEIA 1B3EA 2HZKA 1GGGA 4PFRA 1GTKA 4NG7A 2QMWA 2Y5KA 1QW0A 2QPQA 1NV3A 2DVCA 3RPLB 2CZKA 1RDYA 4TQUQ 3TODA 1B3GA 3SEVA 3K01A 1RKMA 1P1QA 3Q28A 4ZEBA 2ZZWA 3EHSA 1FPEA 1LAXA 3SKPA 2UVIA 5I5PA 5IAIA 1B4HA 4DCYA 4HW8A 3TEPA 3TCHA 3KOSA 4LQ2A 3MQ9A 2QS1A 5AA4A 4OA4A 4ELPA 5I3SA 2Q8MA 2HFBA 2Y7KA 5DVIA 1A54A 4PF8A 1I6QA 3GZGA 3RQTA 2OLBA 2F97A 3H06B 1EYIA 2PVUA 2NXOA 3IB1A 3S4UA 1ATGA 1DTGA 3W15C 3OO6A 4NX1A 4NEDA 1B7UA 3O9PA 4IO2A 4LQ5A 5B7DA 4ZS9A 4RJZA 3M3FA 1SW4A 4F18A 1QVSA 3BIGA 3VXCA 2I3WA 4GBWA 4DLDA 5I59A 5EQ9A 3OENA 2KR0A 3MBPA 5T3JA 5KDTB 3EHTA 5ET7A 3T9HB 1ELJA 3IOVA 5KCJA 4QSDA 3TTMA 4MAGA 3UGWA 1NV4A 1NUXA 2F34A 2B4MA 3HCQA 2OK2A 3MVWA 4H5GA 1LAGE 3GLBA 4OTEA 4P11A 1SQYA 4N13A 2H25A 5LDZA 1MM6A 4DDDA 2OX3A 4RYAA 2ZXTA 2OPEA 3IK6B 1F9BA 1FPKA 3CSGA 1Q1KA 5J16A 1MXUA 4KQPA 2D5WA 3PMVA 2P2AA 2HAVA 3MP8A 1US4A 5FHOA 2Y7RA 2QS3A 5TPAA 1D9YA 4H46A 2QJEA 3QAXA 1CE2A 1FTAA 4R6KA 4Q0CA 4NN3A 1TFAA 1OIBA 3B8BA 2XA5A 2F5XA 2GFEA 3CG3A 4NWDA 3FVKA 3O97A 4JSDA 3ILTB 4POWA 4XXUA 3PUWE 4R9GA 2W7YA 3B50A 1B9JA 3DP4A 3MVXA 3DLNA 2CZIA 1B32A 2Q2CA 2F8DA 4NF8A 1B5HA 4QSCA 2OBGA 4IR8A 4N81A 3CFZA 2YJPA 3M3KA 4Q8RA 4ESXA 1M5CA 3IFCA 4ZEIA 5CMKA 2RC7A 3IX1A 4MMPA 4LVQA 4M4GA 1A40A 3PUVE 5FHMA 1FBPA 4FJPA 2ZNUA 1B3HA 3U94A 4OFLA 1NV5A 4F2QA 5ITOA 5I2NB 3S9LC 3G3JA 1VDWA 3L6HA 3KSJA 3MZ9A 5DTBA 1DPEA 5ET6A 4X8RA 4NQ8A 3QMFA 4JVDA 2OCUA 4FBPA 4GBVA 4Q5TA 3TDJA 2ZZXA 1MY4A 2DVZA 1EYJA 4BDMA 3TQLA 3RT8A 4GWUA 4F3BA 3BIHA 1JW1A 4PGPA 5AA2B 1EYKA 2PFZA 2WBDA 4U4SA 4NF5B 5I7IA 2UVGA 2R8TA 2V3QA 1YAEA 2P3NA 3TCFA 4HCYA 4FORA 2V3UA 2HXRA 4Q30B 3HSTA 3EKIA 2XXKA 2FIEA 3MZBA 4MBPA 3I6VA 1JVYA 1MM7A 1O63A 1R9LA 3TELA 1VSOA 3G3GA 4G68C 3IJOB 2O68A 3CIJA 1II5A 4ZZEA 4GXAA 4O7IA 1BP5A 2VGQA 2MKZA 2DWAA 3FXQA 4Z7EA 5JTYA 4GLIA 1HSEA 2DXRA 1QKBA 1HSJA 3T9VA 4N6PA 4UABA 3SEUA 1MQJA 3FVGA 1IXHA 2QMXA 3HHFA 4PFBA 1ZBMA 3GXAA 1N7WA 4KYEA 3S9NC 3IR1A 3TCGA 4ZEFA 2XXRA 1B3FA 3OMBA 4FAJA 3MP1A 5H8FA 5DVFA 1POTA 4PFUA 2XD3A 3C31A 4WKMA 5ICTA 1Y1MA 1LBWA 1I6AA 4H1XA 1B05A 4YB7A 1MY1A 2QVUA 3HPIA 3UN6A 3PD9A 4THIA 4DI4B 1NH7A 2ONKE 3C4MA 3ROJA 4F19A 4LUBA 3PPPA 2I49A 2GH9A 4H8JA 1LBCA 3IORA 1IMCA 1LCTA 4GOTA 2X26A 4C1TA 2Q8JA 4QHQA 2CMOA 1PBPA 3W9VA 4IY5A 5H8SA 4QXDA 1PB9A 1MY3A 4N6DA 4RK9A 3LSLA 1SW2A 3VFJA 5I58B 1UTHA 1BTJA 3EF7A 5B70A 1XVXA 3E9XA 2DYXA 4RK2A 2XXHA 3CHGA 5H8NA 2OZZA 1G0HA 1DBZA 4ZDMA 4DE8A 4P1LA 4GX6A 1B3LA 3IO6A 3SZPA 2ZYMA 3MUQA 3JV9A 5FBPA 2XHDA 3CVGA 4OANA 4EDPA 4U4XA 3PD8A 4PFYA 5IZ3A 2RC9A 1Q35A 4XFEA 1LGBC 3FV1A 3PUYE 2VHAA 5H8HB 4KI0E 4R2BA 2DE2A 1EZOA 2A5SA 5FTHA 5TU0A 1IITA 3N26A 3PPNA 1FPGA 4WXJA 3E79A 1AIVA 4BLAA 4E0XA 4KPTA 2I48A 2ALUA 1XI6A 3TQWA 3QXMA 5FHNA 3BKIB 2FHYA 5I57A 3G3IA 2XXWA 1I69A 1NNPA 4KYSA 5EHMA 2NWJA 1EZPA 2Z22A 3RTFB 1Q9DA 1TT1A 2KLFA 1NNFA 2RCAA 1MXYA 4OVTA 4YKJA 5ELVA 2Z8DA 4IGRA 4NAPA 4ELQA 1PEBA 3U1OA 3MVYA 1N76A 2AYSA 2PMSA 4PFWA 4N15A 5DVJA 3A09A 2GRVA 4POXA 3T0JA 3ILUB 4OVRA 4YAHX 1FQFA 2XXIA 3RLFE 4QFNA 1FBEA 1SVXB 4IGTA 1OLAA 2XX9A 1Y9UA 4MEVA 4H45A 1FQDA 2ZYNA 2H99A 1SBPA 2DXYA 2KQZA 2QVRA 3KN8A 4EXKA 5EQ7A 4HTGA 3KZGA 4WEPA 3T22A 5L8DA 2D3IA 3RTWB 3PPOA 2F35A 5K2XA 3ZKLA 4OYVA 4R6YA 4NF4A 1R1NA 1MXVA 1QKAA 1EH3A 3S9MC 4AB6A 2PYYA 5HBCA 5ISUA 2CZLA 4ONYA 3LUYA 3LSWA 5AA2D 1O7TA 2B65A 3M3LA 2V3TA 4F29A 1ZJLA 4PQJA 4XKNA 3OO7A 5CMBA 2OJTA 3TKDA 1S9TA 4ZEDA 2ZYOA 4ELRA 3O29A 4OVQA 4FECA 5IZ1A 3VVEA 3IOUA 3PU5A 2F7BA 1JNFA 4YICA 3C34A 3U8QA 3BFTA 2RCBA 3SEYA 3FD3A 3KJ7A 2H4IA 1PC3A 3G3KA 3QSLA 2ESNA 3TYHA 4U2RA 5I2KA 1KA1A 3K6VA 4JVCA 3FJGA 4GVOA 1XVYA 4GX4A 4O8MA 2B4LA 5DW8A 4BDQA 4LZ8A 5I56A 1USYE 4LZ7A 3T1BA 3DP6A 4KD5A 2F3BA 1SDXA 3HHGA 1SD3A 3KJTA 4QFKA 2Y7WA 3W9WA 2DE4A 4MNIA 1NMUA 3V8XB 4I1DA 1FBCA 4IO6A 3BBRA 1XT8A 4BDLA 1B2HA 1H45A 4N4UA 4PDDA 2CEXA 4KFQA 1ZU0A 1JP4A 2Y7IA 3FATA 1M5DA 1G0IA 2RC8A 1PDAA 1MDP1 4PE5B 5DEXA 1UIUA 2DP8A 1Y3PA 3U93A 4R6HA 3ZSFA 5CM6A 4X1BA 3DM0A 1GR2A 4H67A 4RY1A 4NGUA 2HHMA 1XHYA 1B40A 2UVHA 2VPOA 3MPLA 1XS5A 5AA4B 3FVOA 1FQAA 4PAKA 2Y5LA 3TTNA 4H65A 5TP9A 3O2AA 3E3KA 4N07A 3TTRA 2XXUA 1MPCA 4GWOA 5HPQA 4X9TA 1A8FA 3VDFA 4G2ZA 3MYUA 2QS4A 4XIGQ 4NWCA 5J1DA 2P1SA 4MFIA 2FYIA 3T93B 1D9QA 3ISPA 1FTJA 2ANJA 2G29A 1IXGA 4OVJA 4IY6A 2HEUA 4R2FA 5L9OA 1R9QA 3DP8A 2ONRA 3T66A 1UTBA 4X1DA 3VE1B 5KCJB 2CEYA 4ZEKA 4WEDA 4EF1A 5ICQA 4FIMA 1FPJA 3MAMA 2NOOA 4H6DA 1MXXA 3FBPA 3K1MA 4R73A 3MZ1A 3SDFA 1LBZA 3OOAA 1SI0A 4QRZA 5CMMA 3GBBA 3T96B 3P7IA 3KBZA 3CRBA 5I84A 4R74A 3PGFA 3N94A 3OELA 1NI9A 1FPBA 1KA0A 4R72A 2UVJA 2WEFA 5TPAB 3TMGA 4NF0A 4DCXA 1POY1 1RDXA 4P1EA 1OLCA 2XXQA 1FQBA 5H8QA 5CBSA 1NV2A 2I0CA 2Z23A 1P1OA 4O3CA 1FSAA 1QUIA 3C33A 3VVFA 1INPA 2E1SA 3TTLA 4ELOA 1MH4A 4GFRA 1FPFA 2GHAA 2BJJX 5F24A 1JETA 4DIGA 1FPIA 2QFLA 1LEVA 1TXFA 4GWSA 4NF8B 3K6XA 4I9DA 1B5JA 3VV5A 4JB7A 3QUJA 4FATA 1VFDA 2UYFA 5LTCA 3U72A 4DI3D 2F7AA 3WAEA 4PAIA 4XKQA 1MQIA 1LBYA 1B52A 1B1XA 4HS7A 3T9XB 2I6EA 3MWBA 4HXVA 4XTCQ 5A5XA 1FW0A 1H43A 4ESWA 1A8EA 3VLWA 1LBVA 3FIRA 1SW5A 3CFXA 3FVNA 1B58A 4E0WA 4YMAA 3RNNA 1MPDA 2HZLA 2QL3A 1LAHE 5CRYA 2F6GA 2UYEA 2XX7A 2AL5A 2XWIA 1UIVA 4NMYA 1FQEA 2WYKA 1Y3QA 3IAZA 2V25A 4O3BA 2ZZVA 1B7HA 4QBAA 2DS9A 4NF6A 3PMXA 4JVIA 3V83A 4KXPA 2OPDA 4AS4A 1FPLA 4GF8A 3G3FA 2NVUB 3GBAA 3ZKKA 1YZ0A 1IMBA 4LN5A 4LATA 4RNSA 4PBHA 1R6ZA 4PTKA 1OMPA 4ZZAA 1MRPA 1NUWA 4PBQA 4MLVA 4IO7A 4ND9A 1FBDA 4OENA 2OWZA 5JTYB 3PPQA 2PX1A 3PUZE 2DOJA 1FBFA 3V5AA 1LLSA 4XEQA 3TUSA 2XXYA 3VVDA 4U1ZA 3KN7A 4TLMB 3IOTA 1XC1A 1BKAA 3LC8A 1NV0A 4IO3A 1ZMGA 2Q9TA 1Z7ME 3QIMA 5H8FB 1J1NA 4OZ9A 1CNQA 3B7DA 1B0LA 1MY2A 1VR5A 2H9BA 2THIA 3U92A 4DXCA 2QVVA 4QFOA 4MCOA 1DTZA 4PGNA 3MC2A 4FEBA 2F3DA 3D4GA 3OSQA 4RPNA 1MS7A 3R6UA 1FTKA 1FTOA 3CI8A 3KGCA 5JK4A 1RDZA 3AXFA 1B6HA 5ESYA 1UTHB 4G68A 2X7PA 4HE0A 3SETA 2XWOA 4JWXA 3Q25A 1OVTA 2UXAA 5H8NB 1FCKA 2AL4A 1L5TA 1A7LA 3NOHA 3D4CA 3JYRA 1ANFA 1TWYA 3K1NA 1LAFE 1FTLA 3QK6A 4O94A 4U1OA 1USYH 4OETA 3FZVA 3N6UA 5IZ3B 3R7XA 2ZNSA 4I62A 1NV7A 2D21A 5CMCA 1IUDA 5HM4B 5CC2A 2PT2A 3H6WA 5IKBA 4OVSA 1NL5A 2BJIA 1NH8A 1T0KA 2DWHA 1WVJA 2ZNTA 2QSXA 4EUOA 2WX9A 3CR9A 2ONSA 3CSBA 4PFTA 4P56A 4OEVA 3KC1A 3RPLA 3I5OA 4EF2A 2F6PA 1QJMA 1TFDA 4HCWA 3TFLA 3THIA 3G7WA 1GVCA 5KZTA 5FTIA 2O69A 4YZZA 1LFIA 4OERA 1NNKA 1D3KA 2H98A 4G77A 3TAJA 2ZYKA 1EZ9A 5I57B 4N91A 3FXUA 4GRKA 2QRYA 2A5TB 4MNCA 4K3FA 4NTLA 4QFLA 2H5YA 4G8MA 4PFIA 1KZ8A 1FPDA 3K6WA 3K00A 4O3AA 4UA8A 1O64A 1JEVA 4JWOA 1OVBA 3BFUA 4EQBA 1MXZA 4U22A 3EQ1A 3SEXA 3O6GA 4C0RA 5F1QA 1AL3A 1B51A 3PMWA 2YLNA 2VP1A 3MP6A 3EN3A 3IOWA 4F22A 5BWJA 2IA4A 4HE1A 3FV2A 3A29A 3C9HA 3H3GA 2P0SA 3ONMA 5JEIA 4IB2A 1DMBA 3LR1A 1OQHA 3MPKA 3E78A 1MY0A 2VD2A 4N8GA 3QYTA 1YTVA 2CZHA 3H4ZA 4P9KA 1NV6A 2RINA 5KDTA 4GL8A 2Q74A 3IL1B 4R75A 1NV1A 1IXCA 3CFLA 4N8YA 3PPRA 4BDRA 5I2KB 4I3EA 3S9EA 3RUMA 5CBRA 4G8HA 4IO4A 4NF4B 2WYPA 1N0TA 1FBGA 3K4UA 4OWDA 4GWWA 2O7UA 4Z0IA 1QULA 2XXTA 3OEMA 5IGAA 2REJA 3C35A 4PP0A 1PBQA 4PAFA 3QUFA 3UIFA 1NKXA 4U23A 4OFOA 4H8IA 3RN8A 5EQ8A 1DCUA 4EXLA 3K1PA 4MH5A 2I3VA 3RGYA 4RA1A 2GHBA 3MSTA 4OQOA 2ABHA 1SI1A 3MVZA 3UORA 3R26A
chains in the Genus database with same CATH topology
4MIJA 4P8BA 4I40A 1IMAA 5IM2A 1FSAA 3CHGA 1INPA 1K9YA 2DE3A 1G0HA 1DBZA 4MNPA 1FPFA 4G61A 4P1LA 4GX6A 5F24A 2VPNA 1FPIA 2QFLA 1LEVA 4GWSA 1NUZA 2PCRA 3SZPA 5FBPA 2VT5A 1NUYA 4OANA 5LTCA 5IZ3A 4GWYA 4XFEA 1K9ZA 2HZKA 2PFYA 2FIXA 4PFRA 4DI3D 4NG7A 2DE2A 4PAIA 2Y5KA 2QPQA 1NV3A 1LBYA 3RPLB 2CZKA 1RDYA 5EYHA 4HXVA 2P3VA 1FPGA 3FXBA 3IFAA 1LBVA 4HE2A 3E79A 4XF5A 2ZZWA 1FPEA 2L5VA 2HZLA 1XI6A 5I5PA 2FHYA 2GQ1A 2XWIA 4OA4A 2WYKA 5I3SA 2Q8MA 4PF6A 1Q9DA 2ZZVA 4PF8A 4QBAA 1LBXA 4JVIA 4KXPA 4AS4A 1EYIA 1FPLA 4OVTA 3PTYA 1YZ0A 4NX1A 1IMBA 4LN5A 4PBHA 4PTKA 2V4CA 4NAPA 1NUWA 4PBQA 4N15A 4F18A 3BIGA 1FBDA 3T0JA 1QGXA 2OWZA 4GBWA 4OVRA 1FBFA 5EQ9A 2KR0A 1FJ9A 5T3JA 4XEQA 3LV0A 1FBEA 5ET7A 4MAGA 1NV4A 1NUXA 4MEVA 2B4MA 4H45A 1NV0A 2FBPA 2KQZA 2QVRA 5EQ7A 2Q9TA 1CNQA 5LDZA 2FVZA 4PE3A 2QVVA 2OX3A 4MCOA 4PGNA 1FPKA 4PC9A 2F3DA 5J16A 1YYZA 4F1VA 5JK4A 1RDZA 4OVQA 5IZZA 5IZ1A 4H46A 5ESYA 1FBHA 4YICA 1FTAA 4PETA 4HE0A 2XWOA 4PCDA 4N6KA 3LUZA 4NN3A 3RYDA 3B8BA 1KA1A 2XA5A 1SPIA 3NOHA 4JVCA 4N17A 4GX4A 2F5XA 4O8MA 2B4LA 5DW8A 3T1BA 2XWKA 4O94A 4I3YA 3B50A 4F1UA 2F3BA 2CZIA 3W9WA 2DE4A 4MNIA 1FBCA 5IZ3B 4IR8A 4N4UA 1NV7A 5ET5A 4PDDA 4N81A 4OVSA 2CEXA 2BJIA 3IFCA 4MMPA 1JP4A 3HFUA 2WX9A 4GWXA 3GYYA 1FBPA 2XWVA 4NHBA 4P56A 1NV5A 4MX6A 1G0IA 3KC1A 3RPLA 2JJKA 4OVPA 1VDWA 4HCWA 5CM6A 1IMFA 5ET6A 1FJ6A 4X8RA 4NQ8A 4YZZA 3QMFA 4JVDA 4N91A 4NGUA 2HHMA 4P47A 4FBPA 2VPOA 4MNCA 4GBVA 5EQAA 1KZ8A 4PFIA 1FPDA 4PAKA 2Y5LA 2ZZXA 2DVZA 1EYJA 4GWUA 5ET8A 2DDKA 3BIHA 3KC0A 4PGPA 4PDHA 1EYKA 2PFZA 2WBDA 4X9TA 5EYGA 3MYUA 5I7IA 2R8TA 5J1DA 2V3QA 2P3NA 4HCYA 1D9QA 3ISPA 2HXRA 1IMEA 3EKIA 2XXKA 2FIEA 4P3LA 1FRPA 1BK4A 4HE1A 1YXIA 3A29A 4O7MA 2CEYA 3E78A 4O7IA 4N8GA 2MKZA 4GWZA 2CZHA 4P9KA 1FPJA 1NV6A 2Q74A 4AS5A 3U65A 4UABA 1NV1A 4PFBA 4N8YA 1AWBA 4I3EA 1IMDA 3FBPA 1DK4A 1LBZA 5A5LA 3KBZA 2HPGA 2WYPA 2WBBA 1FBGA 4GWWA 1LBWA 5IGAA 4M1VA 2QVUA 4MHFA 1NI9A 4X04A 4PAFA 4DI4B 1FPBA 3ROJA 4F19A 1KA0A 3D1RA 2WEFA 1IMCA 5EQ8A 1DCUA 4MJOA 4NF0A 1RDXA 4P1EA 3W9VA 4QXDA 4GX3A 3MSTA 4N6DA 1NV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPL A;  5EYG A;  3LUZ A;  2R8T A;  4I40 A;  1YZ0 A;  3RYD A;  1IMA A;  1FSA A;  3B8B A;  1KA1 A;  1SPI A;  1IMB A;  1INP A;  1K9Y A;  2P3N A;  1G0H A;  1D9Q A;  4GX4 A;  1DBZ A;  4PTK A;  1IME A;  5DW8 A;  2FIE A;  1FPF A;  1NUW A;  4G61 A;  1FRP A;  1BK4 A;  4HE1 A;  1YXI A;  3A29 A;  4GX6 A;  5F24 A;  4I3Y A;  3BIG A;  1FPI A;  2QFL A;  1LEV A;  2F3B A;  1FBD A;  4GWS A;  1NUZ A;  3T0J A;  1QGX A;  2PCR A;  2OWZ A;  4GBW A;  2CZI A;  1FBC A;  1FBF A;  4O7I A;  5EQ9 A;  5FBP A;  1FJ9 A;  5T3J A;  5IZ3 B;  3LV0 A;  1FBE A;  4GWZ A;  4IR8 A;  2CZH A;  2VT5 A;  5ET7 A;  1NUY A;  1NV7 A;  1FPJ A;  5ET5 A;  1NV6 A;  4N81 A;  5IZ3 A;  1NV4 A;  1NUX A;  4GWY A;  2Q74 A;  4AS5 A;  4H45 A;  1NV0 A;  1NV1 A;  2BJI A;  2FBP A;  1K9Z A;  3IFC A;  2FIX A;  1JP4 A;  1AWB A;  2QVR A;  4I3E A;  1IMD A;  3FBP A;  1DK4 A;  5EQ7 A;  4GWX A;  2Y5K A;  1NV3 A;  1FBP A;  1LBZ A;  1LBY A;  3RPL B;  2CZK A;  1CNQ A;  5A5L A;  3KBZ A;  1RDY A;  1NV5 A;  5EYH A;  1G0I A;  2WBB A;  3KC1 A;  1FBG A;  3RPL A;  4GWW A;  2JJK A;  1LBW A;  4HXV A;  2P3V A;  1FPG A;  5LDZ A;  2FVZ A;  1VDW A;  3IFA A;  1LBV A;  1IMF A;  4HE2 A;  2QVV A;  5ET6 A;  1FJ6 A;  2OX3 A;  2QVU A;  1NI9 A;  3QMF A;  1FPB A;  1FPK A;  1FPE A;  3ROJ A;  2F3D A;  1KA0 A;  2HHM A;  1XI6 A;  4FBP A;  3D1R A;  5J16 A;  2WEF A;  1IMC A;  2FHY A;  2GQ1 A;  1YYZ A;  4GBV A;  5EQ8 A;  1DCU A;  4MJO A;  5EQA A;  1KZ8 A;  1FPD A;  1RDX A;  2Y5L A;  1RDZ A;  5I3S A;  1EYJ A;  2Q8M A;  5IZ1 A;  4QXD A;  4H46 A;  1Q9D A;  4GWU A;  5ET8 A;  4GX3 A;  5ESY A;  1FBH A;  2DDK A;  3BIH A;  1FTA A;  3KC0 A;  4HE0 A;  1LBX A;  1EYK A;  2WBD A;  4KXP A;  1NV2 A;  4AS4 A;  1EYI A; 
#chains in the Genus database with same CATH topology
 4P8B A;  4I40 A;  3EHU A;  1JEU A;  3OXN A;  1B7Z A;  3KG2 A;  5I56 B;  2NUV A;  3UA8 A;  2DE3 A;  3H6T A;  3OO8 A;  1P1U A;  2RKM A;  4DXB A;  1M5E A;  4MNP A;  1QUJ A;  4G61 A;  1GV8 A;  2B3B A;  3OO9 A;  3G3H A;  1MXW A;  2E0S A;  3Q29 A;  4JDF A;  3C32 A;  1BIY A;  1SYH A;  1Y1Z A;  2VT5 A;  1NUY A;  3TPA A;  1M5F A;  2HAU A;  4IO5 A;  3RPW A;  1ZTY A;  4YKI A;  1K9Z A;  3LBS A;  2PFY A;  2FIX A;  1NNT A;  5I59 B;  1B4Z A;  3F11 A;  3HN0 A;  1KWH A;  3C36 A;  3FJ7 A;  5DEX B;  1MH3 A;  5EYH A;  3B6T A;  1IQ7 A;  4JBZ A;  4ZE9 A;  4P0I A;  2P3V A;  3FXB A;  3WAF A;  4XKR A;  3FGS A;  3IFA A;  1MG1 A;  5I2N A;  2X7Q A;  4HE2 A;  1N3W A;  1A55 A;  3N6T A;  4KR5 A;  1XOC A;  4XF5 A;  1JW4 A;  2L5V A;  3KBR A;  4H0W A;  2OWS A;  3FUZ A;  3TZA A;  1VFE A;  2Q2A A;  2Y84 A;  2GQ1 A;  4OFJ A;  2Q88 A;  5TP9 B;  4F31 B;  1H76 A;  2XD2 A;  4ZEC A;  2VD3 A;  4PF6 A;  2PT1 A;  1EU8 A;  1LFG A;  1LBX A;  3CG1 A;  3HO7 A;  5AA2 A;  3USD A;  1MQH A;  1MQG A;  3PTY A;  2V93 A;  1ZLQ A;  4NF5 A;  4F3S A;  4OHN A;  2V4C A;  3EPE A;  1UQW A;  2O1M A;  4QSE A;  3MW0 A;  1JQF A;  1UTB B;  4OXV A;  1QGX A;  3JZJ A;  4H5F A;  4EQ7 A;  4KCC A;  2I4C A;  3FAS A;  4EQ9 A;  1FJ9 A;  1IEJ A;  3Q27 A;  2O6A A;  3LV0 A;  4KYD A;  4AB5 A;  3SES A;  4BDN A;  1A99 A;  3ZS6 A;  4YKK A;  1H3D A;  3O6H A;  2DSF A;  2FBP A;  4F39 A;  2XX8 A;  3DEL B;  3H6U A;  3HV1 A;  1P1W A;  4MF3 A;  4F1Y A;  3LSX A;  3B6W A;  1IIW A;  5EHS A;  1N04 A;  4OES A;  3OSR A;  1AH5 A;  4GXS B;  2HCA A;  2FVZ A;  4PE3 A;  4AQ4 A;  5DT6 A;  2DWJ A;  2Y7P A;  1M5B A;  5L9M A;  3VLV A;  1BLF A;  1LST A;  4PC9 A;  2R6G E;  4JWY A;  1URS A;  1ZKB A;  3UK4 A;  4QF9 A;  4MLQ A;  4YB5 A;  1YYZ A;  4F1V A;  1MQD A;  2O1L A;  4L17 A;  5DYH A;  3SER A;  2OWT A;  3E4R A;  3B6Q A;  5IZZ A;  5H8Q B;  4YB6 A;  4DXU A;  5K2Y A;  1FBH A;  4BDO A;  4PET A;  1RYO A;  3KFM A;  5BUU A;  3ODB A;  4P0G A;  4PCD A;  1WDN A;  4N6K A;  3H03 A;  3LUZ A;  2Z8F A;  3RYD A;  3K2D A;  5I58 A;  1SPI A;  3PV0 E;  4N17 A;  1B46 A;  2V84 A;  1HSL A;  3KN3 A;  2B3F A;  3ECR A;  2F78 A;  2FNC A;  4GL0 A;  3IB2 A;  2XWK A;  4I3Y A;  4F1U A;  1P1N A;  3N5L A;  2R71 A;  1N84 A;  4G8N A;  1B1H A;  4RXL A;  4C1U A;  4GD5 A;  2LAO A;  1LFH A;  2O84 X;  4FED A;  1LB8 A;  3FJM A;  5ET5 A;  4R9F A;  3E13 X;  1RYX A;  1S50 A;  1PB8 A;  1D9V A;  1N7X A;  3HFU A;  2XXP A;  3FXR A;  3TTK A;  4GWX A;  3GYY A;  3H6V A;  3VLU A;  5H8H A;  2XWV A;  4YKP A;  4FE8 A;  1FQC A;  2I58 A;  4NHB A;  1N3X A;  1IXI A;  3V89 B;  5A5X B;  4MX6 A;  3O28 A;  2JJK A;  3RY3 A;  4OVP A;  2FA7 A;  5M2V A;  1AOV A;  2XXX A;  1D4N A;  2I0B A;  2AIX A;  1IMF A;  1FJ6 A;  1JVX A;  2VOZ A;  4ISU A;  4OMB A;  1DSN A;  1LCF A;  4LZ5 A;  4P47 A;  4UAC A;  1URG A;  4JSO A;  2PBW A;  5EQA A;  3Q26 A;  1PB7 A;  4NF6 B;  2M8C A;  4LON B;  4XKP A;  5ET8 A;  4F3G A;  2DDK A;  2HQ0 A;  3KC0 A;  4PDH A;  4YMB A;  5CI5 A;  1DPP A;  4G4P A;  3KOT A;  5EYG A;  3K02 A;  1FTM A;  2R9J A;  4KHZ E;  5EYF A;  3M8U A;  4KCD A;  1NFT A;  1B5I A;  1IME A;  3MJN A;  3S2V A;  4P3L A;  1FRP A;  1BK4 A;  2ZMB A;  1YXI A;  4I8C A;  5AE4 A;  4O7M A;  1ZIU A;  3VXB A;  4LA9 A;  5AA3 A;  2HXW A;  3H7M A;  1SYI A;  4NE4 A;  4GWZ A;  4TOZ A;  4AS5 A;  3U65 A;  3A3C A;  3UP9 A;  1US5 A;  4ECF A;  4F2O A;  3T9U A;  1AWB A;  1IMD A;  1DK4 A;  4X48 A;  2F36 A;  5A5L A;  2QS2 A;  2HPG A;  5L9S A;  2WBB A;  2YPN A;  1Z7N E;  3O66 A;  5ITP A;  2A5T A;  1Y4C A;  1Y3N A;  1YCJ A;  3IO4 A;  4JXI A;  3RT6 B;  1P99 A;  2Z8E A;  2O7I A;  3SEW A;  4DZ1 A;  1OQG A;  3K6U A;  2DWI A;  4M1V A;  4MHF A;  1QUK A;  4X04 A;  5LOM A;  4YU0 A;  3PUX E;  4ZE8 A;  3D1R A;  1B0H A;  1S7Y A;  4MJO A;  1YPN A;  4G68 B;  1H44 A;  1AMF A;  4RPO A;  1DOT A;  4LP2 B;  4U21 A;  4GX3 A;  1LBB A;  1MPB A;  3KSX A;  2Q89 A;  1CB6 A;  3I3V A;  5F7V A;  3LSF B;  1Y4T A;  2RF1 A;  4MIJ A;  4GQO A;  2REG A;  2O51 A;  4QFP A;  1IMA A;  5IM2 A;  3IB0 A;  4TLL B;  1K9Y A;  1Y20 A;  1I6B A;  3L6G A;  5AA1 A;  2XXV A;  2G93 A;  2F7C A;  2VPN A;  3A3U A;  2DQV A;  3OD7 A;  1URD A;  1MDQ A;  1NUZ A;  2PCR A;  3O6I A;  1WOD A;  4OEU A;  2WKY A;  1IZ1 A;  3IJX B;  4F3P A;  2IEE A;  1VE4 A;  1LB9 A;  4GIZ A;  1SW1 A;  2I4B A;  3OEK A;  4GWY A;  3K0V A;  1JW5 A;  3KEI A;  1B3E A;  2HZK A;  1GGG A;  4PFR A;  1GTK A;  4NG7 A;  2QMW A;  2Y5K A;  1QW0 A;  2QPQ A;  1NV3 A;  2DVC A;  3RPL B;  2CZK A;  1RDY A;  4TQU Q;  3TOD A;  1B3G A;  3SEV A;  3K01 A;  1RKM A;  1P1Q A;  3Q28 A;  4ZEB A;  2ZZW A;  3EHS A;  1FPE A;  1LAX A;  3SKP A;  2UVI A;  5I5P A;  5IAI A;  1B4H A;  4DCY A;  4HW8 A;  3TEP A;  3TCH A;  3KOS A;  4LQ2 A;  3MQ9 A;  2QS1 A;  5AA4 A;  4OA4 A;  4ELP A;  5I3S A;  2Q8M A;  2HFB A;  2Y7K A;  5DVI A;  1A54 A;  4PF8 A;  1I6Q A;  3GZG A;  3RQT A;  2OLB A;  2F97 A;  3H06 B;  1EYI A;  2PVU A;  2NXO A;  3IB1 A;  3S4U A;  1ATG A;  1DTG A;  3W15 C;  3OO6 A;  4NX1 A;  4NED A;  1B7U A;  3O9P A;  4IO2 A;  4LQ5 A;  5B7D A;  4ZS9 A;  4RJZ A;  3M3F A;  1SW4 A;  4F18 A;  1QVS A;  3BIG A;  3VXC A;  2I3W A;  4GBW A;  4DLD A;  5I59 A;  5EQ9 A;  3OEN A;  2KR0 A;  3MBP A;  5T3J A;  5KDT B;  3EHT A;  5ET7 A;  3T9H B;  1ELJ A;  3IOV A;  5KCJ A;  4QSD A;  3TTM A;  4MAG A;  3UGW A;  1NV4 A;  1NUX A;  2F34 A;  2B4M A;  3HCQ A;  2OK2 A;  3MVW A;  4H5G A;  1LAG E;  3GLB A;  4OTE A;  4P11 A;  1SQY A;  4N13 A;  2H25 A;  5LDZ A;  1MM6 A;  4DDD A;  2OX3 A;  4RYA A;  2ZXT A;  2OPE A;  3IK6 B;  1F9B A;  1FPK A;  3CSG A;  1Q1K A;  5J16 A;  1MXU A;  4KQP A;  2D5W A;  3PMV A;  2P2A A;  2HAV A;  3MP8 A;  1US4 A;  5FHO A;  2Y7R A;  2QS3 A;  5TPA A;  1D9Y A;  4H46 A;  2QJE A;  3QAX A;  1CE2 A;  1FTA A;  4R6K A;  4Q0C A;  4NN3 A;  1TFA A;  1OIB A;  3B8B A;  2XA5 A;  2F5X A;  2GFE A;  3CG3 A;  4NWD A;  3FVK A;  3O97 A;  4JSD A;  3ILT B;  4POW A;  4XXU A;  3PUW E;  4R9G A;  2W7Y A;  3B50 A;  1B9J A;  3DP4 A;  3MVX A;  3DLN A;  2CZI A;  1B32 A;  2Q2C A;  2F8D A;  4NF8 A;  1B5H A;  4QSC A;  2OBG A;  4IR8 A;  4N81 A;  3CFZ A;  2YJP A;  3M3K A;  4Q8R A;  4ESX A;  1M5C A;  3IFC A;  4ZEI A;  5CMK A;  2RC7 A;  3IX1 A;  4MMP A;  4LVQ A;  4M4G A;  1A40 A;  3PUV E;  5FHM A;  1FBP A;  4FJP A;  2ZNU A;  1B3H A;  3U94 A;  4OFL A;  1NV5 A;  4F2Q A;  5ITO A;  5I2N B;  3S9L C;  3G3J A;  1VDW A;  3L6H A;  3KSJ A;  3MZ9 A;  5DTB A;  1DPE A;  5ET6 A;  4X8R A;  4NQ8 A;  3QMF A;  4JVD A;  2OCU A;  4FBP A;  4GBV A;  4Q5T A;  3TDJ A;  2ZZX A;  1MY4 A;  2DVZ A;  1EYJ A;  4BDM A;  3TQL A;  3RT8 A;  4GWU A;  4F3B A;  3BIH A;  1JW1 A;  4PGP A;  5AA2 B;  1EYK A;  2PFZ A;  2WBD A;  4U4S A;  4NF5 B;  5I7I A;  2UVG A;  2R8T A;  2V3Q A;  1YAE A;  2P3N A;  3TCF A;  4HCY A;  4FOR A;  2V3U A;  2HXR A;  4Q30 B;  3HST A;  3EKI A;  2XXK A;  2FIE A;  3MZB A;  4MBP A;  3I6V A;  1JVY A;  1MM7 A;  1O63 A;  1R9L A;  3TEL A;  1VSO A;  3G3G A;  4G68 C;  3IJO B;  2O68 A;  3CIJ A;  1II5 A;  4ZZE A;  4GXA A;  4O7I A;  1BP5 A;  2VGQ A;  2MKZ A;  2DWA A;  3FXQ A;  4Z7E A;  5JTY A;  4GLI A;  1HSE A;  2DXR A;  1QKB A;  1HSJ A;  3T9V A;  4N6P A;  4UAB A;  3SEU A;  1MQJ A;  3FVG A;  1IXH A;  2QMX A;  3HHF A;  4PFB A;  1ZBM A;  3GXA A;  1N7W A;  4KYE A;  3S9N C;  3IR1 A;  3TCG A;  4ZEF A;  2XXR A;  1B3F A;  3OMB A;  4FAJ A;  3MP1 A;  5H8F A;  5DVF A;  1POT A;  4PFU A;  2XD3 A;  3C31 A;  4WKM A;  5ICT A;  1Y1M A;  1LBW A;  1I6A A;  4H1X A;  1B05 A;  4YB7 A;  1MY1 A;  2QVU A;  3HPI A;  3UN6 A;  3PD9 A;  4THI A;  4DI4 B;  1NH7 A;  2ONK E;  3C4M A;  3ROJ A;  4F19 A;  4LUB A;  3PPP A;  2I49 A;  2GH9 A;  4H8J A;  1LBC A;  3IOR A;  1IMC A;  1LCT A;  4GOT A;  2X26 A;  4C1T A;  2Q8J A;  4QHQ A;  2CMO A;  1PBP A;  3W9V A;  4IY5 A;  5H8S A;  4QXD A;  1PB9 A;  1MY3 A;  4N6D A;  4RK9 A;  3LSL A;  1SW2 A;  3VFJ A;  5I58 B;  1UTH A;  1BTJ A;  3EF7 A;  5B70 A;  1XVX A;  3E9X A;  2DYX A;  4RK2 A;  2XXH A;  3CHG A;  5H8N A;  2OZZ A;  1G0H A;  1DBZ A;  4ZDM A;  4DE8 A;  4P1L A;  4GX6 A;  1B3L A;  3IO6 A;  3SZP A;  2ZYM A;  3MUQ A;  3JV9 A;  5FBP A;  2XHD A;  3CVG A;  4OAN A;  4EDP A;  4U4X A;  3PD8 A;  4PFY A;  5IZ3 A;  2RC9 A;  1Q35 A;  4XFE A;  1LGB C;  3FV1 A;  3PUY E;  2VHA A;  5H8H B;  4KI0 E;  4R2B A;  2DE2 A;  1EZO A;  2A5S A;  5FTH A;  5TU0 A;  1IIT A;  3N26 A;  3PPN A;  1FPG A;  4WXJ A;  3E79 A;  1AIV A;  4BLA A;  4E0X A;  4KPT A;  2I48 A;  2ALU A;  1XI6 A;  3TQW A;  3QXM A;  5FHN A;  3BKI B;  2FHY A;  5I57 A;  3G3I A;  2XXW A;  1I69 A;  1NNP A;  4KYS A;  5EHM A;  2NWJ A;  1EZP A;  2Z22 A;  3RTF B;  1Q9D A;  1TT1 A;  2KLF A;  1NNF A;  2RCA A;  1MXY A;  4OVT A;  4YKJ A;  5ELV A;  2Z8D A;  4IGR A;  4NAP A;  4ELQ A;  1PEB A;  3U1O A;  3MVY A;  1N76 A;  2AYS A;  2PMS A;  4PFW A;  4N15 A;  5DVJ A;  3A09 A;  2GRV A;  4POX A;  3T0J A;  3ILU B;  4OVR A;  4YAH X;  1FQF A;  2XXI A;  3RLF E;  4QFN A;  1FBE A;  1SVX B;  4IGT A;  1OLA A;  2XX9 A;  1Y9U A;  4MEV A;  4H45 A;  1FQD A;  2ZYN A;  2H99 A;  1SBP A;  2DXY A;  2KQZ A;  2QVR A;  3KN8 A;  4EXK A;  5EQ7 A;  4HTG A;  3KZG A;  4WEP A;  3T22 A;  5L8D A;  2D3I A;  3RTW B;  3PPO A;  2F35 A;  5K2X A;  3ZKL A;  4OYV A;  4R6Y A;  4NF4 A;  1R1N A;  1MXV A;  1QKA A;  1EH3 A;  3S9M C;  4AB6 A;  2PYY A;  5HBC A;  5ISU A;  2CZL A;  4ONY A;  3LUY A;  3LSW A;  5AA2 D;  1O7T A;  2B65 A;  3M3L A;  2V3T A;  4F29 A;  1ZJL A;  4PQJ A;  4XKN A;  3OO7 A;  5CMB A;  2OJT A;  3TKD A;  1S9T A;  4ZED A;  2ZYO A;  4ELR A;  3O29 A;  4OVQ A;  4FEC A;  5IZ1 A;  3VVE A;  3IOU A;  3PU5 A;  2F7B A;  1JNF A;  4YIC A;  3C34 A;  3U8Q A;  3BFT A;  2RCB A;  3SEY A;  3FD3 A;  3KJ7 A;  2H4I A;  1PC3 A;  3G3K A;  3QSL A;  2ESN A;  3TYH A;  4U2R A;  5I2K A;  1KA1 A;  3K6V A;  4JVC A;  3FJG A;  4GVO A;  1XVY A;  4GX4 A;  4O8M A;  2B4L A;  5DW8 A;  4BDQ A;  4LZ8 A;  5I56 A;  1USY E;  4LZ7 A;  3T1B A;  3DP6 A;  4KD5 A;  2F3B A;  1SDX A;  3HHG A;  1SD3 A;  3KJT A;  4QFK A;  2Y7W A;  3W9W A;  2DE4 A;  4MNI A;  1NMU A;  3V8X B;  4I1D A;  1FBC A;  4IO6 A;  3BBR A;  1XT8 A;  4BDL A;  1B2H A;  1H45 A;  4N4U A;  4PDD A;  2CEX A;  4KFQ A;  1ZU0 A;  1JP4 A;  2Y7I A;  3FAT A;  1M5D A;  1G0I A;  2RC8 A;  1PDA A;  1MDP 1;  4PE5 B;  5DEX A;  1UIU A;  2DP8 A;  1Y3P A;  3U93 A;  4R6H A;  3ZSF A;  5CM6 A;  4X1B A;  3DM0 A;  1GR2 A;  4H67 A;  4RY1 A;  4NGU A;  2HHM A;  1XHY A;  1B40 A;  2UVH A;  2VPO A;  3MPL A;  1XS5 A;  5AA4 B;  3FVO A;  1FQA A;  4PAK A;  2Y5L A;  3TTN A;  4H65 A;  5TP9 A;  3O2A A;  3E3K A;  4N07 A;  3TTR A;  2XXU A;  1MPC A;  4GWO A;  5HPQ A;  4X9T A;  1A8F A;  3VDF A;  4G2Z A;  3MYU A;  2QS4 A;  4XIG Q;  4NWC A;  5J1D A;  2P1S A;  4MFI A;  2FYI A;  3T93 B;  1D9Q A;  3ISP A;  1FTJ A;  2ANJ A;  2G29 A;  1IXG A;  4OVJ A;  4IY6 A;  2HEU A;  4R2F A;  5L9O A;  1R9Q A;  3DP8 A;  2ONR A;  3T66 A;  1UTB A;  4X1D A;  3VE1 B;  5KCJ B;  2CEY A;  4ZEK A;  4WED A;  4EF1 A;  5ICQ A;  4FIM A;  1FPJ A;  3MAM A;  2NOO A;  4H6D A;  1MXX A;  3FBP A;  3K1M A;  4R73 A;  3MZ1 A;  3SDF A;  1LBZ A;  3OOA A;  1SI0 A;  4QRZ A;  5CMM A;  3GBB A;  3T96 B;  3P7I A;  3KBZ A;  3CRB A;  5I84 A;  4R74 A;  3PGF A;  3N94 A;  3OEL A;  1NI9 A;  1FPB A;  1KA0 A;  4R72 A;  2UVJ A;  2WEF A;  5TPA B;  3TMG A;  4NF0 A;  4DCX A;  1POY 1;  1RDX A;  4P1E A;  1OLC A;  2XXQ A;  1FQB A;  5H8Q A;  5CBS A;  1NV2 A;  2I0C A;  2Z23 A;  1P1O A;  4O3C A;  1FSA A;  1QUI A;  3C33 A;  3VVF A;  1INP A;  2E1S A;  3TTL A;  4ELO A;  1MH4 A;  4GFR A;  1FPF A;  2GHA A;  2BJJ X;  5F24 A;  1JET A;  4DIG A;  1FPI A;  2QFL A;  1LEV A;  1TXF A;  4GWS A;  4NF8 B;  3K6X A;  4I9D A;  1B5J A;  3VV5 A;  4JB7 A;  3QUJ A;  4FAT A;  1VFD A;  2UYF A;  5LTC A;  3U72 A;  4DI3 D;  2F7A A;  3WAE A;  4PAI A;  4XKQ A;  1MQI A;  1LBY A;  1B52 A;  1B1X A;  4HS7 A;  3T9X B;  2I6E A;  3MWB A;  4HXV A;  4XTC Q;  5A5X A;  1FW0 A;  1H43 A;  4ESW A;  1A8E A;  3VLW A;  1LBV A;  3FIR A;  1SW5 A;  3CFX A;  3FVN A;  1B58 A;  4E0W A;  4YMA A;  3RNN A;  1MPD A;  2HZL A;  2QL3 A;  1LAH E;  5CRY A;  2F6G A;  2UYE A;  2XX7 A;  2AL5 A;  2XWI A;  1UIV A;  4NMY A;  1FQE A;  2WYK A;  1Y3Q A;  3IAZ A;  2V25 A;  4O3B A;  2ZZV A;  1B7H A;  4QBA A;  2DS9 A;  4NF6 A;  3PMX A;  4JVI A;  3V83 A;  4KXP A;  2OPD A;  4AS4 A;  1FPL A;  4GF8 A;  3G3F A;  2NVU B;  3GBA A;  3ZKK A;  1YZ0 A;  1IMB A;  4LN5 A;  4LAT A;  4RNS A;  4PBH A;  1R6Z A;  4PTK A;  1OMP A;  4ZZA A;  1MRP A;  1NUW A;  4PBQ A;  4MLV A;  4IO7 A;  4ND9 A;  1FBD A;  4OEN A;  2OWZ A;  5JTY B;  3PPQ A;  2PX1 A;  3PUZ E;  2DOJ A;  1FBF A;  3V5A A;  1LLS A;  4XEQ A;  3TUS A;  2XXY A;  3VVD A;  4U1Z A;  3KN7 A;  4TLM B;  3IOT A;  1XC1 A;  1BKA A;  3LC8 A;  1NV0 A;  4IO3 A;  1ZMG A;  2Q9T A;  1Z7M E;  3QIM A;  5H8F B;  1J1N A;  4OZ9 A;  1CNQ A;  3B7D A;  1B0L A;  1MY2 A;  1VR5 A;  2H9B A;  2THI A;  3U92 A;  4DXC A;  2QVV A;  4QFO A;  4MCO A;  1DTZ A;  4PGN A;  3MC2 A;  4FEB A;  2F3D A;  3D4G A;  3OSQ A;  4RPN A;  1MS7 A;  3R6U A;  1FTK A;  1FTO A;  3CI8 A;  3KGC A;  5JK4 A;  1RDZ A;  3AXF A;  1B6H A;  5ESY A;  1UTH B;  4G68 A;  2X7P A;  4HE0 A;  3SET A;  2XWO A;  4JWX A;  3Q25 A;  1OVT A;  2UXA A;  5H8N B;  1FCK A;  2AL4 A;  1L5T A;  1A7L A;  3NOH A;  3D4C A;  3JYR A;  1ANF A;  1TWY A;  3K1N A;  1LAF E;  1FTL A;  3QK6 A;  4O94 A;  4U1O A;  1USY H;  4OET A;  3FZV A;  3N6U A;  5IZ3 B;  3R7X A;  2ZNS A;  4I62 A;  1NV7 A;  2D21 A;  5CMC A;  1IUD A;  5HM4 B;  5CC2 A;  2PT2 A;  3H6W A;  5IKB A;  4OVS A;  1NL5 A;  2BJI A;  1NH8 A;  1T0K A;  2DWH A;  1WVJ A;  2ZNT A;  2QSX A;  4EUO A;  2WX9 A;  3CR9 A;  2ONS A;  3CSB A;  4PFT A;  4P56 A;  4OEV A;  3KC1 A;  3RPL A;  3I5O A;  4EF2 A;  2F6P A;  1QJM A;  1TFD A;  4HCW A;  3TFL A;  3THI A;  3G7W A;  1GVC A;  5KZT A;  5FTI A;  2O69 A;  4YZZ A;  1LFI A;  4OER A;  1NNK A;  1D3K A;  2H98 A;  4G77 A;  3TAJ A;  2ZYK A;  1EZ9 A;  5I57 B;  4N91 A;  3FXU A;  4GRK A;  2QRY A;  2A5T B;  4MNC A;  4K3F A;  4NTL A;  4QFL A;  2H5Y A;  4G8M A;  4PFI A;  1KZ8 A;  1FPD A;  3K6W A;  3K00 A;  4O3A A;  4UA8 A;  1O64 A;  1JEV A;  4JWO A;  1OVB A;  3BFU A;  4EQB A;  1MXZ A;  4U22 A;  3EQ1 A;  3SEX A;  3O6G A;  4C0R A;  5F1Q A;  1AL3 A;  1B51 A;  3PMW A;  2YLN A;  2VP1 A;  3MP6 A;  3EN3 A;  3IOW A;  4F22 A;  5BWJ A;  2IA4 A;  4HE1 A;  3FV2 A;  3A29 A;  3C9H A;  3H3G A;  2P0S A;  3ONM A;  5JEI A;  4IB2 A;  1DMB A;  3LR1 A;  1OQH A;  3MPK A;  3E78 A;  1MY0 A;  2VD2 A;  4N8G A;  3QYT A;  1YTV A;  2CZH A;  3H4Z A;  4P9K A;  1NV6 A;  2RIN A;  5KDT A;  4GL8 A;  2Q74 A;  3IL1 B;  4R75 A;  1NV1 A;  1IXC A;  3CFL A;  4N8Y A;  3PPR A;  4BDR A;  5I2K B;  4I3E A;  3S9E A;  3RUM A;  5CBR A;  4G8H A;  4IO4 A;  4NF4 B;  2WYP A;  1N0T A;  1FBG A;  3K4U A;  4OWD A;  4GWW A;  2O7U A;  4Z0I A;  1QUL A;  2XXT A;  3OEM A;  5IGA A;  2REJ A;  3C35 A;  4PP0 A;  1PBQ A;  4PAF A;  3QUF A;  3UIF A;  1NKX A;  4U23 A;  4OFO A;  4H8I A;  3RN8 A;  5EQ8 A;  1DCU A;  4EXL A;  3K1P A;  4MH5 A;  2I3V A;  3RGY A;  4RA1 A;  2GHB A;  3MST A;  4OQO A;  2ABH A;  1SI1 A;  3MVZ A;  3UOR A;  3R26 A; 
#chains in the Genus database with same CATH homology
 4MIJ A;  4P8B A;  4I40 A;  1IMA A;  5IM2 A;  1FSA A;  3CHG A;  1INP A;  1K9Y A;  2DE3 A;  1G0H A;  1DBZ A;  4MNP A;  1FPF A;  4G61 A;  4P1L A;  4GX6 A;  5F24 A;  2VPN A;  1FPI A;  2QFL A;  1LEV A;  4GWS A;  1NUZ A;  2PCR A;  3SZP A;  5FBP A;  2VT5 A;  1NUY A;  4OAN A;  5LTC A;  5IZ3 A;  4GWY A;  4XFE A;  1K9Z A;  2HZK A;  2PFY A;  2FIX A;  4PFR A;  4DI3 D;  4NG7 A;  2DE2 A;  4PAI A;  2Y5K A;  2QPQ A;  1NV3 A;  1LBY A;  3RPL B;  2CZK A;  1RDY A;  5EYH A;  4HXV A;  2P3V A;  1FPG A;  3FXB A;  3IFA A;  1LBV A;  4HE2 A;  3E79 A;  4XF5 A;  2ZZW A;  1FPE A;  2L5V A;  2HZL A;  1XI6 A;  5I5P A;  2FHY A;  2GQ1 A;  2XWI A;  4OA4 A;  2WYK A;  5I3S A;  2Q8M A;  4PF6 A;  1Q9D A;  2ZZV A;  4PF8 A;  4QBA A;  1LBX A;  4JVI A;  4KXP A;  4AS4 A;  1EYI A;  1FPL A;  4OVT A;  3PTY A;  1YZ0 A;  4NX1 A;  1IMB A;  4LN5 A;  4PBH A;  4PTK A;  2V4C A;  4NAP A;  1NUW A;  4PBQ A;  4N15 A;  4F18 A;  3BIG A;  1FBD A;  3T0J A;  1QGX A;  2OWZ A;  4GBW A;  4OVR A;  1FBF A;  5EQ9 A;  2KR0 A;  1FJ9 A;  5T3J A;  4XEQ A;  3LV0 A;  1FBE A;  5ET7 A;  4MAG A;  1NV4 A;  1NUX A;  4MEV A;  2B4M A;  4H45 A;  1NV0 A;  2FBP A;  2KQZ A;  2QVR A;  5EQ7 A;  2Q9T A;  1CNQ A;  5LDZ A;  2FVZ A;  4PE3 A;  2QVV A;  2OX3 A;  4MCO A;  4PGN A;  1FPK A;  4PC9 A;  2F3D A;  5J16 A;  1YYZ A;  4F1V A;  5JK4 A;  1RDZ A;  4OVQ A;  5IZZ A;  5IZ1 A;  4H46 A;  5ESY A;  1FBH A;  4YIC A;  1FTA A;  4PET A;  4HE0 A;  2XWO A;  4PCD A;  4N6K A;  3LUZ A;  4NN3 A;  3RYD A;  3B8B A;  1KA1 A;  2XA5 A;  1SPI A;  3NOH A;  4JVC A;  4N17 A;  4GX4 A;  2F5X A;  4O8M A;  2B4L A;  5DW8 A;  3T1B A;  2XWK A;  4O94 A;  4I3Y A;  3B50 A;  4F1U A;  2F3B A;  2CZI A;  3W9W A;  2DE4 A;  4MNI A;  1FBC A;  5IZ3 B;  4IR8 A;  4N4U A;  1NV7 A;  5ET5 A;  4PDD A;  4N81 A;  4OVS A;  2CEX A;  2BJI A;  3IFC A;  4MMP A;  1JP4 A;  3HFU A;  2WX9 A;  4GWX A;  3GYY A;  1FBP A;  2XWV A;  4NHB A;  4P56 A;  1NV5 A;  4MX6 A;  1G0I A;  3KC1 A;  3RPL A;  2JJK A;  4OVP A;  1VDW A;  4HCW A;  5CM6 A;  1IMF A;  5ET6 A;  1FJ6 A;  4X8R A;  4NQ8 A;  4YZZ A;  3QMF A;  4JVD A;  4N91 A;  4NGU A;  2HHM A;  4P47 A;  4FBP A;  2VPO A;  4MNC A;  4GBV A;  5EQA A;  1KZ8 A;  4PFI A;  1FPD A;  4PAK A;  2Y5L A;  2ZZX A;  2DVZ A;  1EYJ A;  4GWU A;  5ET8 A;  2DDK A;  3BIH A;  3KC0 A;  4PGP A;  4PDH A;  1EYK A;  2PFZ A;  2WBD A;  4X9T A;  5EYG A;  3MYU A;  5I7I A;  2R8T A;  5J1D A;  2V3Q A;  2P3N A;  4HCY A;  1D9Q A;  3ISP A;  2HXR A;  1IME A;  3EKI A;  2XXK A;  2FIE A;  4P3L A;  1FRP A;  1BK4 A;  4HE1 A;  1YXI A;  3A29 A;  4O7M A;  2CEY A;  3E78 A;  4O7I A;  4N8G A;  2MKZ A;  4GWZ A;  2CZH A;  4P9K A;  1FPJ A;  1NV6 A;  2Q74 A;  4AS5 A;  3U65 A;  4UAB A;  1NV1 A;  4PFB A;  4N8Y A;  1AWB A;  4I3E A;  1IMD A;  3FBP A;  1DK4 A;  1LBZ A;  5A5L A;  3KBZ A;  2HPG A;  2WYP A;  2WBB A;  1FBG A;  4GWW A;  1LBW A;  5IGA A;  4M1V A;  2QVU A;  4MHF A;  1NI9 A;  4X04 A;  4PAF A;  4DI4 B;  1FPB A;  3ROJ A;  4F19 A;  1KA0 A;  3D1R A;  2WEF A;  1IMC A;  5EQ8 A;  1DCU A;  4MJO A;  4NF0 A;  1RDX A;  4P1E A;  3W9V A;  4QXD A;  4GX3 A;  3MST A;  4N6D A;  1NV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...