1JP4A

Crystal structure of an enzyme displaying both inositol-polyphosphate 1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
302
Chain Sequence
HNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase
publication title Crystal structure of an enzyme displaying both inositol-polyphosphate-1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities: a novel target of lithium therapy.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 98
structure length 302
sequence length 304
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1jp4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1jp4A02
5EQAA 1EYIA 4HE2A 5ET8A 4HXVA 1FPLA 2JJKA 1NI9A 4G61A 2FVZA 1FBCA 1IMFA 1EYKA 2CZHA 1NUXA 3QMFA 4KXPA 1D9QA 1Q9DA 2WBBA 2CZIA 4GWSA 2Q74A 1VDWA 1YXIA 3KC0A 1FBFA 4FBPA 4GBVA 4GX4A 4O7IA 5EQ8A 1FPFA 3LV0A 1FBGA 5F24A 1NV4A 1IMCA 2QVUA 1QGXA 4H46A 4N81A 1NV2A 5I3SA 1G0IA 1RDXA 2PCRA 3LUZA 5ET5A 1YYZA 5LDZA 2P3VA 1FRPA 2QVRA 4GWWA 1INPA 1FSAA 4HE1A 1LBZA 1CNQA 1DK4A 2CZKA 4GWYA 2QFLA 5A5LA 2WEFA 1LEVA 2FIEA 4GWZA 1LBXA 1NUZA 1LBYA 1XI6A 3KC1A 5EYHA 2R8TA 1LBWA 4PTKA 1KA1A 3BIHA 1NV0A 5EQ9A 1NV6A 5EYGA 2VT5A 5ESYA 1FJ6A 1IMAA 1BK4A 2DDKA 3FBPA 1IMEA 1KA0A 5ET7A 1AWBA 1FBPA 4HE0A 2Q8MA 1FPIA 2HHMA 2OX3A 1IMBA 2QVVA 1DBZA 1NUYA 5EQ7A 1FBDA 1FBHA 1FPBA 1FPGA 5ET6A 3RYDA 1FPKA 3IFCA 1FPJA 3A29A 2WBDA 1IMDA 1LBVA 5J16A 1EYJA 3IFAA 4IR8A 1FJ9A 5IZ3A 4AS5A 4H45A 5T3JA 1K9ZA 2F3BA 3T0JA 1KZ8A 2FIXA 1JP4A 1NV3A 1FBEA 3ROJA 3RPLB 1G0HA 1NV1A 4QXDA 2FBPA 1NUWA 3KBZA 4GX6A 1NV5A 4I3EA 5IZ3B 1SPIA 4GWXA 1RDYA 4AS4A 2OWZA 1YZ0A 2Y5KA 5IZ1A 5FBPA 2F3DA 1DCUA 4I40A 2FHYA 1FTAA 4GWUA 4GBWA 4MJOA 3RPLA 2GQ1A 4GX3A 2BJIA 2P3NA 1K9YA 3D1RA 1NV7A 3B8BA 4I3YA 5DW8A 3BIGA 1FPDA 2Y5LA 1RDZA 1FPEA
chains in the Genus database with same CATH superfamily
1EYIA 4DLDA 4DCXA 1NI9A 3A09A 1MM7A 1Y1MA 2Q88A 3T66A 1B58A 1Y9UA 4OVTA 2UXAA 3H6WA 4OVJA 4OEVA 4IO7A 3K6VA 4N81A 4UACA 3N5LA 3ILUB 1I6QA 3O9PA 1INPA 2Z8DA 5I59A 2OWSA 1LBZA 3TTRA 5I57B 4OTEA 3TTMA 2ZNTA 2BJJX 3TPAA 3QXMA 1CE2A 1NV6A 3N94A 4RNSA 4PBQA 1PB9A 5ESYA 4HCYA 2DE2A 1IMAA 1H3DA 1FQDA 3R6UA 3PPQA 4ZS9A 1FTKA 3S9EA 1FBDA 1FPBA 1FPKA 5BWJA 3S4UA 2F78A 1VSOA 4QSCA 3GBBA 4DZ1A 4OANA 1OQGA 4NF4B 3T9VA 2RCBA 1P1OA 3KBZA 4GOTA 3TZAA 4G8HA 2Y5KA 5KCJA 5IZ1A 5H8FB 4MNPA 3K1NA 1XS5A 3O66A 2ZYKA 4LZ8A 2F6GA 1K9YA 5H8HB 2V4CA 1IZ1A 1QKAA 3Q25A 2XXHA 4MFIA 3OEMA 1M5DA 2I3WA 3O6GA 1DTZA 3T9HB 2AL4A 4KXPA 3T93B 1Q9DA 1LBCA 2ZYOA 1VDWA 4C1TA 3MWBA 3IOUA 4H6DA 2DVCA 4KQPA 1B4HA 1GTKA 2FYIA 2O84X 3EHUA 1NV4A 4GWOA 2O1MA 2Q9TA 2B3BA 1ZIUA 3TFLA 4Q0CA 4GXSB 4P3LA 1TFDA 4Q30B 2ONSA 1SW2A 1JNFA 3MVXA 2ZMBA 1B5IA 4PAIA 4POXA 3U1OA 2FIEA 1BIYA 5I84A 2H9BA 2DWJA 3SETA 3DLNA 4IY5A 1SYHA 1KWHA 3BIHA 4NE4A 3RUMA 1JW1A 3OO9A 2NXOA 4JVDA 1II5A 1JVYA 1B7ZA 2QVVA 4QSDA 5KDTB 2DXYA 2WBDA 1LBVA 5A5XB 2ANJA 4WXJA 1IXCA 4FEDA 3IFAA 2PVUA 3HSTA 3JZJA 2ZYNA 3CI8A 1NNTA 3KJ7A 1IXGA 3RT6B 3TTKA 1SDXA 3USDA 5FHMA 3U72A 1H76A 4RA1A 3CFLA 3IL1B 4NF6A 4PFRA 1IQ7A 3K01A 2HXRA 2PFZA 1M5FA 4EXKA 2V3QA 2OPEA 1FQAA 1RYOA 3K6WA 3QMFA 2DWIA 4GRKA 4ZE8A 2PFYA 3FXRA 3KGCA 4GX4A 1URGA 5AA3A 1FPFA 1MXUA 1N0TA 1ZLQA 5F24A 5I57A 3PU5A 2QVUA 2V3UA 5EYFA 2P1SA 3QUFA 1SI0A 2PCRA 1XC1A 2OWTA 2OPDA 3IJOB 4X48A 4M1VA 4MLQA 1B0LA 2O68A 1XI6A 2UYEA 1AIVA 5FTHA 1LAGE 1B9JA 4BDRA 4QSEA 2V25A 2O7UA 3VE1B 5DEXB 3K4UA 2VT5A 1P1NA 1R9LA 1IMEA 2XXVA 1Y4TA 5EHMA 4ZEKA 4DI3D 1EU8A 3CIJA 3FGSA 3UP9A 3ILTB 4GLIA 4LVQA 4GQOA 1IMDA 3IB1A 3CSBA 4AB6A 1FJ9A 4ELPA 1ZTYA 2Z8FA 4YMAA 4YKKA 5H8QB 5H8FA 2O51A 2A5TB 5CMMA 3OO6A 4XFEA 2Y7IA 4KPTA 1J1NA 4PP0A 4OQOA 3T1BA 2X7PA 3MPKA 2FHYA 1XVYA 1DSNA 2I6EA 1WODA 4N17A 2RF1A 5LTCA 4DXBA 1B7HA 1URSA 1RDZA 1NH8A 4HE2A 4RXLA 3EF7A 1NUXA 2H98A 4OMBA 3VVEA 2ZZVA 2GHBA 1UTHA 2XX8A 3K2DA 2CEYA 3ISPA 3IK6B 4FBPA 4GBVA 4NEDA 5EQ8A 4MNCA 5IM2A 2QSXA 4YKJA 2Y7PA 3TQWA 2RKMA 4EUOA 3MUQA 4G8MA 3LUZA 4NF0A 1XHYA 1Y20A 3VDFA 4F1YA 3UA8A 4PE5B 5IKBA 3UIFA 4ESXA 3QK6A 4FECA 1AOVA 3KN7A 4IO4A 4P47A 5KDTA 3PPNA 4P0IA 2DDKA 3FBPA 2Z22A 1YCJA 2VOZA 1GGGA 1B3FA 4EDPA 3KSJA 1DTGA 1B51A 4PFYA 1N3WA 3MZ1A 5ET6A 1I6AA 2P0SA 3R26A 4NMYA 1IEJA 5L9MA 2F34A 3MP1A 2I4CA 3LSWA 3D4GA 4N07A 4F29A 3C33A 5T3JA 4NWCA 2WKYA 3PUZE 2ZNSA 1JP4A 4ZEBA 4IO5A 2XWIA 2KQZA 1NV5A 3G3GA 4EF2A 3FXQA 1RDYA 1NNPA 3PD8A 4XF5A 3OMBA 3RPLA 1B2HA 4YICA 4MBPA 1MXZA 4OHNA 3FXUA 3OSRA 3PUXE 1N7XA 2FVZA 1N04A 3D4CA 5IZZA 2B4LA 3FIRA 2DYXA 1BKAA 1MY1A 4BDLA 4IGRA 2ZYMA 4ND9A 1IMCA 2F8DA 1FW0A 5AA2B 1XOCA 2QS3A 2Q89A 4DDDA 1PEBA 1LFGA 1B3HA 3C9HA 5HM4B 5DEXA 5FTIA 1R6ZA 3U8QA 2WX9A 4RY1A 3PUWE 3UK4A 2HEUA 4YKIA 5EYHA 4LZ5A 3MYUA 2O69A 4FJPA 4MMPA 1OLAA 4AB5A 3R7XA 2DOJA 1NMUA 2Q8MA 1FQCA 1IMBA 3PV0E 1UIUA 5DYHA 3HN0A 2A5TA 1SW1A 4QFOA 1A54A 3PPOA 3T96B 1QW0A 3V5AA 1SYIA 2RCAA 4QBAA 3S2VA 4LATA 1KZ8A 3IOWA 2OLBA 2XXIA 3TMGA 3TCFA 1TT1A 3BBRA 3B7DA 3RNNA 1MXXA 2HAVA 4ECFA 4MIJA 4GBWA 2P2AA 4RYAA 1USYE 5I58B 3GZGA 4MNIA 4F3PA 4XTCQ 1PDAA 3OSQA 4I3YA 1NH7A 3OO8A 2XXXA 4ZEFA 3MVWA 4BDNA 1FPEA 2XD2A 4F19A 3IOVA 4NTLA 1FTLA 3U94A 1ZKBA 4P56A 4F1UA 3M3FA 2CZHA 5TPAB 3H4ZA 3VXCA 1D9QA 3CR9A 2XXPA 4R9GA 3FVOA 4R6HA 2OJTA 4F39A 4H0WA 2XX7A 1MQHA 3IO4A 3KOTA 4NG7A 2H5YA 1OLCA 1Q1KA 2AIXA 1M5CA 5B7DA 1MY4A 5JK4A 4KCDA 2OBGA 4KI0E 3OEKA 4P8BA 4LQ2A 1LB8A 2ESNA 2GRVA 4KR5A 3G3HA 4IO2A 5EQ9A 4QFKA 4ESWA 5JTYA 3H3GA 5DT6A 2Q2AA 4OFLA 2NOOA 3E3KA 3RTWB 1IXHA 5M2VA 2Y7KA 3HHFA 2PT2A 3SEWA 4FORA 5L9SA 4AS5A 1RYXA 4I1DA 1QKBA 2UVGA 2W7YA 1Y4CA 1MXWA 1FBEA 4KYEA 2NUVA 4NWDA 1SD3A 3L6GA 4QFLA 1MRPA 1JEUA 4EF1A 4DXCA 3TTNA 2KR0A 1UTBB 3VVFA 3NOHA 4U23A 1EZ9A 2HXWA 1R1NA 1MG1A 3GLBA 2QMWA 4HXVA 1LAFE 2O7IA 1FQEA 1FBCA 1IMFA 5AA2A 2WBBA 4GF8A 3FV1A 3RN8A 1A7LA 4DE8A 2I0CA 4EXLA 5K2XA 3TELA 5DTBA 2CMOA 1O64A 2X26A 4H8JA 2QRYA 4GFRA 3ECRA 3HV1A 3CFXA 3MAMA 2GFEA 4ZE9A 3LSXA 3H03A 2PYYA 3FVKA 3OD7A 5I2NB 1A40A 3P7IA 2DS9A 3FVGA 1PBPA 3ZKKA 4F3BA 2R8TA 4R72A 5DVFA 3FJMA 4JWOA 4XKNA 5CI5A 1FJ6A 3E4RA 4DIGA 3B6WA 3EPEA 2V3TA 3I5OA 4JWXA 3V89B 4H65A 4NQ8A 3EHSA 4P11A 3PUYE 1FPGA 3B6QA 1FPJA 5J16A 1B6HA 1MY3A 2Y84A 4TOZA 3UN6A 1LBBA 4N13A 5I58A 1B05A 2H4IA 4JXIA 5H8NB 4G68B 4I8CA 3LSLA 2VP1A 4M4GA 1LSTA 4TLMB 1SPIA 1QJMA 1WDNA 4LA9A 1PC3A 1SVXB 4I40A 4MJOA 3A3UA 3UORA 2GQ1A 3H6VA 1AL3A 4G77A 5TP9B 1SW5A 5TPAA 2LAOA 4F3SA 5DW8A 1MQDA 2G29A 1ATGA 4ISUA 4F18A 1O7TA 4OVRA 4MF3A 2XHDA 2I58A 4PFWA 4OETA 3W15C 5F7VA 1MQGA 2O1LA 4OVSA 1A55A 4X04A 4R73A 1NFTA 1H43A 4O7IA 2XWOA 3LC8A 4GIZA 1MH3A 3PMWA 5CC2A 3G3KA 2IA4A 3PPRA 2FA7A 4H46A 1MXVA 5CMKA 4OVQA 1P99A 1IXIA 1B32A 2DSFA 1Q35A 1ZBMA 3OENA 4OA4A 2O6AA 3E13X 4PBHA 3RPWA 3KC1A 4MAGA 4PTKA 2DXRA 4BDOA 3U65A 1GR2A 1B5JA 5I2KB 4HE0A 1Z7NE 4ZZEA 4OFJA 4OZ9A 4U1ZA 1A8EA 2I3VA 3MQ9A 3E9XA 4H5GA 4R2FA 1K9ZA 2F3BA 2XD3A 5AA4B 1MH4A 1ZJLA 1UTBA 4I3EA 1B52A 1BP5A 1FCKA 4NF4A 2UVHA 4N6DA 4U4XA 1R9QA 2VD2A 1LCTA 3BKIB 3U92A 4N4UA 4RJZA 3B8BA 2V84A 4HW8A 4YAHX 3DM0A 4XKRA 4PAKA 4NN3A 4RPOA 4N6KA 4PFTA 3S9NC 1EH3A 2GH9A 1EZOA 5H8HA 4WEPA 5BUUA 4ZEDA 2F35A 3V83A 3SERA 3PD9A 4U21A 4NF8B 4EQ9A 3TODA 4OWDA 2REGA 3QAXA 2Q8JA 4YU0A 5I3SA 3FV2A 3VVDA 3CFZA 1IUDA 4G68C 3KJTA 1YYZA 4FE8A 1FRPA 1FSAA 2YPNA 5KZTA 5A5LA 3F11A 2WEFA 2PBWA 1ZU0A 1TXFA 4LQ5A 1QULA 1NV0A 4I9DA 3RY3A 1YTVA 1DMBA 3K1PA 3SKPA 3IB2A 2CZLA 5ELVA 5IAIA 1FPIA 4JSDA 2RINA 1D3KA 4YB7A 4R6YA 3KN8A 3TCGA 1JETA 3QYTA 3IFCA 4HTGA 5H8NA 3Q29A 3EHTA 4GL0A 3FZVA 4DI4B 2F7BA 1S7YA 1PB7A 4OEUA 3MJNA 1POY1 4N8GA 1MDQA 5A5XA 4PFUA 2FBPA 4H1XA 3ZKLA 2NVUB 1YZ0A 3FATA 1FTAA 4GD5A 4HS7A 1VFDA 4Z0IA 4O7MA 4NGUA 3O6HA 3BFTA 2D3IA 5EQAA 3C32A 3IORA 4R74A 2DP8A 2OZZA 1GV8A 2VGQA 4N91A 1NL5A 1QUKA 3B6TA 5J1DA 5TU0A 4OFOA 1FBGA 5I59B 1RKMA 1M5BA 3MC2A 4FAJA 4O3CA 4PDDA 4RK9A 3W9VA 4F22A 1FQBA 4TQUQ 1CNQA 1DK4A 2CZKA 2THIA 1UQWA 2IEEA 1P1UA 4N8YA 3IB0A 3KN3A 4FATA 1LAXA 1MQJA 3VLVA 1LLSA 1LGBC 5L8DA 2PX1A 1B3EA 3HPIA 1DBZA 1QVSA 2QS2A 3TYHA 3T9XB 3TEPA 1EYJA 1QUJA 3O29A 5AE4A 1SQYA 4R2BA 3WAEA 3MP8A 1JW5A 3PMXA 3RLFE 3EN3A 5HPQA 4NF5B 5IGAA 4GWXA 4PETA 3KEIA 3Q27A 5H8QA 2Z8EA 2F3DA 2ONKE 4GWUA 4Z7EA 2V93A 2BJIA 3HCQA 1MY0A 1P1WA 4N6PA 4NF8A 3OELA 3DP4A 3LSFB 3HFUA 2OCUA 5F1QA 4U2RA 3VXBA 5CM6A 1MPBA 3EQ1A 1LB9A 2QL3A 3GYYA 4O3AA 3ODBA 4F1VA 3FVNA 1LFIA 2XXYA 3W9WA 1B3GA 2CZIA 4GWSA 2Q74A 1WVJA 2F97A 3IOTA 4F2QA 4YKPA 1FBFA 5DVIA 5CBSA 5CMBA 3M3KA 3LV0A 2ZXTA 3QUJA 1VE4A 1B40A 3KSXA 1S50A 2XXQA 3FJ7A 1USYH 5LDZA 4KHZE 4PFBA 4GWWA 3EKIA 1N84A 4KFQA 5AA1A 5ISUA 1FTJA 3MZ9A 3O2AA 3DELB 1LFHA 3SEUA 5I56B 1BLFA 3TAJA 2F6PA 2HPGA 2HHMA 2OX3A 5EQ7A 1FBHA 4JB7A 4QFPA 1GVCA 4K3FA 5LOMA 1NNFA 3SESA 3IR1A 3THIA 3MVZA 4KYDA 2DVZA 2QS1A 2HQ0A 1JQFA 1NV1A 3CHGA 3GBAA 4G4PA 4X1BA 4GX6A 4NF6B 4ZZAA 3SEXA 2HZKA 4AS4A 2E0SA 1T0KA 2H25A 3H6UA 2RC9A 5FHOA 5H8SA 4IB2A 3HHGA 4OESA 1A99A 3KFMA 1FPDA 2ZZXA 4GXAA 3PPPA 3VLUA 2OK2A 4MCOA 3CSGA 5CRYA 1FPLA 4XEQA 1YPNA 4F3GA 1EYKA 1US4A 2HCAA 3C31A 4XXUA 2I48A 4OXVA 4ELQA 3KC0A 4Q5TA 2Z23A 3RT8A 4ELRA 4GL8A 2HFBA 3IJXB 2P3VA 1I6BA 3G3FA 3RTFB 3ZSFA 1BTJA 3GXAA 4GWYA 3SEVA 1L5TA 3H7MA 2QFLA 2Y7RA 3C35A 4H8IA 2AYSA 3K02A 4KD5A 5JEIA 3PUVE 4BDMA 1SI1A 2XXWA 2WYKA 3FASA 2G93A 4JVCA 1AWBA 3Q28A 4PF6A 3MZBA 2F36A 3H6TA 3OXNA 5ITOA 3A29A 3E78A 3SEYA 3MSTA 4IR8A 1MM6A 3DP8A 4NF5A 3O28A 2HAUA 4N15A 2FIXA 1I69A 3OOAA 3ROJA 3C4MA 4GVOA 5CMCA 1NUWA 3A3CA 4O3BA 5IZ3B 4E0WA 1XVXA 5FBPA 2R71A 1P1QA 3KOSA 3MP6A 3LBSA 1AH5A 2P3NA 3I3VA 1DPEA 2PMSA 3BIGA 1UTHB 4OERA 1QUIA 1MY2A 4C0RA 4PGNA 3BFUA 5CBRA 4ONYA 5DVJA 3IAZA 3K0VA 3IX1A 4F2OA 2WYPA 1B46A 4POWA 1OMPA 2DE3A 4OENA 1RDXA 3TCHA 4P0GA 2HZLA 5I56A 2XA5A 1FTOA 4JSOA 2D21A 1NUZA 2I4BA 2R9JA 4ZECA 3SDFA 4YZZA 4LP2B 1OVBA 3Q26A 1B0HA 3FD3A 1N7WA 2XX9A 4EQ7A 1NUYA 2F5XA 3HO7A 4IO3A 4MHFA 2QPQA 4PGPA 1B7UA 1SBPA 3KZGA 1N3XA 2RC8A 3LUYA 3PMVA 4IO6A 3VFJA 3RQTA 1NV3A 4C1UA 3RPLB 1G0HA 2XWKA 3CG1A 4QXDA 4WEDA 4LN5A 3JYRA 1NKXA 2OWZA 2XXKA 3QSLA 4HCWA 3K00A 3TKDA 4UA8A 3E79A 3IO6A 3I6VA 1JW4A 4WKMA 2I49A 1B1XA 4DXUA 1MPDA 2ZNUA 4PQJA 3SZPA 2VPNA 1B1HA 4JDFA 4YB5A 4RPNA 4U4SA 2Y5LA 1B4ZA 2MKZA 3N26A 4LZ7A 3MVYA 1YAEA 4O8MA 3MW0A 4QHQA 1MDP1 1ANFA 3S9MC 5K2YA 4P9KA 5HBCA 3CVGA 1OQHA 4YB6A 1SW4A 3M8UA 2R6GE 1MXYA 3DP6A 4PDHA 2X7QA 4TLLB 3CRBA 5ET5A 1TWYA 3AXFA 1URDA 2QVRA 4I62A 1HSEA 1NNKA 2FNCA 4QFNA 4R9FA 3V8XB 2VPOA 3VV5A 1LBXA 3G3JA 4FIMA 4JWYA 1Z7ME 2YLNA 2CEXA 1KA1A 2YJPA 1Y3QA 4MLVA 4UABA 5EYGA 5I2NA 1KA0A 1D9VA 2Y7WA 5EHSA 2UVIA 3RYDA 3N6UA 1S9TA 1TFAA 1VR5A 5IZ3A 3K6XA 2UVJA 4H45A 1AMFA 1POTA 4THIA 1B3LA 3C34A 2QMXA 3PTYA 1A8FA 4BLAA 4Q8RA 1DOTA 3B50A 4G68A 2ONRA 4H5FA 5L9OA 2XXRA 4NX1A 1NV7A 2ABHA 2DWAA 4AQ4A 4U22A 2XXUA 3KG2A 4G8NA 4IY6A 2ZZWA 2RC7A 3U93A 5ET8A 1IITA 1HSLA 5TP9A 4FEBA 4IGTA 2AL5A 4G2ZA 4XKPA 4DCYA 5B70A 1YXIA 1PB8A 1FQFA 4KCCA 1MPCA 1EZPA 1HSJA 5ITPA 2XXTA 2D5WA 1OIBA 1IIWA 4L17A 4E0XA 2F7CA 1D4NA 1US5A 3TQLA 4OYVA 1NV2A 1CB6A 4PC9A 2QJEA 1M5EA 4XKQA 1G0IA 3ONMA 4RK2A 2M8CA 3KBRA 3WAFA 4GWZA 1LEVA 5JTYB 4U1OA 4JVIA 3T9UA 1ZMGA 2DE4A 2L5VA 5I7IA 3RGYA 1Y1ZA 1D9YA 2QS4A 5ET7A 4X8RA 4PFIA 1Y3PA 4LONB 2B65A 2REJA 5I2KA 1ELJA 3TDJA 3M3LA 3T0JA 4EQBA 2UYFA 2Q2CA 3S9LC 4LUBA 4X9TA 1H45A 4X1DA 5AA4A 4PF8A 2A5SA 1FTMA 3O97A 3K1MA 2VD3A 3G7WA 3D1RA 4NHBA 5FHNA 3MPLA 5KCJB 3LR1A 3UGWA 4KYSA 3FXBA 4ZDMA 2E1SA 1B5HA 4OVPA 2JJKA 4PE3A 4G61A 3G3IA 3TTLA 4MEVA 3VLWA 4QF9A 1N76A 3QIMA 3MBPA 4ELOA 3PGFA 3CG3A 4R6KA 4JBZA 1QGXA 1Y3NA 2PT1A 3T22A 2XWVA 1OVTA 1LCFA 3FUZA 4NAPA 3TUSA 4R75A 3OO7A 1LAHE 4HE1A 2VHAA 4QRZA 2KLFA 4P1EA 4PAFA 1LBYA 3L6HA 2DWHA 1MQIA 1DPPA 1LBWA 4O94A 4F31B 2NWJA 2DQVA 4XIGQ 1BK4A 3N6TA 1F9BA 3O6IA 3H06B 2B3FA 4P1LA 1FBPA 2GHAA 5I5PA 1JEVA 2I0BA 1O63A 2F7AA 5ICQA 4MX6A 2ALUA 3FJGA 4YMBA 5AA2D 5ICTA 3K6UA 1VFEA 1PBQA 1JVXA 2H99A 1MS7A 4PCDA 4ZEIA 3C36A 1DCUA 1UIVA 3JV9A 4MH5A 4GX3A 1XT8A 3ZS6A 4BDQA 4H67A 1H44A 2B4MA
chains in the Genus database with same CATH topology
1EYIA 4N6KA 1NI9A 2FVZA 5IZZA 2B4LA 4PGNA 4OVTA 2WYPA 1IMCA 4N81A 5I3SA 2DE3A 1RDXA 1YYZA 1FRPA 2HZLA 1INPA 1FSAA 2XA5A 1LBZA 2WX9A 5A5LA 2WEFA 1NUZA 5EYHA 1NV0A 4YZZA 1NV6A 3MYUA 4PBQA 5ESYA 4HCYA 2DE2A 1IMAA 4MMPA 2Q8MA 1FPIA 1IMBA 1NUYA 1FBDA 1FPBA 1FPKA 2F5XA 3IFCA 4MHFA 2QPQA 4PGPA 4DI4B 4OANA 4QBAA 1KZ8A 1NV3A 4N8GA 3RPLB 1G0HA 2XWKA 4QXDA 2FBPA 3KBZA 4LN5A 2OWZA 2XXKA 4HCWA 1YZ0A 2Y5KA 5IZ1A 3E79A 4MIJA 4MNPA 1FTAA 4GBWA 4MNIA 1K9YA 4O7MA 3SZPA 2VPNA 4NGUA 4I3YA 2V4CA 2Y5LA 1FPEA 5EQAA 2MKZA 4F19A 4P56A 4F1UA 2CZHA 4O8MA 4KXPA 1D9QA 1Q9DA 4N91A 1VDWA 4P9KA 5J1DA 1FBGA 4PDHA 1NV4A 2Q9TA 4NG7A 4PDDA 4P3LA 5ET5A 3W9VA 2QVRA 5JK4A 1CNQA 1DK4A 2CZKA 4PAIA 4P8BA 2VPOA 2FIEA 1LBXA 4N8YA 2CEXA 1KA1A 3BIHA 5EQ9A 4UABA 5EYGA 1KA0A 4JVDA 2QVVA 1DBZA 3RYDA 2WBDA 1LBVA 1EYJA 3IFAA 5IZ3A 4AS5A 4H45A 1FBEA 3PTYA 5IGAA 4GWXA 4PETA 2F3DA 3B50A 4GWUA 2KR0A 2BJIA 4NX1A 1NV7A 3NOHA 4PFRA 3HFUA 2HXRA 2PFZA 2ZZWA 5ET8A 5CM6A 4HXVA 2V3QA 3GYYA 1FBCA 1IMFA 3QMFA 4F1VA 2WBBA 3W9WA 2CZIA 4GWSA 2Q74A 2PFYA 1YXIA 1FBFA 4GX4A 1FPFA 3LV0A 5F24A 2QVUA 1NV2A 4PC9A 1G0IA 2PCRA 5LDZA 4PFBA 4GWWA 3EKIA 4M1VA 4GWZA 1LEVA 1XI6A 4JVIA 2R8TA 2DE4A 2L5VA 2VT5A 5I7IA 1FJ6A 2HPGA 1IMEA 4DI3D 5ET7A 4X8RA 2HHMA 4NQ8A 2OX3A 5EQ7A 4PFIA 1FBHA 1FPGA 1FPJA 1IMDA 5J16A 1FJ9A 3T0JA 2DVZA 3CHGA 1NV1A 4GX6A 4XFEA 1SPIA 2HZKA 4AS4A 4X9TA 3T1BA 4PF8A 4I40A 2FHYA 4MJOA 2GQ1A 4N17A 3D1RA 4NHBA 5LTCA 5DW8A 1FPDA 2ZZXA 4F18A 1RDZA 4OVRA 3FXBA 4HE2A 4MCOA 4OVPA 1FPLA 2JJKA 4PE3A 4XEQA 4G61A 4MEVA 1EYKA 1NUXA 2ZZVA 4OVSA 2CEYA 3ISPA 4X04A 3KC0A 4FBPA 4GBVA 4O7IA 5EQ8A 2XWOA 4MNCA 5IM2A 1QGXA 4H46A 2XWVA 4OVQA 4NAPA 3LUZA 4NF0A 2P3VA 4HE1A 4GWYA 4OA4A 2QFLA 4PBHA 4P1EA 4PAFA 1LBYA 3KC1A 4MAGA 1LBWA 4PTKA 4P47A 4O94A 1BK4A 2DDKA 3U65A 3FBPA 2WYKA 4JVCA 1AWBA 4P1LA 1FBPA 4HE0A 4PF6A 5I5PA 5ET6A 3A29A 3E78A 3MSTA 4IR8A 4MX6A 5T3JA 4N15A 1K9ZA 2F3BA 2FIXA 1JP4A 3ROJA 2XWIA 1NUWA 2KQZA 1NV5A 4I3EA 5IZ3B 1RDYA 4PCDA 5FBPA 1DCUA 4XF5A 3RPLA 4N6DA 4GX3A 2P3NA 4YICA 4N4UA 3B8BA 4PAKA 3BIGA 2B4MA 4NN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQA A;  1EYI A;  4HE2 A;  5ET8 A;  4HXV A;  1FPL A;  2JJK A;  1NI9 A;  4G61 A;  2FVZ A;  1FBC A;  1IMF A;  1EYK A;  2CZH A;  1NUX A;  3QMF A;  4KXP A;  1D9Q A;  1Q9D A;  2WBB A;  2CZI A;  4GWS A;  2Q74 A;  1VDW A;  1YXI A;  3KC0 A;  1FBF A;  4FBP A;  4GBV A;  4GX4 A;  4O7I A;  5EQ8 A;  1FPF A;  3LV0 A;  1FBG A;  5F24 A;  1NV4 A;  1IMC A;  2QVU A;  1QGX A;  4H46 A;  4N81 A;  1NV2 A;  5I3S A;  1G0I A;  1RDX A;  2PCR A;  3LUZ A;  5ET5 A;  1YYZ A;  5LDZ A;  2P3V A;  1FRP A;  2QVR A;  4GWW A;  1INP A;  1FSA A;  4HE1 A;  1LBZ A;  1CNQ A;  1DK4 A;  2CZK A;  4GWY A;  2QFL A;  5A5L A;  2WEF A;  1LEV A;  2FIE A;  4GWZ A;  1LBX A;  1NUZ A;  1LBY A;  1XI6 A;  3KC1 A;  5EYH A;  2R8T A;  1LBW A;  4PTK A;  1KA1 A;  3BIH A;  1NV0 A;  5EQ9 A;  1NV6 A;  5EYG A;  2VT5 A;  5ESY A;  1FJ6 A;  1IMA A;  1BK4 A;  2DDK A;  3FBP A;  1IME A;  1KA0 A;  5ET7 A;  1AWB A;  1FBP A;  4HE0 A;  2Q8M A;  1FPI A;  2HHM A;  2OX3 A;  1IMB A;  2QVV A;  1DBZ A;  1NUY A;  5EQ7 A;  1FBD A;  1FBH A;  1FPB A;  1FPG A;  5ET6 A;  3RYD A;  1FPK A;  3IFC A;  1FPJ A;  3A29 A;  2WBD A;  1IMD A;  1LBV A;  5J16 A;  1EYJ A;  3IFA A;  4IR8 A;  1FJ9 A;  5IZ3 A;  4AS5 A;  4H45 A;  5T3J A;  1K9Z A;  2F3B A;  3T0J A;  1KZ8 A;  2FIX A;  1JP4 A;  1NV3 A;  1FBE A;  3ROJ A;  3RPL B;  1G0H A;  1NV1 A;  4QXD A;  2FBP A;  1NUW A;  3KBZ A;  4GX6 A;  1NV5 A;  4I3E A;  5IZ3 B;  1SPI A;  4GWX A;  1RDY A;  4AS4 A;  2OWZ A;  1YZ0 A;  2Y5K A;  5IZ1 A;  5FBP A;  2F3D A;  1DCU A;  4I40 A;  2FHY A;  1FTA A;  4GWU A;  4GBW A;  4MJO A;  3RPL A;  2GQ1 A;  4GX3 A;  2BJI A;  2P3N A;  1K9Y A;  3D1R A;  1NV7 A;  3B8B A;  4I3Y A;  5DW8 A;  3BIG A;  1FPD A;  2Y5L A;  1RDZ A;  1FPE A; 
#chains in the Genus database with same CATH topology
 1EYI A;  4DLD A;  4DCX A;  1NI9 A;  3A09 A;  1MM7 A;  1Y1M A;  2Q88 A;  3T66 A;  1B58 A;  1Y9U A;  4OVT A;  2UXA A;  3H6W A;  4OVJ A;  4OEV A;  4IO7 A;  3K6V A;  4N81 A;  4UAC A;  3N5L A;  3ILU B;  1I6Q A;  3O9P A;  1INP A;  2Z8D A;  5I59 A;  2OWS A;  1LBZ A;  3TTR A;  5I57 B;  4OTE A;  3TTM A;  2ZNT A;  2BJJ X;  3TPA A;  3QXM A;  1CE2 A;  1NV6 A;  3N94 A;  4RNS A;  4PBQ A;  1PB9 A;  5ESY A;  4HCY A;  2DE2 A;  1IMA A;  1H3D A;  1FQD A;  3R6U A;  3PPQ A;  4ZS9 A;  1FTK A;  3S9E A;  1FBD A;  1FPB A;  1FPK A;  5BWJ A;  3S4U A;  2F78 A;  1VSO A;  4QSC A;  3GBB A;  4DZ1 A;  4OAN A;  1OQG A;  4NF4 B;  3T9V A;  2RCB A;  1P1O A;  3KBZ A;  4GOT A;  3TZA A;  4G8H A;  2Y5K A;  5KCJ A;  5IZ1 A;  5H8F B;  4MNP A;  3K1N A;  1XS5 A;  3O66 A;  2ZYK A;  4LZ8 A;  2F6G A;  1K9Y A;  5H8H B;  2V4C A;  1IZ1 A;  1QKA A;  3Q25 A;  2XXH A;  4MFI A;  3OEM A;  1M5D A;  2I3W A;  3O6G A;  1DTZ A;  3T9H B;  2AL4 A;  4KXP A;  3T93 B;  1Q9D A;  1LBC A;  2ZYO A;  1VDW A;  4C1T A;  3MWB A;  3IOU A;  4H6D A;  2DVC A;  4KQP A;  1B4H A;  1GTK A;  2FYI A;  2O84 X;  3EHU A;  1NV4 A;  4GWO A;  2O1M A;  2Q9T A;  2B3B A;  1ZIU A;  3TFL A;  4Q0C A;  4GXS B;  4P3L A;  1TFD A;  4Q30 B;  2ONS A;  1SW2 A;  1JNF A;  3MVX A;  2ZMB A;  1B5I A;  4PAI A;  4POX A;  3U1O A;  2FIE A;  1BIY A;  5I84 A;  2H9B A;  2DWJ A;  3SET A;  3DLN A;  4IY5 A;  1SYH A;  1KWH A;  3BIH A;  4NE4 A;  3RUM A;  1JW1 A;  3OO9 A;  2NXO A;  4JVD A;  1II5 A;  1JVY A;  1B7Z A;  2QVV A;  4QSD A;  5KDT B;  2DXY A;  2WBD A;  1LBV A;  5A5X B;  2ANJ A;  4WXJ A;  1IXC A;  4FED A;  3IFA A;  2PVU A;  3HST A;  3JZJ A;  2ZYN A;  3CI8 A;  1NNT A;  3KJ7 A;  1IXG A;  3RT6 B;  3TTK A;  1SDX A;  3USD A;  5FHM A;  3U72 A;  1H76 A;  4RA1 A;  3CFL A;  3IL1 B;  4NF6 A;  4PFR A;  1IQ7 A;  3K01 A;  2HXR A;  2PFZ A;  1M5F A;  4EXK A;  2V3Q A;  2OPE A;  1FQA A;  1RYO A;  3K6W A;  3QMF A;  2DWI A;  4GRK A;  4ZE8 A;  2PFY A;  3FXR A;  3KGC A;  4GX4 A;  1URG A;  5AA3 A;  1FPF A;  1MXU A;  1N0T A;  1ZLQ A;  5F24 A;  5I57 A;  3PU5 A;  2QVU A;  2V3U A;  5EYF A;  2P1S A;  3QUF A;  1SI0 A;  2PCR A;  1XC1 A;  2OWT A;  2OPD A;  3IJO B;  4X48 A;  4M1V A;  4MLQ A;  1B0L A;  2O68 A;  1XI6 A;  2UYE A;  1AIV A;  5FTH A;  1LAG E;  1B9J A;  4BDR A;  4QSE A;  2V25 A;  2O7U A;  3VE1 B;  5DEX B;  3K4U A;  2VT5 A;  1P1N A;  1R9L A;  1IME A;  2XXV A;  1Y4T A;  5EHM A;  4ZEK A;  4DI3 D;  1EU8 A;  3CIJ A;  3FGS A;  3UP9 A;  3ILT B;  4GLI A;  4LVQ A;  4GQO A;  1IMD A;  3IB1 A;  3CSB A;  4AB6 A;  1FJ9 A;  4ELP A;  1ZTY A;  2Z8F A;  4YMA A;  4YKK A;  5H8Q B;  5H8F A;  2O51 A;  2A5T B;  5CMM A;  3OO6 A;  4XFE A;  2Y7I A;  4KPT A;  1J1N A;  4PP0 A;  4OQO A;  3T1B A;  2X7P A;  3MPK A;  2FHY A;  1XVY A;  1DSN A;  2I6E A;  1WOD A;  4N17 A;  2RF1 A;  5LTC A;  4DXB A;  1B7H A;  1URS A;  1RDZ A;  1NH8 A;  4HE2 A;  4RXL A;  3EF7 A;  1NUX A;  2H98 A;  4OMB A;  3VVE A;  2ZZV A;  2GHB A;  1UTH A;  2XX8 A;  3K2D A;  2CEY A;  3ISP A;  3IK6 B;  4FBP A;  4GBV A;  4NED A;  5EQ8 A;  4MNC A;  5IM2 A;  2QSX A;  4YKJ A;  2Y7P A;  3TQW A;  2RKM A;  4EUO A;  3MUQ A;  4G8M A;  3LUZ A;  4NF0 A;  1XHY A;  1Y20 A;  3VDF A;  4F1Y A;  3UA8 A;  4PE5 B;  5IKB A;  3UIF A;  4ESX A;  3QK6 A;  4FEC A;  1AOV A;  3KN7 A;  4IO4 A;  4P47 A;  5KDT A;  3PPN A;  4P0I A;  2DDK A;  3FBP A;  2Z22 A;  1YCJ A;  2VOZ A;  1GGG A;  1B3F A;  4EDP A;  3KSJ A;  1DTG A;  1B51 A;  4PFY A;  1N3W A;  3MZ1 A;  5ET6 A;  1I6A A;  2P0S A;  3R26 A;  4NMY A;  1IEJ A;  5L9M A;  2F34 A;  3MP1 A;  2I4C A;  3LSW A;  3D4G A;  4N07 A;  4F29 A;  3C33 A;  5T3J A;  4NWC A;  2WKY A;  3PUZ E;  2ZNS A;  1JP4 A;  4ZEB A;  4IO5 A;  2XWI A;  2KQZ A;  1NV5 A;  3G3G A;  4EF2 A;  3FXQ A;  1RDY A;  1NNP A;  3PD8 A;  4XF5 A;  3OMB A;  3RPL A;  1B2H A;  4YIC A;  4MBP A;  1MXZ A;  4OHN A;  3FXU A;  3OSR A;  3PUX E;  1N7X A;  2FVZ A;  1N04 A;  3D4C A;  5IZZ A;  2B4L A;  3FIR A;  2DYX A;  1BKA A;  1MY1 A;  4BDL A;  4IGR A;  2ZYM A;  4ND9 A;  1IMC A;  2F8D A;  1FW0 A;  5AA2 B;  1XOC A;  2QS3 A;  2Q89 A;  4DDD A;  1PEB A;  1LFG A;  1B3H A;  3C9H A;  5HM4 B;  5DEX A;  5FTI A;  1R6Z A;  3U8Q A;  2WX9 A;  4RY1 A;  3PUW E;  3UK4 A;  2HEU A;  4YKI A;  5EYH A;  4LZ5 A;  3MYU A;  2O69 A;  4FJP A;  4MMP A;  1OLA A;  4AB5 A;  3R7X A;  2DOJ A;  1NMU A;  2Q8M A;  1FQC A;  1IMB A;  3PV0 E;  1UIU A;  5DYH A;  3HN0 A;  2A5T A;  1SW1 A;  4QFO A;  1A54 A;  3PPO A;  3T96 B;  1QW0 A;  3V5A A;  1SYI A;  2RCA A;  4QBA A;  3S2V A;  4LAT A;  1KZ8 A;  3IOW A;  2OLB A;  2XXI A;  3TMG A;  3TCF A;  1TT1 A;  3BBR A;  3B7D A;  3RNN A;  1MXX A;  2HAV A;  4ECF A;  4MIJ A;  4GBW A;  2P2A A;  4RYA A;  1USY E;  5I58 B;  3GZG A;  4MNI A;  4F3P A;  4XTC Q;  1PDA A;  3OSQ A;  4I3Y A;  1NH7 A;  3OO8 A;  2XXX A;  4ZEF A;  3MVW A;  4BDN A;  1FPE A;  2XD2 A;  4F19 A;  3IOV A;  4NTL A;  1FTL A;  3U94 A;  1ZKB A;  4P56 A;  4F1U A;  3M3F A;  2CZH A;  5TPA B;  3H4Z A;  3VXC A;  1D9Q A;  3CR9 A;  2XXP A;  4R9G A;  3FVO A;  4R6H A;  2OJT A;  4F39 A;  4H0W A;  2XX7 A;  1MQH A;  3IO4 A;  3KOT A;  4NG7 A;  2H5Y A;  1OLC A;  1Q1K A;  2AIX A;  1M5C A;  5B7D A;  1MY4 A;  5JK4 A;  4KCD A;  2OBG A;  4KI0 E;  3OEK A;  4P8B A;  4LQ2 A;  1LB8 A;  2ESN A;  2GRV A;  4KR5 A;  3G3H A;  4IO2 A;  5EQ9 A;  4QFK A;  4ESW A;  5JTY A;  3H3G A;  5DT6 A;  2Q2A A;  4OFL A;  2NOO A;  3E3K A;  3RTW B;  1IXH A;  5M2V A;  2Y7K A;  3HHF A;  2PT2 A;  3SEW A;  4FOR A;  5L9S A;  4AS5 A;  1RYX A;  4I1D A;  1QKB A;  2UVG A;  2W7Y A;  1Y4C A;  1MXW A;  1FBE A;  4KYE A;  2NUV A;  4NWD A;  1SD3 A;  3L6G A;  4QFL A;  1MRP A;  1JEU A;  4EF1 A;  4DXC A;  3TTN A;  2KR0 A;  1UTB B;  3VVF A;  3NOH A;  4U23 A;  1EZ9 A;  2HXW A;  1R1N A;  1MG1 A;  3GLB A;  2QMW A;  4HXV A;  1LAF E;  2O7I A;  1FQE A;  1FBC A;  1IMF A;  5AA2 A;  2WBB A;  4GF8 A;  3FV1 A;  3RN8 A;  1A7L A;  4DE8 A;  2I0C A;  4EXL A;  5K2X A;  3TEL A;  5DTB A;  2CMO A;  1O64 A;  2X26 A;  4H8J A;  2QRY A;  4GFR A;  3ECR A;  3HV1 A;  3CFX A;  3MAM A;  2GFE A;  4ZE9 A;  3LSX A;  3H03 A;  2PYY A;  3FVK A;  3OD7 A;  5I2N B;  1A40 A;  3P7I A;  2DS9 A;  3FVG A;  1PBP A;  3ZKK A;  4F3B A;  2R8T A;  4R72 A;  5DVF A;  3FJM A;  4JWO A;  4XKN A;  5CI5 A;  1FJ6 A;  3E4R A;  4DIG A;  3B6W A;  3EPE A;  2V3T A;  3I5O A;  4JWX A;  3V89 B;  4H65 A;  4NQ8 A;  3EHS A;  4P11 A;  3PUY E;  1FPG A;  3B6Q A;  1FPJ A;  5J16 A;  1B6H A;  1MY3 A;  2Y84 A;  4TOZ A;  3UN6 A;  1LBB A;  4N13 A;  5I58 A;  1B05 A;  2H4I A;  4JXI A;  5H8N B;  4G68 B;  4I8C A;  3LSL A;  2VP1 A;  4M4G A;  1LST A;  4TLM B;  1SPI A;  1QJM A;  1WDN A;  4LA9 A;  1PC3 A;  1SVX B;  4I40 A;  4MJO A;  3A3U A;  3UOR A;  2GQ1 A;  3H6V A;  1AL3 A;  4G77 A;  5TP9 B;  1SW5 A;  5TPA A;  2LAO A;  4F3S A;  5DW8 A;  1MQD A;  2G29 A;  1ATG A;  4ISU A;  4F18 A;  1O7T A;  4OVR A;  4MF3 A;  2XHD A;  2I58 A;  4PFW A;  4OET A;  3W15 C;  5F7V A;  1MQG A;  2O1L A;  4OVS A;  1A55 A;  4X04 A;  4R73 A;  1NFT A;  1H43 A;  4O7I A;  2XWO A;  3LC8 A;  4GIZ A;  1MH3 A;  3PMW A;  5CC2 A;  3G3K A;  2IA4 A;  3PPR A;  2FA7 A;  4H46 A;  1MXV A;  5CMK A;  4OVQ A;  1P99 A;  1IXI A;  1B32 A;  2DSF A;  1Q35 A;  1ZBM A;  3OEN A;  4OA4 A;  2O6A A;  3E13 X;  4PBH A;  3RPW A;  3KC1 A;  4MAG A;  4PTK A;  2DXR A;  4BDO A;  3U65 A;  1GR2 A;  1B5J A;  5I2K B;  4HE0 A;  1Z7N E;  4ZZE A;  4OFJ A;  4OZ9 A;  4U1Z A;  1A8E A;  2I3V A;  3MQ9 A;  3E9X A;  4H5G A;  4R2F A;  1K9Z A;  2F3B A;  2XD3 A;  5AA4 B;  1MH4 A;  1ZJL A;  1UTB A;  4I3E A;  1B52 A;  1BP5 A;  1FCK A;  4NF4 A;  2UVH A;  4N6D A;  4U4X A;  1R9Q A;  2VD2 A;  1LCT A;  3BKI B;  3U92 A;  4N4U A;  4RJZ A;  3B8B A;  2V84 A;  4HW8 A;  4YAH X;  3DM0 A;  4XKR A;  4PAK A;  4NN3 A;  4RPO A;  4N6K A;  4PFT A;  3S9N C;  1EH3 A;  2GH9 A;  1EZO A;  5H8H A;  4WEP A;  5BUU A;  4ZED A;  2F35 A;  3V83 A;  3SER A;  3PD9 A;  4U21 A;  4NF8 B;  4EQ9 A;  3TOD A;  4OWD A;  2REG A;  3QAX A;  2Q8J A;  4YU0 A;  5I3S A;  3FV2 A;  3VVD A;  3CFZ A;  1IUD A;  4G68 C;  3KJT A;  1YYZ A;  4FE8 A;  1FRP A;  1FSA A;  2YPN A;  5KZT A;  5A5L A;  3F11 A;  2WEF A;  2PBW A;  1ZU0 A;  1TXF A;  4LQ5 A;  1QUL A;  1NV0 A;  4I9D A;  3RY3 A;  1YTV A;  1DMB A;  3K1P A;  3SKP A;  3IB2 A;  2CZL A;  5ELV A;  5IAI A;  1FPI A;  4JSD A;  2RIN A;  1D3K A;  4YB7 A;  4R6Y A;  3KN8 A;  3TCG A;  1JET A;  3QYT A;  3IFC A;  4HTG A;  5H8N A;  3Q29 A;  3EHT A;  4GL0 A;  3FZV A;  4DI4 B;  2F7B A;  1S7Y A;  1PB7 A;  4OEU A;  3MJN A;  1POY 1;  4N8G A;  1MDQ A;  5A5X A;  4PFU A;  2FBP A;  4H1X A;  3ZKL A;  2NVU B;  1YZ0 A;  3FAT A;  1FTA A;  4GD5 A;  4HS7 A;  1VFD A;  4Z0I A;  4O7M A;  4NGU A;  3O6H A;  3BFT A;  2D3I A;  5EQA A;  3C32 A;  3IOR A;  4R74 A;  2DP8 A;  2OZZ A;  1GV8 A;  2VGQ A;  4N91 A;  1NL5 A;  1QUK A;  3B6T A;  5J1D A;  5TU0 A;  4OFO A;  1FBG A;  5I59 B;  1RKM A;  1M5B A;  3MC2 A;  4FAJ A;  4O3C A;  4PDD A;  4RK9 A;  3W9V A;  4F22 A;  1FQB A;  4TQU Q;  1CNQ A;  1DK4 A;  2CZK A;  2THI A;  1UQW A;  2IEE A;  1P1U A;  4N8Y A;  3IB0 A;  3KN3 A;  4FAT A;  1LAX A;  1MQJ A;  3VLV A;  1LLS A;  1LGB C;  5L8D A;  2PX1 A;  1B3E A;  3HPI A;  1DBZ A;  1QVS A;  2QS2 A;  3TYH A;  3T9X B;  3TEP A;  1EYJ A;  1QUJ A;  3O29 A;  5AE4 A;  1SQY A;  4R2B A;  3WAE A;  3MP8 A;  1JW5 A;  3PMX A;  3RLF E;  3EN3 A;  5HPQ A;  4NF5 B;  5IGA A;  4GWX A;  4PET A;  3KEI A;  3Q27 A;  5H8Q A;  2Z8E A;  2F3D A;  2ONK E;  4GWU A;  4Z7E A;  2V93 A;  2BJI A;  3HCQ A;  1MY0 A;  1P1W A;  4N6P A;  4NF8 A;  3OEL A;  3DP4 A;  3LSF B;  3HFU A;  2OCU A;  5F1Q A;  4U2R A;  3VXB A;  5CM6 A;  1MPB A;  3EQ1 A;  1LB9 A;  2QL3 A;  3GYY A;  4O3A A;  3ODB A;  4F1V A;  3FVN A;  1LFI A;  2XXY A;  3W9W A;  1B3G A;  2CZI A;  4GWS A;  2Q74 A;  1WVJ A;  2F97 A;  3IOT A;  4F2Q A;  4YKP A;  1FBF A;  5DVI A;  5CBS A;  5CMB A;  3M3K A;  3LV0 A;  2ZXT A;  3QUJ A;  1VE4 A;  1B40 A;  3KSX A;  1S50 A;  2XXQ A;  3FJ7 A;  1USY H;  5LDZ A;  4KHZ E;  4PFB A;  4GWW A;  3EKI A;  1N84 A;  4KFQ A;  5AA1 A;  5ISU A;  1FTJ A;  3MZ9 A;  3O2A A;  3DEL B;  1LFH A;  3SEU A;  5I56 B;  1BLF A;  3TAJ A;  2F6P A;  2HPG A;  2HHM A;  2OX3 A;  5EQ7 A;  1FBH A;  4JB7 A;  4QFP A;  1GVC A;  4K3F A;  5LOM A;  1NNF A;  3SES A;  3IR1 A;  3THI A;  3MVZ A;  4KYD A;  2DVZ A;  2QS1 A;  2HQ0 A;  1JQF A;  1NV1 A;  3CHG A;  3GBA A;  4G4P A;  4X1B A;  4GX6 A;  4NF6 B;  4ZZA A;  3SEX A;  2HZK A;  4AS4 A;  2E0S A;  1T0K A;  2H25 A;  3H6U A;  2RC9 A;  5FHO A;  5H8S A;  4IB2 A;  3HHG A;  4OES A;  1A99 A;  3KFM A;  1FPD A;  2ZZX A;  4GXA A;  3PPP A;  3VLU A;  2OK2 A;  4MCO A;  3CSG A;  5CRY A;  1FPL A;  4XEQ A;  1YPN A;  4F3G A;  1EYK A;  1US4 A;  2HCA A;  3C31 A;  4XXU A;  2I48 A;  4OXV A;  4ELQ A;  3KC0 A;  4Q5T A;  2Z23 A;  3RT8 A;  4ELR A;  4GL8 A;  2HFB A;  3IJX B;  2P3V A;  1I6B A;  3G3F A;  3RTF B;  3ZSF A;  1BTJ A;  3GXA A;  4GWY A;  3SEV A;  1L5T A;  3H7M A;  2QFL A;  2Y7R A;  3C35 A;  4H8I A;  2AYS A;  3K02 A;  4KD5 A;  5JEI A;  3PUV E;  4BDM A;  1SI1 A;  2XXW A;  2WYK A;  3FAS A;  2G93 A;  4JVC A;  1AWB A;  3Q28 A;  4PF6 A;  3MZB A;  2F36 A;  3H6T A;  3OXN A;  5ITO A;  3A29 A;  3E78 A;  3SEY A;  3MST A;  4IR8 A;  1MM6 A;  3DP8 A;  4NF5 A;  3O28 A;  2HAU A;  4N15 A;  2FIX A;  1I69 A;  3OOA A;  3ROJ A;  3C4M A;  4GVO A;  5CMC A;  1NUW A;  3A3C A;  4O3B A;  5IZ3 B;  4E0W A;  1XVX A;  5FBP A;  2R71 A;  1P1Q A;  3KOS A;  3MP6 A;  3LBS A;  1AH5 A;  2P3N A;  3I3V A;  1DPE A;  2PMS A;  3BIG A;  1UTH B;  4OER A;  1QUI A;  1MY2 A;  4C0R A;  4PGN A;  3BFU A;  5CBR A;  4ONY A;  5DVJ A;  3IAZ A;  3K0V A;  3IX1 A;  4F2O A;  2WYP A;  1B46 A;  4POW A;  1OMP A;  2DE3 A;  4OEN A;  1RDX A;  3TCH A;  4P0G A;  2HZL A;  5I56 A;  2XA5 A;  1FTO A;  4JSO A;  2D21 A;  1NUZ A;  2I4B A;  2R9J A;  4ZEC A;  3SDF A;  4YZZ A;  4LP2 B;  1OVB A;  3Q26 A;  1B0H A;  3FD3 A;  1N7W A;  2XX9 A;  4EQ7 A;  1NUY A;  2F5X A;  3HO7 A;  4IO3 A;  4MHF A;  2QPQ A;  4PGP A;  1B7U A;  1SBP A;  3KZG A;  1N3X A;  2RC8 A;  3LUY A;  3PMV A;  4IO6 A;  3VFJ A;  3RQT A;  1NV3 A;  4C1U A;  3RPL B;  1G0H A;  2XWK A;  3CG1 A;  4QXD A;  4WED A;  4LN5 A;  3JYR A;  1NKX A;  2OWZ A;  2XXK A;  3QSL A;  4HCW A;  3K00 A;  3TKD A;  4UA8 A;  3E79 A;  3IO6 A;  3I6V A;  1JW4 A;  4WKM A;  2I49 A;  1B1X A;  4DXU A;  1MPD A;  2ZNU A;  4PQJ A;  3SZP A;  2VPN A;  1B1H A;  4JDF A;  4YB5 A;  4RPN A;  4U4S A;  2Y5L A;  1B4Z A;  2MKZ A;  3N26 A;  4LZ7 A;  3MVY A;  1YAE A;  4O8M A;  3MW0 A;  4QHQ A;  1MDP 1;  1ANF A;  3S9M C;  5K2Y A;  4P9K A;  5HBC A;  3CVG A;  1OQH A;  4YB6 A;  1SW4 A;  3M8U A;  2R6G E;  1MXY A;  3DP6 A;  4PDH A;  2X7Q A;  4TLL B;  3CRB A;  5ET5 A;  1TWY A;  3AXF A;  1URD A;  2QVR A;  4I62 A;  1HSE A;  1NNK A;  2FNC A;  4QFN A;  4R9F A;  3V8X B;  2VPO A;  3VV5 A;  1LBX A;  3G3J A;  4FIM A;  4JWY A;  1Z7M E;  2YLN A;  2CEX A;  1KA1 A;  2YJP A;  1Y3Q A;  4MLV A;  4UAB A;  5EYG A;  5I2N A;  1KA0 A;  1D9V A;  2Y7W A;  5EHS A;  2UVI A;  3RYD A;  3N6U A;  1S9T A;  1TFA A;  1VR5 A;  5IZ3 A;  3K6X A;  2UVJ A;  4H45 A;  1AMF A;  1POT A;  4THI A;  1B3L A;  3C34 A;  2QMX A;  3PTY A;  1A8F A;  4BLA A;  4Q8R A;  1DOT A;  3B50 A;  4G68 A;  2ONR A;  4H5F A;  5L9O A;  2XXR A;  4NX1 A;  1NV7 A;  2ABH A;  2DWA A;  4AQ4 A;  4U22 A;  2XXU A;  3KG2 A;  4G8N A;  4IY6 A;  2ZZW A;  2RC7 A;  3U93 A;  5ET8 A;  1IIT A;  1HSL A;  5TP9 A;  4FEB A;  4IGT A;  2AL5 A;  4G2Z A;  4XKP A;  4DCY A;  5B70 A;  1YXI A;  1PB8 A;  1FQF A;  4KCC A;  1MPC A;  1EZP A;  1HSJ A;  5ITP A;  2XXT A;  2D5W A;  1OIB A;  1IIW A;  4L17 A;  4E0X A;  2F7C A;  1D4N A;  1US5 A;  3TQL A;  4OYV A;  1NV2 A;  1CB6 A;  4PC9 A;  2QJE A;  1M5E A;  4XKQ A;  1G0I A;  3ONM A;  4RK2 A;  2M8C A;  3KBR A;  3WAF A;  4GWZ A;  1LEV A;  5JTY B;  4U1O A;  4JVI A;  3T9U A;  1ZMG A;  2DE4 A;  2L5V A;  5I7I A;  3RGY A;  1Y1Z A;  1D9Y A;  2QS4 A;  5ET7 A;  4X8R A;  4PFI A;  1Y3P A;  4LON B;  2B65 A;  2REJ A;  5I2K A;  1ELJ A;  3TDJ A;  3M3L A;  3T0J A;  4EQB A;  2UYF A;  2Q2C A;  3S9L C;  4LUB A;  4X9T A;  1H45 A;  4X1D A;  5AA4 A;  4PF8 A;  2A5S A;  1FTM A;  3O97 A;  3K1M A;  2VD3 A;  3G7W A;  3D1R A;  4NHB A;  5FHN A;  3MPL A;  5KCJ B;  3LR1 A;  3UGW A;  4KYS A;  3FXB A;  4ZDM A;  2E1S A;  1B5H A;  4OVP A;  2JJK A;  4PE3 A;  4G61 A;  3G3I A;  3TTL A;  4MEV A;  3VLW A;  4QF9 A;  1N76 A;  3QIM A;  3MBP A;  4ELO A;  3PGF A;  3CG3 A;  4R6K A;  4JBZ A;  1QGX A;  1Y3N A;  2PT1 A;  3T22 A;  2XWV A;  1OVT A;  1LCF A;  3FUZ A;  4NAP A;  3TUS A;  4R75 A;  3OO7 A;  1LAH E;  4HE1 A;  2VHA A;  4QRZ A;  2KLF A;  4P1E A;  4PAF A;  1LBY A;  3L6H A;  2DWH A;  1MQI A;  1DPP A;  1LBW A;  4O94 A;  4F31 B;  2NWJ A;  2DQV A;  4XIG Q;  1BK4 A;  3N6T A;  1F9B A;  3O6I A;  3H06 B;  2B3F A;  4P1L A;  1FBP A;  2GHA A;  5I5P A;  1JEV A;  2I0B A;  1O63 A;  2F7A A;  5ICQ A;  4MX6 A;  2ALU A;  3FJG A;  4YMB A;  5AA2 D;  5ICT A;  3K6U A;  1VFE A;  1PBQ A;  1JVX A;  2H99 A;  1MS7 A;  4PCD A;  4ZEI A;  3C36 A;  1DCU A;  1UIV A;  3JV9 A;  4MH5 A;  4GX3 A;  1XT8 A;  3ZS6 A;  4BDQ A;  4H67 A;  1H44 A;  2B4M A; 
#chains in the Genus database with same CATH homology
 1EYI A;  4N6K A;  1NI9 A;  2FVZ A;  5IZZ A;  2B4L A;  4PGN A;  4OVT A;  2WYP A;  1IMC A;  4N81 A;  5I3S A;  2DE3 A;  1RDX A;  1YYZ A;  1FRP A;  2HZL A;  1INP A;  1FSA A;  2XA5 A;  1LBZ A;  2WX9 A;  5A5L A;  2WEF A;  1NUZ A;  5EYH A;  1NV0 A;  4YZZ A;  1NV6 A;  3MYU A;  4PBQ A;  5ESY A;  4HCY A;  2DE2 A;  1IMA A;  4MMP A;  2Q8M A;  1FPI A;  1IMB A;  1NUY A;  1FBD A;  1FPB A;  1FPK A;  2F5X A;  3IFC A;  4MHF A;  2QPQ A;  4PGP A;  4DI4 B;  4OAN A;  4QBA A;  1KZ8 A;  1NV3 A;  4N8G A;  3RPL B;  1G0H A;  2XWK A;  4QXD A;  2FBP A;  3KBZ A;  4LN5 A;  2OWZ A;  2XXK A;  4HCW A;  1YZ0 A;  2Y5K A;  5IZ1 A;  3E79 A;  4MIJ A;  4MNP A;  1FTA A;  4GBW A;  4MNI A;  1K9Y A;  4O7M A;  3SZP A;  2VPN A;  4NGU A;  4I3Y A;  2V4C A;  2Y5L A;  1FPE A;  5EQA A;  2MKZ A;  4F19 A;  4P56 A;  4F1U A;  2CZH A;  4O8M A;  4KXP A;  1D9Q A;  1Q9D A;  4N91 A;  1VDW A;  4P9K A;  5J1D A;  1FBG A;  4PDH A;  1NV4 A;  2Q9T A;  4NG7 A;  4PDD A;  4P3L A;  5ET5 A;  3W9V A;  2QVR A;  5JK4 A;  1CNQ A;  1DK4 A;  2CZK A;  4PAI A;  4P8B A;  2VPO A;  2FIE A;  1LBX A;  4N8Y A;  2CEX A;  1KA1 A;  3BIH A;  5EQ9 A;  4UAB A;  5EYG A;  1KA0 A;  4JVD A;  2QVV A;  1DBZ A;  3RYD A;  2WBD A;  1LBV A;  1EYJ A;  3IFA A;  5IZ3 A;  4AS5 A;  4H45 A;  1FBE A;  3PTY A;  5IGA A;  4GWX A;  4PET A;  2F3D A;  3B50 A;  4GWU A;  2KR0 A;  2BJI A;  4NX1 A;  1NV7 A;  3NOH A;  4PFR A;  3HFU A;  2HXR A;  2PFZ A;  2ZZW A;  5ET8 A;  5CM6 A;  4HXV A;  2V3Q A;  3GYY A;  1FBC A;  1IMF A;  3QMF A;  4F1V A;  2WBB A;  3W9W A;  2CZI A;  4GWS A;  2Q74 A;  2PFY A;  1YXI A;  1FBF A;  4GX4 A;  1FPF A;  3LV0 A;  5F24 A;  2QVU A;  1NV2 A;  4PC9 A;  1G0I A;  2PCR A;  5LDZ A;  4PFB A;  4GWW A;  3EKI A;  4M1V A;  4GWZ A;  1LEV A;  1XI6 A;  4JVI A;  2R8T A;  2DE4 A;  2L5V A;  2VT5 A;  5I7I A;  1FJ6 A;  2HPG A;  1IME A;  4DI3 D;  5ET7 A;  4X8R A;  2HHM A;  4NQ8 A;  2OX3 A;  5EQ7 A;  4PFI A;  1FBH A;  1FPG A;  1FPJ A;  1IMD A;  5J16 A;  1FJ9 A;  3T0J A;  2DVZ A;  3CHG A;  1NV1 A;  4GX6 A;  4XFE A;  1SPI A;  2HZK A;  4AS4 A;  4X9T A;  3T1B A;  4PF8 A;  4I40 A;  2FHY A;  4MJO A;  2GQ1 A;  4N17 A;  3D1R A;  4NHB A;  5LTC A;  5DW8 A;  1FPD A;  2ZZX A;  4F18 A;  1RDZ A;  4OVR A;  3FXB A;  4HE2 A;  4MCO A;  4OVP A;  1FPL A;  2JJK A;  4PE3 A;  4XEQ A;  4G61 A;  4MEV A;  1EYK A;  1NUX A;  2ZZV A;  4OVS A;  2CEY A;  3ISP A;  4X04 A;  3KC0 A;  4FBP A;  4GBV A;  4O7I A;  5EQ8 A;  2XWO A;  4MNC A;  5IM2 A;  1QGX A;  4H46 A;  2XWV A;  4OVQ A;  4NAP A;  3LUZ A;  4NF0 A;  2P3V A;  4HE1 A;  4GWY A;  4OA4 A;  2QFL A;  4PBH A;  4P1E A;  4PAF A;  1LBY A;  3KC1 A;  4MAG A;  1LBW A;  4PTK A;  4P47 A;  4O94 A;  1BK4 A;  2DDK A;  3U65 A;  3FBP A;  2WYK A;  4JVC A;  1AWB A;  4P1L A;  1FBP A;  4HE0 A;  4PF6 A;  5I5P A;  5ET6 A;  3A29 A;  3E78 A;  3MST A;  4IR8 A;  4MX6 A;  5T3J A;  4N15 A;  1K9Z A;  2F3B A;  2FIX A;  1JP4 A;  3ROJ A;  2XWI A;  1NUW A;  2KQZ A;  1NV5 A;  4I3E A;  5IZ3 B;  1RDY A;  4PCD A;  5FBP A;  1DCU A;  4XF5 A;  3RPL A;  4N6D A;  4GX3 A;  2P3N A;  4YIC A;  4N4U A;  3B8B A;  4PAK A;  3BIG A;  2B4M A;  4NN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...