3KBZA

Crystal structure of human liver fbpase in complex with tricyclic inhibitor 6
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
327
structure length
319
Chain Sequence
DVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based drug design of tricyclic 8H-indeno[1,2-d][1,3]thiazoles as potent FBPase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 98
structure length 319
sequence length 327
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 3kbzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3kbzA02
2Q74A 1NV0A 4GBVA 1NV5A 4GWYA 4KXPA 1NI9A 3KC0A 1IMBA 5DW8A 4GWUA 4GWSA 4FBPA 1FJ6A 5EYHA 2P3NA 3KBZA 2HHMA 3A29A 3RYDA 1FRPA 5ESYA 2BJIA 1NUXA 4I3EA 1NV6A 2QVRA 1INPA 2WBDA 4AS4A 3BIGA 2JJKA 1DBZA 5I3SA 3B8BA 5EQ9A 5EYGA 1LBXA 5T3JA 3D1RA 4GBWA 1FBHA 1FPKA 2DDKA 2FBPA 1DK4A 5LDZA 4N81A 1FBDA 1FBGA 4PTKA 1G0HA 2R8TA 1NUWA 1EYJA 1QGXA 1CNQA 2OWZA 3T0JA 4GWZA 1YYZA 4I40A 1XI6A 4MJOA 5IZ3A 4QXDA 1KA1A 1RDXA 1JP4A 4I3YA 1IMEA 2P3VA 1NV4A 4HXVA 2GQ1A 2FVZA 2WEFA 2WBBA 1FSAA 3KC1A 4AS5A 2PCRA 1K9ZA 1FPGA 1NUYA 1FPJA 5IZ3B 2Y5LA 4GX3A 3RPLA 1FBEA 1FPFA 1FTAA 1KZ8A 5F24A 4GWXA 1D9QA 3FBPA 5ET5A 1FBFA 1SPIA 1EYIA 2FIEA 5EQ8A 4HE2A 1LBWA 1FPIA 1NV7A 2CZIA 1IMFA 2QVVA 5ET6A 5J16A 5A5LA 3RPLB 1LBYA 1K9YA 3BIHA 1NV2A 4IR8A 3IFAA 1KA0A 1LBZA 2FHYA 2OX3A 1FPLA 3LUZA 1FPBA 2QVUA 1AWBA 2VT5A 4GX6A 1FPDA 2FIXA 4GWWA 3IFCA 4GX4A 1DCUA 1NV1A 4O7IA 3ROJA 1BK4A 1RDZA 1YXIA 2F3DA 5FBPA 2QFLA 1IMCA 1Q9DA 1FBPA 3QMFA 4HE0A 5EQ7A 1EYKA 1FJ9A 2F3BA 1RDYA 1IMAA 1G0IA 5IZ1A 1NUZA 1LBVA 4G61A 2Y5KA 1FBCA 2Q8MA 2CZHA 1VDWA 4HE1A 4H45A 1FPEA 1LEVA 3LV0A 5EQAA 2CZKA 5ET7A 4H46A 5ET8A 1YZ0A 1IMDA 1NV3A
chains in the Genus database with same CATH superfamily
3K6WA 1O7TA 4JXIA 4N6PA 3C33A 3OO7A 2DE2A 3MBPA 4OERA 4QSDA 4P9KA 3EF7A 2YLNA 2DE4A 1B7ZA 1S50A 3FIRA 1P1QA 3KN3A 1MXWA 1VFEA 1SDXA 3IAZA 3H4ZA 4AQ4A 2ABHA 2O7UA 3SEYA 1IXIA 1FPKA 3MP8A 2F6PA 4DXCA 5HPQA 2B65A 3G3GA 4JWYA 1A8EA 2CMOA 3PPPA 4YICA 3T0JA 5CI5A 4N91A 3UK4A 1M5EA 4R9FA 1XS5A 2OJTA 2AIXA 5HBCA 3DP8A 2H98A 1EU8A 4OFLA 1HSJA 1N3WA 5KCJB 1LBWA 2ANJA 3G3FA 3FZVA 3OXNA 1Y1ZA 1UIVA 1WDNA 4IO7A 1NV2A 4GF8A 1FPBA 3VXCA 1DOTA 4DCYA 3UORA 1B3EA 1FCKA 1IEJA 2OK2A 3GZGA 2X7QA 3RNNA 2HAUA 2ZNUA 4HE0A 4C0RA 2QS2A 2Y7IA 1Y3QA 1VDWA 1NL5A 1ZKBA 2D21A 1LEVA 1RYXA 2DOJA 4RJZA 4OFJA 3QYTA 1HSEA 3CHGA 1LGBC 5I58B 3IO6A 3S9EA 2XXXA 1NMUA 3MZ1A 3K4UA 4P3LA 2R71A 4OA4A 3SEVA 2XXYA 2NOOA 4JSOA 4ESXA 3KOSA 1YPNA 3EHUA 2DSFA 1UTHA 3TQWA 1B0LA 2PMSA 1DBZA 2WYPA 4GLIA 4PF8A 3GXAA 3IOVA 4NMYA 5EHSA 5LTCA 4NG7A 3IB2A 3IJOB 3P7IA 3V8XB 3TYHA 3H06B 4WEPA 1XOCA 4XKQA 2IEEA 2ZMBA 1IMEA 2OCUA 1BIYA 3O97A 4RK2A 4NHBA 3FVKA 4PBQA 5CMCA 2KR0A 3UIFA 1MY1A 2XWVA 3WAFA 3ECRA 4NX1A 4DZ1A 3FBPA 4P8BA 2V4CA 2UYFA 4MX6A 4KQPA 5CM6A 1NH7A 2QVVA 2AL4A 2O68A 3KEIA 1FPLA 2REGA 1GGGA 1R9LA 4G8MA 2B4MA 2XD3A 4IO4A 4GWWA 3TCGA 1RDZA 5H8HB 4JWOA 5A5XA 5H8FA 4KYSA 4GVOA 1NNFA 1PBQA 4MMPA 3LV0A 3ISPA 2XXPA 2F35A 4ZECA 5CMMA 5ET8A 3VFJA 1IXCA 2DVZA 3MVXA 3VLUA 4PBHA 3LR1A 4U2RA 4RY1A 3ODBA 1MY4A 2I4BA 2RC7A 4MNCA 1FQDA 1LLSA 5CC2A 4OVPA 4XKPA 2X26A 4Q8RA 3M8UA 2OLBA 2JJKA 4G8NA 5I3SA 1DPEA 5EYGA 4OXVA 2I58A 4PFRA 3EKIA 2DVCA 4GQOA 3F11A 3K01A 2QS4A 5KDTB 4NWCA 2PT2A 1ELJA 2LAOA 3UP9A 1NUWA 1MM6A 5B7DA 4PAKA 2GRVA 4GWZA 2HXRA 3KOTA 4R72A 1LAXA 2AL5A 2RC8A 2O84X 2XWIA 4YMBA 4H6DA 2XXIA 4RYAA 1LFIA 1FPJA 1UTBA 2ONRA 1FPFA 1YTVA 4KPTA 2XA5A 3TEPA 3MW0A 2FIEA 3O9PA 4IY5A 4YU0A 1SVXB 4YB6A 1Q1KA 4KFQA 5KCJA 3MVZA 2UVHA 1MG1A 3S2VA 1OMPA 3LSLA 4GX4A 4OETA 2VHAA 4F3BA 1H43A 3K6UA 2I3WA 5EYFA 3K6VA 3RLFE 1SW5A 4ZE8A 1EZPA 3O29A 3C35A 3E13X 4NE4A 2Y5KA 1P1OA 3UN6A 3FXQA 2QL3A 4AB5A 2XD2A 3PV0E 5JTYA 1NNKA 4GBVA 5I7IA 5ELVA 1JQFA 4NQ8A 4C1UA 2H9BA 2VD2A 1MS7A 5I58A 1ZMGA 3Q26A 4THIA 1B58A 5KDTA 3PPNA 4PAFA 2UVIA 3FVGA 2I0BA 4PCDA 1SYHA 1B5IA 5IAIA 1FBDA 1GVCA 2Z23A 2R8TA 3VVDA 1KWHA 3EHTA 3VLVA 3PU5A 4FAJA 3CG1A 3OENA 4PGPA 1IZ1A 5IZ3A 2HEUA 4OVRA 2XX9A 3OO9A 1LBBA 1PB7A 1QUIA 3T9XB 4MBPA 4POXA 3N5LA 3VVFA 4KD5A 2OWTA 3RPLA 1I69A 1URGA 3CR9A 2HZLA 4GWXA 4ND9A 2Q9TA 2F8DA 5EQ8A 1NV7A 5I59A 3B7DA 1JW4A 4PFIA 1P99A 1T0KA 3S9NC 2RCAA 1A8FA 5BWJA 2RF1A 4BDRA 4PC9A 4LATA 4P1LA 2CZLA 4IGTA 3C32A 4ELOA 3VDFA 4F3GA 2QFLA 4YMAA 5I2KB 5M2VA 1N76A 3MVWA 3H3GA 2UVJA 1FBCA 4I62A 5JEIA 2ZYKA 4QFKA 3OELA 5AE4A 1N84A 1IMDA 2Q74A 4YKJA 3DLNA 4OVJA 1MQDA 5B70A 4GXAA 2P2AA 1A40A 4P56A 2D3IA 1A55A 4N15A 4ISUA 4F29A 2FA7A 1ATGA 4FORA 3RQTA 4F22A 2H4IA 3DP4A 3D1RA 2RKMA 4Q5TA 2G29A 1DTGA 5DT6A 1B5HA 1YYZA 1LBCA 5AA4A 5I2NB 2A5TB 1IITA 1B0HA 4KHZE 4NF5B 1JW5A 1SI0A 2G93A 1MQIA 1TWYA 3NOHA 2DXYA 1D9QA 1M5DA 4JVDA 1N0TA 3MYUA 2XX7A 1UTBB 2QS1A 3OOAA 2MKZA 1PEBA 1NV1A 1BK4A 5ICTA 1IMCA 1Y20A 4X9TA 3KN7A 2HFBA 3AXFA 3OO6A 1CE2A 4OZ9A 1AL3A 3G3IA 4NF0A 4N13A 3BBRA 4P47A 2CZKA 1FQBA 3B50A 2B4LA 3N94A 3HSTA 4OWDA 1LAFE 4GWYA 1NI9A 4HCYA 2I0CA 3LUYA 5L9SA 2UVGA 4FBPA 5LOMA 1MPBA 1O64A 4UACA 2XXQA 1FRPA 5ESYA 1INPA 4KCDA 5EQ9A 2AYSA 2O7IA 2A5SA 4GD5A 2XXRA 4TLMB 4O8MA 1A7LA 2D5WA 1B05A 4POWA 3R7XA 1XVYA 5AA4B 3IK6B 4NF5A 4N6KA 2KLFA 4ZE9A 1XI6A 1BTJA 1KA1A 1B46A 2GQ1A 4AS5A 3KC1A 4PQJA 5IZ3B 1FBEA 2FYIA 3VXBA 2F97A 4QRZA 4HE2A 4JVIA 4FECA 1O63A 5J16A 5AA3A 1B6HA 1A54A 1LBZA 2OX3A 1FPDA 4DE8A 1H3DA 4LZ5A 1H76A 4OQOA 2DQVA 4RPOA 3MP1A 1B3HA 3ZKLA 3LSXA 3MSTA 3TODA 1LAGE 1FQCA 1EYKA 1FJ9A 1RDYA 2I3VA 4NGUA 5L9OA 3A3CA 1P1NA 4YAHX 4H8IA 3G3HA 1BLFA 2WKYA 1YZ0A 1NKXA 1L5TA 4TQUQ 1Y4TA 1IMBA 4EXKA 3C4MA 3HN0A 3C9HA 3IB0A 4H67A 3SETA 2WBDA 1EZ9A 1LSTA 4YB5A 4FIMA 3TKDA 5DEXA 1JEVA 2Z8DA 3DELB 4UABA 5F7VA 1OQHA 1YAEA 1F9BA 4RNSA 1G0HA 1TFAA 1XVXA 2OWZA 1URDA 2Y7KA 2V3UA 4MJOA 1SW2A 4PFTA 3CFZA 5ITPA 4JB7A 2PCRA 4LVQA 2E1SA 4F18A 1N7XA 3H03A 1FTAA 3SERA 1B32A 4U4XA 3PPQA 3HHFA 4LQ5A 2F78A 3PUWE 3IO4A 4G2ZA 3D4CA 1MY2A 4XFEA 2Q2AA 5HM4B 5CMKA 1B7UA 4ZEKA 4ZS9A 3QMFA 5AA1A 3S9LC 1G0IA 3N6UA 2I49A 4F2OA 1FTKA 2VP1A 4H45A 1MPDA 2QS3A 3T1BA 1AMFA 1VSOA 2HAVA 1OIBA 4E0XA 4YKKA 4WEDA 4KYEA 4G8HA 1XHYA 4OENA 1VFDA 2DE3A 1B7HA 3GYYA 2NUVA 3PUVE 2BJIA 3SEWA 2WYKA 4AS4A 4ZEIA 3CIJA 3TELA 1AIVA 2QMWA 4N81A 5H8NB 3W15C 1LB8A 3QK6A 4PP0A 1OQGA 4OESA 1FTLA 4OMBA 1YCJA 3O6HA 1GTKA 1MDQA 4N6DA 3CVGA 4QFOA 4QXDA 1A99A 3EQ1A 2ZZVA 1XT8A 3VLWA 4IO6A 1D9VA 1ZIUA 5FHNA 4NF6A 1LAHE 1SPIA 4I1DA 3ZKKA 1UQWA 2CEXA 4EDPA 1QUJA 1ZJLA 3EHSA 3IFAA 4FATA 4F1YA 2F36A 5A5XB 3U94A 2ZYOA 4NAPA 1LCTA 5DYHA 1DPPA 2F5XA 4F1UA 4OVQA 3QAXA 1IMAA 4XKRA 4OVSA 2DXRA 3FVNA 4EQ7A 4EUOA 3U93A 2Q8MA 1PC3A 2V84A 5EQAA 4F2QA 2PYYA 3TTRA 2FIXA 4F3SA 1B9JA 2Q8JA 2RINA 5EYHA 2P3NA 1Y1MA 1I6BA 3KSJA 1PDAA 4NTLA 1S7YA 2O51A 3FXUA 1LBXA 5T3JA 2B3FA 4MEVA 1D4NA 1FBHA 3TAJA 3MJNA 4IO2A 3TFLA 3RGYA 1UTHB 4YZZA 3Q28A 4AB6A 4EQ9A 2WX9A 1IQ7A 3MQ9A 3FV2A 2PFYA 4I40A 4ECFA 5L9MA 1NV4A 3E9XA 4G4PA 2FVZA 4ELPA 1VR5A 3ILUB 2XWOA 5ICQA 3KBRA 4GIZA 1MY0A 1FBFA 2FNCA 1EYIA 4GFRA 2V25A 3O66A 1IMFA 1N04A 1LB9A 2YPNA 1LBYA 2VPOA 3TMGA 4IR8A 1H45A 3HFUA 4HCWA 1B40A 1FTMA 3SDFA 4LP2B 4OVTA 3O28A 1QKBA 3O6IA 3THIA 3ROJA 4ELRA 1ANFA 4NF8B 4ZEFA 2R6GE 1WVJA 1Q9DA 2RC9A 5IGAA 4NWDA 1QULA 4R6HA 2B3BA 3IOWA 4DDDA 5IZ1A 3B6QA 3FJGA 1MXYA 1RKMA 1VE4A 4G77A 4H8JA 3OSRA 5H8HA 5H8SA 1TT1A 1CB6A 1MXXA 4YKIA 1PB8A 1NV0A 2Q89A 1Z7NE 2KQZA 4X48A 4H65A 1JNFA 3V89B 2DWIA 4GOTA 3MC2A 4O3BA 3OEKA 3USDA 2QVRA 4QF9A 1NNPA 1MQHA 1B1HA 2CEYA 2V3TA 3B8BA 4MNPA 2ONKE 3MP6A 3A3UA 3L6HA 1DK4A 4JWXA 3WAEA 5J1DA 2F34A 3RT8A 4Q0CA 5I5PA 3HPIA 2GH9A 2Y7WA 1SI1A 1BKAA 3N26A 5H8NA 4C1TA 3GBBA 2HQ0A 1MQJA 4N07A 2THIA 1FSAA 2W7YA 1M5BA 4U21A 4JDFA 2OPDA 1NUYA 1QW0A 1KZ8A 3W9WA 3PUYE 1Y3PA 3HV1A 3CG3A 5ET6A 3SESA 3MPLA 3MPKA 1M5CA 1SW4A 1FTJA 1MQGA 3G3JA 2XX8A 4OANA 3PTYA 3R6UA 3KSXA 2HXWA 1OVBA 4LQ2A 3BFUA 3O2AA 5FBPA 2H25A 1I6QA 1US5A 4LA9A 5CBSA 4U23A 3G7WA 4H5FA 3DP6A 3HO7A 1N7WA 2DYXA 3TCHA 3I6VA 3PD9A 4PFUA 4FEDA 2XXTA 3IR1A 3UA8A 1B5JA 3LSWA 4KXPA 4JVCA 4Z0IA 3MZ9A 1FQFA 2PX1A 2VGQA 3G3KA 4HTGA 3FJMA 4PDHA 5JTYB 3TPAA 1IUDA 3KFMA 1AOVA 4DIGA 5IZZA 1FW0A 3FUZA 1FTOA 4GBWA 2I4CA 2F7AA 1MXVA 2ZZWA 3FXRA 4OTEA 4ONYA 4P11A 4GL8A 3L6GA 1MM7A 4RPNA 1OLAA 4X1BA 3R26A 1JP4A 4R74A 2P3VA 4MCOA 4U1OA 1UIUA 4XEQA 5DVJA 2WEFA 2HPGA 4F31B 3PPOA 4FJPA 1MRPA 4X8RA 1Y3NA 1DSNA 5H8QA 5A5LA 1B4ZA 2UYEA 2O69A 1MH3A 3U1OA 2R9JA 4PF6A 4P0IA 1ZLQA 5I59B 4O7MA 3PUXE 1QJMA 1DCUA 4O7IA 2F3DA 5K2YA 4YB7A 1MXUA 1JW1A 3TCFA 1TFDA 2GFEA 3U72A 4X1DA 4HE1A 1LCFA 1QKAA 3OMBA 1SYIA 4EF1A 1MXZA 2PT1A 4N4UA 5CMBA 2QMXA 5IM2A 3K1NA 4G68B 4KR5A 4GWUA 5K2XA 1NFTA 3IL1B 3RYDA 1M5FA 1NV6A 3IB1A 1FQAA 3C31A 4ELQA 3KJ7A 2YJPA 4R6YA 3VVEA 1AH5A 3EPEA 3H6TA 3TUSA 3CFXA 4ZDMA 3LC8A 4M4GA 1EH3A 3K00A 1SW1A 2L5VA 1URSA 3PMVA 1OLCA 3FVOA 4LZ8A 1EYJA 2DWAA 1CNQA 3KG2A 1B2HA 4H5GA 3I5OA 1NNTA 2Y7PA 1EZOA 4I3YA 2PBWA 2O6AA 5H8QB 3MVYA 4DI3D 2Y5LA 4QHQA 2CZIA 3RN8A 3M3FA 2Z8FA 3O6GA 4MAGA 2QVUA 1GR2A 4GX6A 4WXJA 2DWHA 2NVUB 2Y7RA 2REJA 4MIJA 4OFOA 3KN8A 1BP5A 4PGNA 4DXBA 1JVYA 3M3LA 2RCBA 4DLDA 3PD8A 2HCAA 1USYE 5ISUA 4QFNA 1LBVA 4OEVA 2CZHA 4G68A 5KZTA 3C34A 5CBRA 3QXMA 5ITOA 5H8FB 3VE1B 2OBGA 5ET7A 1HSLA 1MDP1 4GRKA 3U8QA 1JETA 1NH8A 2DS9A 4GWSA 3MWBA 4KI0E 4FE8A 5DEXB 2HHMA 1ZU0A 1NUXA 4RK9A 4BDNA 5DVIA 2GHBA 2OPEA 1P1UA 4NF4B 3JYRA 1POTA 5TP9B 3RTWB 2FBPA 1PBPA 5TPAB 3TDJA 2NXOA 4PTKA 5I84A 2VD3A 4P0GA 1DTZA 2PFZA 3PMWA 4PE5B 2QSXA 2ESNA 1RDXA 5L8DA 1GV8A 4DXUA 1ZTYA 3QSLA 1PB9A 3S9MC 4QFLA 4IY6A 1ZBMA 4M1VA 3A09A 1B4HA 4DCXA 4ZZEA 5F24A 1SD3A 1SQYA 4R2BA 5FTIA 2DP8A 3PPRA 4HW8A 4NN3A 1K9YA 1QVSA 3BIHA 4XIGQ 3EN3A 2FHYA 2VOZA 4LN5A 3T66A 1LFHA 5JK4A 1B51A 5I2KA 3IORA 3KGCA 3Q29A 3K02A 4KYDA 3U92A 1USYH 3E4RA 3FATA 1FBPA 5EQ7A 2O1MA 1POY1 2F3BA 2Q88A 3TTKA 2Z22A 1Z7ME 4G61A 3HHGA 2O1LA 1FPEA 3FD3A 4ZEDA 3T9HB 3RT6B 5DTBA 4NEDA 5F1QA 4MHFA 3T22A 4L17A 1B3GA 2Y84A 2P0SA 3KC0A 2QPQA 5DW8A 2ZXTA 3TQLA 2I48A 3KZGA 4N8YA 5TP9A 4I3EA 3MZBA 2V3QA 2UXAA 3CSBA 3BIGA 3FASA 4U22A 4K3FA 3U65A 3OO8A 3T93B 3ZSFA 4Z7EA 2DDKA 3BKIB 2A5TA 3C36A 2HZKA 4P1EA 1Y4CA 2VPNA 5FTHA 1QGXA 4MLQA 3JV9A 4U1ZA 3PGFA 2H99A 3D4GA 4PFBA 4NF6B 2ALUA 4F19A 1US4A 1D3KA 1LFGA 2Z8EA 3IJXB 4LZ7A 3T96B 4MNIA 3IOUA 3ILTB 5CRYA 4XXUA 4XF5A 1R1NA 1P1WA 3RPLB 2ONSA 4F39A 4QBAA 2XHDA 4XTCQ 3K1PA 5EHMA 4TOZA 3CI8A 2ZYMA 3RY3A 2VT5A 2Q2CA 3MUQA 3TTLA 3LBSA 1Q35A 3TTNA 5DVFA 1YXIA 4OHNA 3K2DA 1B3FA 4PFWA 4OEUA 3QUJA 3Q25A 3FV1A 4PFYA 1IIWA 1B1XA 3CSGA 3B6WA 4KCCA 1IXHA 5AA2A 4H46A 4R6KA 5FHMA 1SBPA 2F6GA 2P1SA 4IB2A 1FJ6A 3GBAA 5TU0A 3A29A 2ZNSA 1MH4A 2GHAA 4LONB 1DMBA 2H5YA 2DWJA 1I6AA 4GWOA 4PE3A 3T9UA 4DI4B 4EQBA 2I6EA 4E0WA 3TTMA 4ESWA 5I56A 3MAMA 1JVXA 4QSEA 3SEUA 4NF4A 3SKPA 4IO3A 4PAIA 3K1MA 4QFPA 5TPAA 4I8CA 3SEXA 3B6TA 5AA2D 4RA1A 4HXVA 4WKMA 4ZZAA 3RTFB 5IKBA 5FHOA 1JEUA 3UGWA 3PMXA 4GX3A 5I2NA 2ZYNA 4X04A 1N3XA 5ET5A 4R2FA 1D9YA 3OEMA 2OWSA 4OYVA 1H44A 4MH5A 3IOTA 2XXKA 3FGSA 3W9VA 1KA0A 4PETA 4QSCA 3IX1A 1II5A 1MPCA 4ZEBA 3H6UA 3E78A 3H7MA 4MFIA 3FXBA 2V93A 4G68C 4BDLA 1RYOA 3M3KA 5AA2B 5I57B 4F3PA 4FEBA 2PVUA 4Q30B 3PUZE 4UA8A 1NUZA 3H6WA 4JSDA 4JBZA 2M8CA 3RPWA 4O3AA 2ZZXA 4O94A 4MLVA 3TZAA 2XWKA 3QUFA 1NV5A 4EXLA 3BFTA 3Q27A 3JZJA 3T9VA 4TLLB 3V83A 4N17A 4F1VA 3KBZA 3I3VA 3VV5A 4R75A 3CRBA 5I56B 1WODA 2QJEA 3ZS6A 4H1XA 4I9DA 2XXWA 4IGRA 1R9QA 4R9GA 5LDZA 1FBGA 4O3CA 2OZZA 1FQEA 2XXUA 4N8GA 4LUBA 4BDQA 4RXLA 4HS7A 4BDMA 1XC1A 1OVTA 3N6TA 4IO5A 2E0SA 2X7PA 3HCQA 3KJTA 4R73A 1IXGA 2NWJA 1K9ZA 3RUMA 3OSQA 1FPGA 4GL0A 2IA4A 3SZPA 1S9TA 2ZNTA 1R6ZA 1Y9UA 2XXVA 4BDOA 3CFLA 1FPIA 4U4SA 2XXHA 4GXSB 4PDDA 3DM0A 3E3KA 3LUZA 3FJ7A 3LSFB 1B3LA 1AWBA 4H0WA 3H6VA 3ONMA 4BLAA 3IFCA 3K0VA 1TXFA 4MF3A 1J1NA 5I57A 4XKNA 3E79A 2QRYA 4EF2A 3OD7A 1QUKA 2BJJX 3K6XA 5BUUA 3V5AA 2F7BA 4NF8A 2F7CA 3GLBA 3QIMA 4YKPA 1B52A 1MY3A 3S4UA 2WBBA 1NV3A
chains in the Genus database with same CATH topology
2DVZA 2Q74A 1NV0A 2B4LA 2XWKA 3B50A 4MHFA 5IM2A 4P3LA 4GBVA 1NV5A 2KQZA 4GWYA 5I7IA 4KXPA 1NI9A 3KC0A 4HCYA 2QPQA 4OA4A 1IMBA 5DW8A 4PBHA 4GWUA 4GWSA 4JVCA 4NQ8A 4FBPA 1FJ6A 4N8YA 2DE2A 2DE3A 4N17A 5EYHA 4F1VA 4PDHA 4P9KA 2P3NA 3KBZA 2HHMA 3A29A 3RYDA 4MNCA 3GYYA 1FRPA 5ESYA 2BJIA 1NUXA 4I3EA 1NV6A 2DE4A 4P56A 2WYKA 4OVPA 2QVRA 4XFEA 2V3QA 1INPA 2WBDA 4N15A 4AS4A 4PE3A 3BIGA 4PAFA 5IZZA 2JJKA 1DBZA 2CEYA 5I3SA 3B8BA 5EQ9A 5EYGA 4MNPA 2WYPA 1LBXA 5T3JA 4PFRA 3D1RA 3U65A 4MEVA 3EKIA 4GBWA 4DI4B 1FBHA 1FPKA 2DDKA 2FBPA 4N4UA 4O8MA 4PCDA 4PF8A 1DK4A 4UABA 5LDZA 4N81A 5J1DA 4PF6A 1FBDA 1FBGA 2ZZWA 4YZZA 4PTKA 2L5VA 5I5PA 1G0HA 2R8TA 5LTCA 2HZKA 4NG7A 4P1EA 1NUWA 2WX9A 2VPNA 4PAKA 1EYJA 2PFZA 4N6KA 1QGXA 1CNQA 2OWZA 4N8GA 4YICA 3T0JA 4GWZA 2HXRA 2PFYA 4PETA 1YYZA 4I40A 1XI6A 4MJOA 5IZ3A 4PAIA 4N6DA 4PGPA 4N91A 4QXDA 4OVRA 1KA1A 1RDXA 1JP4A 4I3YA 1IMEA 2P3VA 2XWIA 2ZZVA 4MCOA 4PFBA 1NV4A 4HXVA 2GQ1A 4XEQA 2FVZA 4NHBA 2WEFA 4PBQA 2KR0A 2WBBA 1FSAA 3KC1A 4AS5A 2HPGA 4F19A 2PCRA 2XWVA 1K9ZA 1FPGA 1NUYA 1FPJA 5IZ3B 4M1VA 2Y5LA 4GX3A 3RPLA 2XWOA 3W9WA 4DI3D 4F18A 1FBEA 1FPFA 1FTAA 1KZ8A 5F24A 3NOHA 2HZLA 4GWXA 4NX1A 4X04A 1D9QA 3FBPA 5ET5A 4JVDA 2Q9TA 2XA5A 4P8BA 1FBFA 2V4CA 1SPIA 1EYIA 2FIEA 5EQ8A 4MNIA 4X8RA 4HE2A 4MX6A 1LBWA 1FPIA 1NV7A 4JVIA 2CZIA 1IMFA 5CM6A 2QVVA 2CEXA 3MYUA 5ET6A 4XF5A 5J16A 4PFIA 5A5LA 3RPLB 1LBYA 4NN3A 2VPOA 1K9YA 4QBAA 4PDDA 3BIHA 1NV2A 4IR8A 3IFAA 2XXKA 3HFUA 4HCWA 3W9VA 1KA0A 1LBZA 4PC9A 2FHYA 2OX3A 1FPLA 3LUZA 1FPBA 4LN5A 2QVUA 1AWBA 2VT5A 4MAGA 4P1LA 4GX6A 4OANA 5JK4A 2MKZA 3PTYA 1FPDA 4OVTA 2FIXA 2B4MA 4O7MA 4GWWA 3IFCA 4GX4A 3SZPA 4MIJA 4NAPA 1DCUA 1NV1A 4O7IA 3E79A 3ROJA 1BK4A 1RDZA 1YXIA 2F3DA 5FBPA 3E78A 2QFLA 2F5XA 1IMCA 1Q9DA 3FXBA 3MSTA 4PGNA 4X9TA 5IGAA 1FBPA 4OVQA 3QMFA 4HE0A 4F1UA 5EQ7A 1EYKA 1FJ9A 2F3BA 1RDYA 1IMAA 1G0IA 4OVSA 4NGUA 5IZ1A 1NUZA 1LBVA 4MMPA 4G61A 4NF0A 2Y5KA 1FBCA 2Q8MA 2CZHA 1VDWA 4HE1A 4H45A 1FPEA 2ZZXA 4O94A 4P47A 1LEVA 3LV0A 3ISPA 3T1BA 5EQAA 2CZKA 3CHGA 5ET7A 4H46A 5ET8A 1YZ0A 1IMDA 1NV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q74 A;  1NV0 A;  4GBV A;  1NV5 A;  4GWY A;  4KXP A;  1NI9 A;  3KC0 A;  1IMB A;  5DW8 A;  4GWU A;  4GWS A;  4FBP A;  1FJ6 A;  5EYH A;  2P3N A;  3KBZ A;  2HHM A;  3A29 A;  3RYD A;  1FRP A;  5ESY A;  2BJI A;  1NUX A;  4I3E A;  1NV6 A;  2QVR A;  1INP A;  2WBD A;  4AS4 A;  3BIG A;  2JJK A;  1DBZ A;  5I3S A;  3B8B A;  5EQ9 A;  5EYG A;  1LBX A;  5T3J A;  3D1R A;  4GBW A;  1FBH A;  1FPK A;  2DDK A;  2FBP A;  1DK4 A;  5LDZ A;  4N81 A;  1FBD A;  1FBG A;  4PTK A;  1G0H A;  2R8T A;  1NUW A;  1EYJ A;  1QGX A;  1CNQ A;  2OWZ A;  3T0J A;  4GWZ A;  1YYZ A;  4I40 A;  1XI6 A;  4MJO A;  5IZ3 A;  4QXD A;  1KA1 A;  1RDX A;  1JP4 A;  4I3Y A;  1IME A;  2P3V A;  1NV4 A;  4HXV A;  2GQ1 A;  2FVZ A;  2WEF A;  2WBB A;  1FSA A;  3KC1 A;  4AS5 A;  2PCR A;  1K9Z A;  1FPG A;  1NUY A;  1FPJ A;  5IZ3 B;  2Y5L A;  4GX3 A;  3RPL A;  1FBE A;  1FPF A;  1FTA A;  1KZ8 A;  5F24 A;  4GWX A;  1D9Q A;  3FBP A;  5ET5 A;  1FBF A;  1SPI A;  1EYI A;  2FIE A;  5EQ8 A;  4HE2 A;  1LBW A;  1FPI A;  1NV7 A;  2CZI A;  1IMF A;  2QVV A;  5ET6 A;  5J16 A;  5A5L A;  3RPL B;  1LBY A;  1K9Y A;  3BIH A;  1NV2 A;  4IR8 A;  3IFA A;  1KA0 A;  1LBZ A;  2FHY A;  2OX3 A;  1FPL A;  3LUZ A;  1FPB A;  2QVU A;  1AWB A;  2VT5 A;  4GX6 A;  1FPD A;  2FIX A;  4GWW A;  3IFC A;  4GX4 A;  1DCU A;  1NV1 A;  4O7I A;  3ROJ A;  1BK4 A;  1RDZ A;  1YXI A;  2F3D A;  5FBP A;  2QFL A;  1IMC A;  1Q9D A;  1FBP A;  3QMF A;  4HE0 A;  5EQ7 A;  1EYK A;  1FJ9 A;  2F3B A;  1RDY A;  1IMA A;  1G0I A;  5IZ1 A;  1NUZ A;  1LBV A;  4G61 A;  2Y5K A;  1FBC A;  2Q8M A;  2CZH A;  1VDW A;  4HE1 A;  4H45 A;  1FPE A;  1LEV A;  3LV0 A;  5EQA A;  2CZK A;  5ET7 A;  4H46 A;  5ET8 A;  1YZ0 A;  1IMD A;  1NV3 A; 
#chains in the Genus database with same CATH topology
 3K6W A;  1O7T A;  4JXI A;  4N6P A;  3C33 A;  3OO7 A;  2DE2 A;  3MBP A;  4OER A;  4QSD A;  4P9K A;  3EF7 A;  2YLN A;  2DE4 A;  1B7Z A;  1S50 A;  3FIR A;  1P1Q A;  3KN3 A;  1MXW A;  1VFE A;  1SDX A;  3IAZ A;  3H4Z A;  4AQ4 A;  2ABH A;  2O7U A;  3SEY A;  1IXI A;  1FPK A;  3MP8 A;  2F6P A;  4DXC A;  5HPQ A;  2B65 A;  3G3G A;  4JWY A;  1A8E A;  2CMO A;  3PPP A;  4YIC A;  3T0J A;  5CI5 A;  4N91 A;  3UK4 A;  1M5E A;  4R9F A;  1XS5 A;  2OJT A;  2AIX A;  5HBC A;  3DP8 A;  2H98 A;  1EU8 A;  4OFL A;  1HSJ A;  1N3W A;  5KCJ B;  1LBW A;  2ANJ A;  3G3F A;  3FZV A;  3OXN A;  1Y1Z A;  1UIV A;  1WDN A;  4IO7 A;  1NV2 A;  4GF8 A;  1FPB A;  3VXC A;  1DOT A;  4DCY A;  3UOR A;  1B3E A;  1FCK A;  1IEJ A;  2OK2 A;  3GZG A;  2X7Q A;  3RNN A;  2HAU A;  2ZNU A;  4HE0 A;  4C0R A;  2QS2 A;  2Y7I A;  1Y3Q A;  1VDW A;  1NL5 A;  1ZKB A;  2D21 A;  1LEV A;  1RYX A;  2DOJ A;  4RJZ A;  4OFJ A;  3QYT A;  1HSE A;  3CHG A;  1LGB C;  5I58 B;  3IO6 A;  3S9E A;  2XXX A;  1NMU A;  3MZ1 A;  3K4U A;  4P3L A;  2R71 A;  4OA4 A;  3SEV A;  2XXY A;  2NOO A;  4JSO A;  4ESX A;  3KOS A;  1YPN A;  3EHU A;  2DSF A;  1UTH A;  3TQW A;  1B0L A;  2PMS A;  1DBZ A;  2WYP A;  4GLI A;  4PF8 A;  3GXA A;  3IOV A;  4NMY A;  5EHS A;  5LTC A;  4NG7 A;  3IB2 A;  3IJO B;  3P7I A;  3V8X B;  3TYH A;  3H06 B;  4WEP A;  1XOC A;  4XKQ A;  2IEE A;  2ZMB A;  1IME A;  2OCU A;  1BIY A;  3O97 A;  4RK2 A;  4NHB A;  3FVK A;  4PBQ A;  5CMC A;  2KR0 A;  3UIF A;  1MY1 A;  2XWV A;  3WAF A;  3ECR A;  4NX1 A;  4DZ1 A;  3FBP A;  4P8B A;  2V4C A;  2UYF A;  4MX6 A;  4KQP A;  5CM6 A;  1NH7 A;  2QVV A;  2AL4 A;  2O68 A;  3KEI A;  1FPL A;  2REG A;  1GGG A;  1R9L A;  4G8M A;  2B4M A;  2XD3 A;  4IO4 A;  4GWW A;  3TCG A;  1RDZ A;  5H8H B;  4JWO A;  5A5X A;  5H8F A;  4KYS A;  4GVO A;  1NNF A;  1PBQ A;  4MMP A;  3LV0 A;  3ISP A;  2XXP A;  2F35 A;  4ZEC A;  5CMM A;  5ET8 A;  3VFJ A;  1IXC A;  2DVZ A;  3MVX A;  3VLU A;  4PBH A;  3LR1 A;  4U2R A;  4RY1 A;  3ODB A;  1MY4 A;  2I4B A;  2RC7 A;  4MNC A;  1FQD A;  1LLS A;  5CC2 A;  4OVP A;  4XKP A;  2X26 A;  4Q8R A;  3M8U A;  2OLB A;  2JJK A;  4G8N A;  5I3S A;  1DPE A;  5EYG A;  4OXV A;  2I58 A;  4PFR A;  3EKI A;  2DVC A;  4GQO A;  3F11 A;  3K01 A;  2QS4 A;  5KDT B;  4NWC A;  2PT2 A;  1ELJ A;  2LAO A;  3UP9 A;  1NUW A;  1MM6 A;  5B7D A;  4PAK A;  2GRV A;  4GWZ A;  2HXR A;  3KOT A;  4R72 A;  1LAX A;  2AL5 A;  2RC8 A;  2O84 X;  2XWI A;  4YMB A;  4H6D A;  2XXI A;  4RYA A;  1LFI A;  1FPJ A;  1UTB A;  2ONR A;  1FPF A;  1YTV A;  4KPT A;  2XA5 A;  3TEP A;  3MW0 A;  2FIE A;  3O9P A;  4IY5 A;  4YU0 A;  1SVX B;  4YB6 A;  1Q1K A;  4KFQ A;  5KCJ A;  3MVZ A;  2UVH A;  1MG1 A;  3S2V A;  1OMP A;  3LSL A;  4GX4 A;  4OET A;  2VHA A;  4F3B A;  1H43 A;  3K6U A;  2I3W A;  5EYF A;  3K6V A;  3RLF E;  1SW5 A;  4ZE8 A;  1EZP A;  3O29 A;  3C35 A;  3E13 X;  4NE4 A;  2Y5K A;  1P1O A;  3UN6 A;  3FXQ A;  2QL3 A;  4AB5 A;  2XD2 A;  3PV0 E;  5JTY A;  1NNK A;  4GBV A;  5I7I A;  5ELV A;  1JQF A;  4NQ8 A;  4C1U A;  2H9B A;  2VD2 A;  1MS7 A;  5I58 A;  1ZMG A;  3Q26 A;  4THI A;  1B58 A;  5KDT A;  3PPN A;  4PAF A;  2UVI A;  3FVG A;  2I0B A;  4PCD A;  1SYH A;  1B5I A;  5IAI A;  1FBD A;  1GVC A;  2Z23 A;  2R8T A;  3VVD A;  1KWH A;  3EHT A;  3VLV A;  3PU5 A;  4FAJ A;  3CG1 A;  3OEN A;  4PGP A;  1IZ1 A;  5IZ3 A;  2HEU A;  4OVR A;  2XX9 A;  3OO9 A;  1LBB A;  1PB7 A;  1QUI A;  3T9X B;  4MBP A;  4POX A;  3N5L A;  3VVF A;  4KD5 A;  2OWT A;  3RPL A;  1I69 A;  1URG A;  3CR9 A;  2HZL A;  4GWX A;  4ND9 A;  2Q9T A;  2F8D A;  5EQ8 A;  1NV7 A;  5I59 A;  3B7D A;  1JW4 A;  4PFI A;  1P99 A;  1T0K A;  3S9N C;  2RCA A;  1A8F A;  5BWJ A;  2RF1 A;  4BDR A;  4PC9 A;  4LAT A;  4P1L A;  2CZL A;  4IGT A;  3C32 A;  4ELO A;  3VDF A;  4F3G A;  2QFL A;  4YMA A;  5I2K B;  5M2V A;  1N76 A;  3MVW A;  3H3G A;  2UVJ A;  1FBC A;  4I62 A;  5JEI A;  2ZYK A;  4QFK A;  3OEL A;  5AE4 A;  1N84 A;  1IMD A;  2Q74 A;  4YKJ A;  3DLN A;  4OVJ A;  1MQD A;  5B70 A;  4GXA A;  2P2A A;  1A40 A;  4P56 A;  2D3I A;  1A55 A;  4N15 A;  4ISU A;  4F29 A;  2FA7 A;  1ATG A;  4FOR A;  3RQT A;  4F22 A;  2H4I A;  3DP4 A;  3D1R A;  2RKM A;  4Q5T A;  2G29 A;  1DTG A;  5DT6 A;  1B5H A;  1YYZ A;  1LBC A;  5AA4 A;  5I2N B;  2A5T B;  1IIT A;  1B0H A;  4KHZ E;  4NF5 B;  1JW5 A;  1SI0 A;  2G93 A;  1MQI A;  1TWY A;  3NOH A;  2DXY A;  1D9Q A;  1M5D A;  4JVD A;  1N0T A;  3MYU A;  2XX7 A;  1UTB B;  2QS1 A;  3OOA A;  2MKZ A;  1PEB A;  1NV1 A;  1BK4 A;  5ICT A;  1IMC A;  1Y20 A;  4X9T A;  3KN7 A;  2HFB A;  3AXF A;  3OO6 A;  1CE2 A;  4OZ9 A;  1AL3 A;  3G3I A;  4NF0 A;  4N13 A;  3BBR A;  4P47 A;  2CZK A;  1FQB A;  3B50 A;  2B4L A;  3N94 A;  3HST A;  4OWD A;  1LAF E;  4GWY A;  1NI9 A;  4HCY A;  2I0C A;  3LUY A;  5L9S A;  2UVG A;  4FBP A;  5LOM A;  1MPB A;  1O64 A;  4UAC A;  2XXQ A;  1FRP A;  5ESY A;  1INP A;  4KCD A;  5EQ9 A;  2AYS A;  2O7I A;  2A5S A;  4GD5 A;  2XXR A;  4TLM B;  4O8M A;  1A7L A;  2D5W A;  1B05 A;  4POW A;  3R7X A;  1XVY A;  5AA4 B;  3IK6 B;  4NF5 A;  4N6K A;  2KLF A;  4ZE9 A;  1XI6 A;  1BTJ A;  1KA1 A;  1B46 A;  2GQ1 A;  4AS5 A;  3KC1 A;  4PQJ A;  5IZ3 B;  1FBE A;  2FYI A;  3VXB A;  2F97 A;  4QRZ A;  4HE2 A;  4JVI A;  4FEC A;  1O63 A;  5J16 A;  5AA3 A;  1B6H A;  1A54 A;  1LBZ A;  2OX3 A;  1FPD A;  4DE8 A;  1H3D A;  4LZ5 A;  1H76 A;  4OQO A;  2DQV A;  4RPO A;  3MP1 A;  1B3H A;  3ZKL A;  3LSX A;  3MST A;  3TOD A;  1LAG E;  1FQC A;  1EYK A;  1FJ9 A;  1RDY A;  2I3V A;  4NGU A;  5L9O A;  3A3C A;  1P1N A;  4YAH X;  4H8I A;  3G3H A;  1BLF A;  2WKY A;  1YZ0 A;  1NKX A;  1L5T A;  4TQU Q;  1Y4T A;  1IMB A;  4EXK A;  3C4M A;  3HN0 A;  3C9H A;  3IB0 A;  4H67 A;  3SET A;  2WBD A;  1EZ9 A;  1LST A;  4YB5 A;  4FIM A;  3TKD A;  5DEX A;  1JEV A;  2Z8D A;  3DEL B;  4UAB A;  5F7V A;  1OQH A;  1YAE A;  1F9B A;  4RNS A;  1G0H A;  1TFA A;  1XVX A;  2OWZ A;  1URD A;  2Y7K A;  2V3U A;  4MJO A;  1SW2 A;  4PFT A;  3CFZ A;  5ITP A;  4JB7 A;  2PCR A;  4LVQ A;  2E1S A;  4F18 A;  1N7X A;  3H03 A;  1FTA A;  3SER A;  1B32 A;  4U4X A;  3PPQ A;  3HHF A;  4LQ5 A;  2F78 A;  3PUW E;  3IO4 A;  4G2Z A;  3D4C A;  1MY2 A;  4XFE A;  2Q2A A;  5HM4 B;  5CMK A;  1B7U A;  4ZEK A;  4ZS9 A;  3QMF A;  5AA1 A;  3S9L C;  1G0I A;  3N6U A;  2I49 A;  4F2O A;  1FTK A;  2VP1 A;  4H45 A;  1MPD A;  2QS3 A;  3T1B A;  1AMF A;  1VSO A;  2HAV A;  1OIB A;  4E0X A;  4YKK A;  4WED A;  4KYE A;  4G8H A;  1XHY A;  4OEN A;  1VFD A;  2DE3 A;  1B7H A;  3GYY A;  2NUV A;  3PUV E;  2BJI A;  3SEW A;  2WYK A;  4AS4 A;  4ZEI A;  3CIJ A;  3TEL A;  1AIV A;  2QMW A;  4N81 A;  5H8N B;  3W15 C;  1LB8 A;  3QK6 A;  4PP0 A;  1OQG A;  4OES A;  1FTL A;  4OMB A;  1YCJ A;  3O6H A;  1GTK A;  1MDQ A;  4N6D A;  3CVG A;  4QFO A;  4QXD A;  1A99 A;  3EQ1 A;  2ZZV A;  1XT8 A;  3VLW A;  4IO6 A;  1D9V A;  1ZIU A;  5FHN A;  4NF6 A;  1LAH E;  1SPI A;  4I1D A;  3ZKK A;  1UQW A;  2CEX A;  4EDP A;  1QUJ A;  1ZJL A;  3EHS A;  3IFA A;  4FAT A;  4F1Y A;  2F36 A;  5A5X B;  3U94 A;  2ZYO A;  4NAP A;  1LCT A;  5DYH A;  1DPP A;  2F5X A;  4F1U A;  4OVQ A;  3QAX A;  1IMA A;  4XKR A;  4OVS A;  2DXR A;  3FVN A;  4EQ7 A;  4EUO A;  3U93 A;  2Q8M A;  1PC3 A;  2V84 A;  5EQA A;  4F2Q A;  2PYY A;  3TTR A;  2FIX A;  4F3S A;  1B9J A;  2Q8J A;  2RIN A;  5EYH A;  2P3N A;  1Y1M A;  1I6B A;  3KSJ A;  1PDA A;  4NTL A;  1S7Y A;  2O51 A;  3FXU A;  1LBX A;  5T3J A;  2B3F A;  4MEV A;  1D4N A;  1FBH A;  3TAJ A;  3MJN A;  4IO2 A;  3TFL A;  3RGY A;  1UTH B;  4YZZ A;  3Q28 A;  4AB6 A;  4EQ9 A;  2WX9 A;  1IQ7 A;  3MQ9 A;  3FV2 A;  2PFY A;  4I40 A;  4ECF A;  5L9M A;  1NV4 A;  3E9X A;  4G4P A;  2FVZ A;  4ELP A;  1VR5 A;  3ILU B;  2XWO A;  5ICQ A;  3KBR A;  4GIZ A;  1MY0 A;  1FBF A;  2FNC A;  1EYI A;  4GFR A;  2V25 A;  3O66 A;  1IMF A;  1N04 A;  1LB9 A;  2YPN A;  1LBY A;  2VPO A;  3TMG A;  4IR8 A;  1H45 A;  3HFU A;  4HCW A;  1B40 A;  1FTM A;  3SDF A;  4LP2 B;  4OVT A;  3O28 A;  1QKB A;  3O6I A;  3THI A;  3ROJ A;  4ELR A;  1ANF A;  4NF8 B;  4ZEF A;  2R6G E;  1WVJ A;  1Q9D A;  2RC9 A;  5IGA A;  4NWD A;  1QUL A;  4R6H A;  2B3B A;  3IOW A;  4DDD A;  5IZ1 A;  3B6Q A;  3FJG A;  1MXY A;  1RKM A;  1VE4 A;  4G77 A;  4H8J A;  3OSR A;  5H8H A;  5H8S A;  1TT1 A;  1CB6 A;  1MXX A;  4YKI A;  1PB8 A;  1NV0 A;  2Q89 A;  1Z7N E;  2KQZ A;  4X48 A;  4H65 A;  1JNF A;  3V89 B;  2DWI A;  4GOT A;  3MC2 A;  4O3B A;  3OEK A;  3USD A;  2QVR A;  4QF9 A;  1NNP A;  1MQH A;  1B1H A;  2CEY A;  2V3T A;  3B8B A;  4MNP A;  2ONK E;  3MP6 A;  3A3U A;  3L6H A;  1DK4 A;  4JWX A;  3WAE A;  5J1D A;  2F34 A;  3RT8 A;  4Q0C A;  5I5P A;  3HPI A;  2GH9 A;  2Y7W A;  1SI1 A;  1BKA A;  3N26 A;  5H8N A;  4C1T A;  3GBB A;  2HQ0 A;  1MQJ A;  4N07 A;  2THI A;  1FSA A;  2W7Y A;  1M5B A;  4U21 A;  4JDF A;  2OPD A;  1NUY A;  1QW0 A;  1KZ8 A;  3W9W A;  3PUY E;  1Y3P A;  3HV1 A;  3CG3 A;  5ET6 A;  3SES A;  3MPL A;  3MPK A;  1M5C A;  1SW4 A;  1FTJ A;  1MQG A;  3G3J A;  2XX8 A;  4OAN A;  3PTY A;  3R6U A;  3KSX A;  2HXW A;  1OVB A;  4LQ2 A;  3BFU A;  3O2A A;  5FBP A;  2H25 A;  1I6Q A;  1US5 A;  4LA9 A;  5CBS A;  4U23 A;  3G7W A;  4H5F A;  3DP6 A;  3HO7 A;  1N7W A;  2DYX A;  3TCH A;  3I6V A;  3PD9 A;  4PFU A;  4FED A;  2XXT A;  3IR1 A;  3UA8 A;  1B5J A;  3LSW A;  4KXP A;  4JVC A;  4Z0I A;  3MZ9 A;  1FQF A;  2PX1 A;  2VGQ A;  3G3K A;  4HTG A;  3FJM A;  4PDH A;  5JTY B;  3TPA A;  1IUD A;  3KFM A;  1AOV A;  4DIG A;  5IZZ A;  1FW0 A;  3FUZ A;  1FTO A;  4GBW A;  2I4C A;  2F7A A;  1MXV A;  2ZZW A;  3FXR A;  4OTE A;  4ONY A;  4P11 A;  4GL8 A;  3L6G A;  1MM7 A;  4RPN A;  1OLA A;  4X1B A;  3R26 A;  1JP4 A;  4R74 A;  2P3V A;  4MCO A;  4U1O A;  1UIU A;  4XEQ A;  5DVJ A;  2WEF A;  2HPG A;  4F31 B;  3PPO A;  4FJP A;  1MRP A;  4X8R A;  1Y3N A;  1DSN A;  5H8Q A;  5A5L A;  1B4Z A;  2UYE A;  2O69 A;  1MH3 A;  3U1O A;  2R9J A;  4PF6 A;  4P0I A;  1ZLQ A;  5I59 B;  4O7M A;  3PUX E;  1QJM A;  1DCU A;  4O7I A;  2F3D A;  5K2Y A;  4YB7 A;  1MXU A;  1JW1 A;  3TCF A;  1TFD A;  2GFE A;  3U72 A;  4X1D A;  4HE1 A;  1LCF A;  1QKA A;  3OMB A;  1SYI A;  4EF1 A;  1MXZ A;  2PT1 A;  4N4U A;  5CMB A;  2QMX A;  5IM2 A;  3K1N A;  4G68 B;  4KR5 A;  4GWU A;  5K2X A;  1NFT A;  3IL1 B;  3RYD A;  1M5F A;  1NV6 A;  3IB1 A;  1FQA A;  3C31 A;  4ELQ A;  3KJ7 A;  2YJP A;  4R6Y A;  3VVE A;  1AH5 A;  3EPE A;  3H6T A;  3TUS A;  3CFX A;  4ZDM A;  3LC8 A;  4M4G A;  1EH3 A;  3K00 A;  1SW1 A;  2L5V A;  1URS A;  3PMV A;  1OLC A;  3FVO A;  4LZ8 A;  1EYJ A;  2DWA A;  1CNQ A;  3KG2 A;  1B2H A;  4H5G A;  3I5O A;  1NNT A;  2Y7P A;  1EZO A;  4I3Y A;  2PBW A;  2O6A A;  5H8Q B;  3MVY A;  4DI3 D;  2Y5L A;  4QHQ A;  2CZI A;  3RN8 A;  3M3F A;  2Z8F A;  3O6G A;  4MAG A;  2QVU A;  1GR2 A;  4GX6 A;  4WXJ A;  2DWH A;  2NVU B;  2Y7R A;  2REJ A;  4MIJ A;  4OFO A;  3KN8 A;  1BP5 A;  4PGN A;  4DXB A;  1JVY A;  3M3L A;  2RCB A;  4DLD A;  3PD8 A;  2HCA A;  1USY E;  5ISU A;  4QFN A;  1LBV A;  4OEV A;  2CZH A;  4G68 A;  5KZT A;  3C34 A;  5CBR A;  3QXM A;  5ITO A;  5H8F B;  3VE1 B;  2OBG A;  5ET7 A;  1HSL A;  1MDP 1;  4GRK A;  3U8Q A;  1JET A;  1NH8 A;  2DS9 A;  4GWS A;  3MWB A;  4KI0 E;  4FE8 A;  5DEX B;  2HHM A;  1ZU0 A;  1NUX A;  4RK9 A;  4BDN A;  5DVI A;  2GHB A;  2OPE A;  1P1U A;  4NF4 B;  3JYR A;  1POT A;  5TP9 B;  3RTW B;  2FBP A;  1PBP A;  5TPA B;  3TDJ A;  2NXO A;  4PTK A;  5I84 A;  2VD3 A;  4P0G A;  1DTZ A;  2PFZ A;  3PMW A;  4PE5 B;  2QSX A;  2ESN A;  1RDX A;  5L8D A;  1GV8 A;  4DXU A;  1ZTY A;  3QSL A;  1PB9 A;  3S9M C;  4QFL A;  4IY6 A;  1ZBM A;  4M1V A;  3A09 A;  1B4H A;  4DCX A;  4ZZE A;  5F24 A;  1SD3 A;  1SQY A;  4R2B A;  5FTI A;  2DP8 A;  3PPR A;  4HW8 A;  4NN3 A;  1K9Y A;  1QVS A;  3BIH A;  4XIG Q;  3EN3 A;  2FHY A;  2VOZ A;  4LN5 A;  3T66 A;  1LFH A;  5JK4 A;  1B51 A;  5I2K A;  3IOR A;  3KGC A;  3Q29 A;  3K02 A;  4KYD A;  3U92 A;  1USY H;  3E4R A;  3FAT A;  1FBP A;  5EQ7 A;  2O1M A;  1POY 1;  2F3B A;  2Q88 A;  3TTK A;  2Z22 A;  1Z7M E;  4G61 A;  3HHG A;  2O1L A;  1FPE A;  3FD3 A;  4ZED A;  3T9H B;  3RT6 B;  5DTB A;  4NED A;  5F1Q A;  4MHF A;  3T22 A;  4L17 A;  1B3G A;  2Y84 A;  2P0S A;  3KC0 A;  2QPQ A;  5DW8 A;  2ZXT A;  3TQL A;  2I48 A;  3KZG A;  4N8Y A;  5TP9 A;  4I3E A;  3MZB A;  2V3Q A;  2UXA A;  3CSB A;  3BIG A;  3FAS A;  4U22 A;  4K3F A;  3U65 A;  3OO8 A;  3T93 B;  3ZSF A;  4Z7E A;  2DDK A;  3BKI B;  2A5T A;  3C36 A;  2HZK A;  4P1E A;  1Y4C A;  2VPN A;  5FTH A;  1QGX A;  4MLQ A;  3JV9 A;  4U1Z A;  3PGF A;  2H99 A;  3D4G A;  4PFB A;  4NF6 B;  2ALU A;  4F19 A;  1US4 A;  1D3K A;  1LFG A;  2Z8E A;  3IJX B;  4LZ7 A;  3T96 B;  4MNI A;  3IOU A;  3ILT B;  5CRY A;  4XXU A;  4XF5 A;  1R1N A;  1P1W A;  3RPL B;  2ONS A;  4F39 A;  4QBA A;  2XHD A;  4XTC Q;  3K1P A;  5EHM A;  4TOZ A;  3CI8 A;  2ZYM A;  3RY3 A;  2VT5 A;  2Q2C A;  3MUQ A;  3TTL A;  3LBS A;  1Q35 A;  3TTN A;  5DVF A;  1YXI A;  4OHN A;  3K2D A;  1B3F A;  4PFW A;  4OEU A;  3QUJ A;  3Q25 A;  3FV1 A;  4PFY A;  1IIW A;  1B1X A;  3CSG A;  3B6W A;  4KCC A;  1IXH A;  5AA2 A;  4H46 A;  4R6K A;  5FHM A;  1SBP A;  2F6G A;  2P1S A;  4IB2 A;  1FJ6 A;  3GBA A;  5TU0 A;  3A29 A;  2ZNS A;  1MH4 A;  2GHA A;  4LON B;  1DMB A;  2H5Y A;  2DWJ A;  1I6A A;  4GWO A;  4PE3 A;  3T9U A;  4DI4 B;  4EQB A;  2I6E A;  4E0W A;  3TTM A;  4ESW A;  5I56 A;  3MAM A;  1JVX A;  4QSE A;  3SEU A;  4NF4 A;  3SKP A;  4IO3 A;  4PAI A;  3K1M A;  4QFP A;  5TPA A;  4I8C A;  3SEX A;  3B6T A;  5AA2 D;  4RA1 A;  4HXV A;  4WKM A;  4ZZA A;  3RTF B;  5IKB A;  5FHO A;  1JEU A;  3UGW A;  3PMX A;  4GX3 A;  5I2N A;  2ZYN A;  4X04 A;  1N3X A;  5ET5 A;  4R2F A;  1D9Y A;  3OEM A;  2OWS A;  4OYV A;  1H44 A;  4MH5 A;  3IOT A;  2XXK A;  3FGS A;  3W9V A;  1KA0 A;  4PET A;  4QSC A;  3IX1 A;  1II5 A;  1MPC A;  4ZEB A;  3H6U A;  3E78 A;  3H7M A;  4MFI A;  3FXB A;  2V93 A;  4G68 C;  4BDL A;  1RYO A;  3M3K A;  5AA2 B;  5I57 B;  4F3P A;  4FEB A;  2PVU A;  4Q30 B;  3PUZ E;  4UA8 A;  1NUZ A;  3H6W A;  4JSD A;  4JBZ A;  2M8C A;  3RPW A;  4O3A A;  2ZZX A;  4O94 A;  4MLV A;  3TZA A;  2XWK A;  3QUF A;  1NV5 A;  4EXL A;  3BFT A;  3Q27 A;  3JZJ A;  3T9V A;  4TLL B;  3V83 A;  4N17 A;  4F1V A;  3KBZ A;  3I3V A;  3VV5 A;  4R75 A;  3CRB A;  5I56 B;  1WOD A;  2QJE A;  3ZS6 A;  4H1X A;  4I9D A;  2XXW A;  4IGR A;  1R9Q A;  4R9G A;  5LDZ A;  1FBG A;  4O3C A;  2OZZ A;  1FQE A;  2XXU A;  4N8G A;  4LUB A;  4BDQ A;  4RXL A;  4HS7 A;  4BDM A;  1XC1 A;  1OVT A;  3N6T A;  4IO5 A;  2E0S A;  2X7P A;  3HCQ A;  3KJT A;  4R73 A;  1IXG A;  2NWJ A;  1K9Z A;  3RUM A;  3OSQ A;  1FPG A;  4GL0 A;  2IA4 A;  3SZP A;  1S9T A;  2ZNT A;  1R6Z A;  1Y9U A;  2XXV A;  4BDO A;  3CFL A;  1FPI A;  4U4S A;  2XXH A;  4GXS B;  4PDD A;  3DM0 A;  3E3K A;  3LUZ A;  3FJ7 A;  3LSF B;  1B3L A;  1AWB A;  4H0W A;  3H6V A;  3ONM A;  4BLA A;  3IFC A;  3K0V A;  1TXF A;  4MF3 A;  1J1N A;  5I57 A;  4XKN A;  3E79 A;  2QRY A;  4EF2 A;  3OD7 A;  1QUK A;  2BJJ X;  3K6X A;  5BUU A;  3V5A A;  2F7B A;  4NF8 A;  2F7C A;  3GLB A;  3QIM A;  4YKP A;  1B52 A;  1MY3 A;  3S4U A;  2WBB A;  1NV3 A; 
#chains in the Genus database with same CATH homology
 2DVZ A;  2Q74 A;  1NV0 A;  2B4L A;  2XWK A;  3B50 A;  4MHF A;  5IM2 A;  4P3L A;  4GBV A;  1NV5 A;  2KQZ A;  4GWY A;  5I7I A;  4KXP A;  1NI9 A;  3KC0 A;  4HCY A;  2QPQ A;  4OA4 A;  1IMB A;  5DW8 A;  4PBH A;  4GWU A;  4GWS A;  4JVC A;  4NQ8 A;  4FBP A;  1FJ6 A;  4N8Y A;  2DE2 A;  2DE3 A;  4N17 A;  5EYH A;  4F1V A;  4PDH A;  4P9K A;  2P3N A;  3KBZ A;  2HHM A;  3A29 A;  3RYD A;  4MNC A;  3GYY A;  1FRP A;  5ESY A;  2BJI A;  1NUX A;  4I3E A;  1NV6 A;  2DE4 A;  4P56 A;  2WYK A;  4OVP A;  2QVR A;  4XFE A;  2V3Q A;  1INP A;  2WBD A;  4N15 A;  4AS4 A;  4PE3 A;  3BIG A;  4PAF A;  5IZZ A;  2JJK A;  1DBZ A;  2CEY A;  5I3S A;  3B8B A;  5EQ9 A;  5EYG A;  4MNP A;  2WYP A;  1LBX A;  5T3J A;  4PFR A;  3D1R A;  3U65 A;  4MEV A;  3EKI A;  4GBW A;  4DI4 B;  1FBH A;  1FPK A;  2DDK A;  2FBP A;  4N4U A;  4O8M A;  4PCD A;  4PF8 A;  1DK4 A;  4UAB A;  5LDZ A;  4N81 A;  5J1D A;  4PF6 A;  1FBD A;  1FBG A;  2ZZW A;  4YZZ A;  4PTK A;  2L5V A;  5I5P A;  1G0H A;  2R8T A;  5LTC A;  2HZK A;  4NG7 A;  4P1E A;  1NUW A;  2WX9 A;  2VPN A;  4PAK A;  1EYJ A;  2PFZ A;  4N6K A;  1QGX A;  1CNQ A;  2OWZ A;  4N8G A;  4YIC A;  3T0J A;  4GWZ A;  2HXR A;  2PFY A;  4PET A;  1YYZ A;  4I40 A;  1XI6 A;  4MJO A;  5IZ3 A;  4PAI A;  4N6D A;  4PGP A;  4N91 A;  4QXD A;  4OVR A;  1KA1 A;  1RDX A;  1JP4 A;  4I3Y A;  1IME A;  2P3V A;  2XWI A;  2ZZV A;  4MCO A;  4PFB A;  1NV4 A;  4HXV A;  2GQ1 A;  4XEQ A;  2FVZ A;  4NHB A;  2WEF A;  4PBQ A;  2KR0 A;  2WBB A;  1FSA A;  3KC1 A;  4AS5 A;  2HPG A;  4F19 A;  2PCR A;  2XWV A;  1K9Z A;  1FPG A;  1NUY A;  1FPJ A;  5IZ3 B;  4M1V A;  2Y5L A;  4GX3 A;  3RPL A;  2XWO A;  3W9W A;  4DI3 D;  4F18 A;  1FBE A;  1FPF A;  1FTA A;  1KZ8 A;  5F24 A;  3NOH A;  2HZL A;  4GWX A;  4NX1 A;  4X04 A;  1D9Q A;  3FBP A;  5ET5 A;  4JVD A;  2Q9T A;  2XA5 A;  4P8B A;  1FBF A;  2V4C A;  1SPI A;  1EYI A;  2FIE A;  5EQ8 A;  4MNI A;  4X8R A;  4HE2 A;  4MX6 A;  1LBW A;  1FPI A;  1NV7 A;  4JVI A;  2CZI A;  1IMF A;  5CM6 A;  2QVV A;  2CEX A;  3MYU A;  5ET6 A;  4XF5 A;  5J16 A;  4PFI A;  5A5L A;  3RPL B;  1LBY A;  4NN3 A;  2VPO A;  1K9Y A;  4QBA A;  4PDD A;  3BIH A;  1NV2 A;  4IR8 A;  3IFA A;  2XXK A;  3HFU A;  4HCW A;  3W9V A;  1KA0 A;  1LBZ A;  4PC9 A;  2FHY A;  2OX3 A;  1FPL A;  3LUZ A;  1FPB A;  4LN5 A;  2QVU A;  1AWB A;  2VT5 A;  4MAG A;  4P1L A;  4GX6 A;  4OAN A;  5JK4 A;  2MKZ A;  3PTY A;  1FPD A;  4OVT A;  2FIX A;  2B4M A;  4O7M A;  4GWW A;  3IFC A;  4GX4 A;  3SZP A;  4MIJ A;  4NAP A;  1DCU A;  1NV1 A;  4O7I A;  3E79 A;  3ROJ A;  1BK4 A;  1RDZ A;  1YXI A;  2F3D A;  5FBP A;  3E78 A;  2QFL A;  2F5X A;  1IMC A;  1Q9D A;  3FXB A;  3MST A;  4PGN A;  4X9T A;  5IGA A;  1FBP A;  4OVQ A;  3QMF A;  4HE0 A;  4F1U A;  5EQ7 A;  1EYK A;  1FJ9 A;  2F3B A;  1RDY A;  1IMA A;  1G0I A;  4OVS A;  4NGU A;  5IZ1 A;  1NUZ A;  1LBV A;  4MMP A;  4G61 A;  4NF0 A;  2Y5K A;  1FBC A;  2Q8M A;  2CZH A;  1VDW A;  4HE1 A;  4H45 A;  1FPE A;  2ZZX A;  4O94 A;  4P47 A;  1LEV A;  3LV0 A;  3ISP A;  3T1B A;  5EQA A;  2CZK A;  3CHG A;  5ET7 A;  4H46 A;  5ET8 A;  1YZ0 A;  1IMD A;  1NV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...