1JP4A

Crystal structure of an enzyme displaying both inositol-polyphosphate 1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
302
Chain Sequence
HNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3'(2'),5'-bisphosphate nucleotidase
publication title Crystal structure of an enzyme displaying both inositol-polyphosphate-1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities: a novel target of lithium therapy.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 98
structure length 302
sequence length 304
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1jp4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1jp4A02
1SPIA 2CZKA 1EYJA 5ET6A 1LEVA 1IMAA 1BK4A 2OX3A 2P3VA 3QMFA 3LV0A 1FPJA 1NV5A 1K9YA 1NI9A 4GX4A 1G0IA 4PTKA 1NUYA 1CNQA 1FBEA 4GWWA 4GWYA 2VT5A 1VDWA 2F3BA 5J16A 1NV1A 5EQ9A 5ESYA 1YXIA 1FPFA 1EYIA 3ROJA 2WBDA 5DW8A 1NV3A 1IMEA 1INPA 3IFAA 1FPIA 1K9ZA 2FHYA 3KC1A 2CZIA 1NV7A 1FTAA 3KC0A 4H46A 1DK4A 2CZHA 1KA1A 1FPBA 1YZ0A 4HE1A 1D9QA 2DDKA 3T0JA 4G61A 5EQAA 5ET5A 1QGXA 1RDXA 2QFLA 4GWSA 2PCRA 4GWUA 1YYZA 2FVZA 1FRPA 2FIEA 1NV2A 1FJ6A 1FPDA 4AS4A 2JJKA 5ET7A 4FBPA 2GQ1A 2HHMA 4QXDA 2FIXA 1DBZA 5EQ8A 1FPKA 2WEFA 1FBCA 1NUWA 2OWZA 3BIHA 2Q8MA 1IMDA 1LBZA 4HE0A 3LUZA 5F24A 4AS5A 3FBPA 4I3YA 2QVRA 1FPEA 4O7IA 1NV4A 1FBDA 2P3NA 1FBFA 1Q9DA 2BJIA 1DCUA 1KA0A 4GWXA 4MJOA 5EQ7A 1KZ8A 1XI6A 4GX3A 2FBPA 1FBGA 2R8TA 5FBPA 1FBPA 2Y5LA 1FSAA 3D1RA 4GBWA 5ET8A 1IMBA 1LBWA 5LDZA 5EYGA 5IZ1A 2F3DA 3A29A 4I40A 4H45A 1LBYA 3KBZA 1RDYA 4GX6A 3RYDA 1NUXA 1G0HA 2Q74A 4HXVA 1LBVA 1IMFA 1FPGA 1EYKA 4IR8A 5IZ3A 3BIGA 5IZ3B 1FJ9A 1RDZA 5T3JA 1NV6A 4HE2A 3IFCA 4I3EA 1IMCA 2QVVA 4GWZA 4KXPA 4N81A 3RPLA 2QVUA 3RPLB 5EYHA 1FPLA 1NUZA 1LBXA 3B8BA 2WBBA 1AWBA 4GBVA 1JP4A 5A5LA 5I3SA 1FBHA 2Y5KA 1NV0A
chains in the Genus database with same CATH superfamily
4F39A 1DTZA 4LVQA 1MY0A 1N76A 2WX9A 3TZAA 1L5TA 4FAJA 1NI9A 1OQGA 2GRVA 2H4IA 4JB7A 4NF4B 4EF1A 5J16A 4UABA 4HCWA 4GL8A 3IAZA 5TPAA 2A5TB 3OO9A 1MY4A 2Z8EA 4IO4A 3K01A 1YAEA 5A5XA 5ET5A 5IKBA 3FVGA 4OVPA 2DE3A 2PCRA 2XXPA 1NV2A 2DYXA 2DXYA 2AYSA 5DEXB 4H8IA 2WKYA 1MY2A 2E1SA 1B5HA 4NF6A 3R7XA 1EZOA 3MP6A 1D9YA 1KA0A 4GWXA 5EQ7A 2XXVA 4XEQA 2DWAA 5I84A 2FBPA 3D4CA 1GVCA 5AA2A 5FBPA 2Y5LA 2L5VA 3FV1A 4Q8RA 1LBWA 4NG7A 3KBRA 4NF8B 4GX6A 1D3KA 4OHNA 3FASA 3MP8A 3B6QA 3CG1A 5J1DA 3KOSA 3O28A 4KXPA 3SDFA 2QVUA 2F97A 1PBPA 3K6WA 4QRZA 3RT6B 1LBXA 3VLUA 3EQ1A 3HN0A 1UQWA 3TCHA 5L9SA 4ZEBA 1SI1A 5TP9A 5B7DA 3O66A 1PC3A 3H06B 1S7YA 3FATA 4X8RA 2Y84A 1T0KA 5EQ9A 1HSJA 4H5GA 4DCXA 4PETA 1S50A 3SZPA 4RY1A 3C31A 5KZTA 2F8DA 2NUVA 2XX7A 4OA4A 3IX1A 5H8NB 2CEYA 3HHGA 4F31B 4F2OA 3I3VA 3KJTA 4EQ7A 4O94A 2FIEA 4JBZA 2Z8FA 2HPGA 1NH7A 2THIA 3H4ZA 2I58A 1FQAA 4HS7A 1R9LA 3K0VA 4ZS9A 3Q27A 4MMPA 1M5EA 2F35A 3TTKA 1FPEA 3SEYA 1QKBA 1N84A 4AB5A 4HW8A 4JVCA 3TYHA 5H8QB 4KCDA 1FSAA 1B7UA 1NL5A 1GGGA 1Z7ME 4I40A 3OO6A 1M5BA 3C34A 4LATA 1M5FA 1EYKA 2B65A 1RDZA 3RTWB 4MFIA 5I56B 2R6GE 2X7PA 3C9HA 2F7BA 2F6PA 2A5SA 1J1NA 2P3VA 1MM7A 5DVIA 2CZKA 3WAFA 4MCOA 1MXWA 4PF6A 3RQTA 3OO7A 4X04A 4ELRA 2V3QA 2HXRA 3SERA 4NF4A 3H03A 1ZTYA 2QSXA 3QXMA 3N6TA 3IL1B 3ECRA 4G77A 4H6DA 4MF3A 3V89B 1NV3A 2A5TA 1P1NA 1K9ZA 2OLBA 3MP1A 4R73A 2P1SA 3LSFB 2IEEA 3PPQA 3CI8A 2Q2AA 1NKXA 3OO8A 1QUKA 1RDXA 3KN8A 5I2NB 2DS9A 4RNSA 5DEXA 1MM6A 5BUUA 3O6HA 3GBAA 1NUWA 4XTCQ 1LBZA 4ZEIA 4AS5A 2HXWA 3MSTA 4DXCA 4PAFA 3LSXA 4G68B 2O7IA 3PUVE 4R2FA 4OWDA 2VPOA 1FTKA 4NF8A 4NEDA 4TQUQ 4EF2A 4IO5A 4HXVA 1LAXA 4OVJA 3Q26A 1JEUA 3A3CA 2QJEA 4HE2A 2Y7IA 4GWZA 5KDTB 1M5DA 4RPNA 1H44A 3CFXA 5HPQA 1N3XA 2RC9A 3KGCA 3MPKA 1AWBA 2VGQA 3ONMA 3A3UA 3E3KA 1P1WA 4JVDA 4PFUA 1BLFA 4DZ1A 3MUQA 1ZU0A 4U1OA 5EYFA 3QMFA 4LONB 2DWHA 3MZ9A 3QAXA 4RK2A 2VT5A 4QFOA 5KCJB 4KD5A 4OYVA 3PTYA 1MDQA 1BTJA 3SEXA 2XXRA 2O68A 4H0WA 1B0LA 2OPDA 1DK4A 3OENA 3MJNA 3MVXA 2WYKA 4Q0CA 4G2ZA 5H8NA 3RTFB 2XA5A 3OEMA 4PQJA 3PMVA 2UVJA 1FCKA 1IXCA 4C1TA 1OVTA 3PMXA 3EF7A 4FBPA 3O97A 2ESNA 3T9UA 2GFEA 3KZGA 1MQJA 4OQOA 4ZECA 3U72A 1IUDA 4IO2A 4IO6A 5FTHA 3TFLA 1B3FA 1KWHA 1VFDA 5H8QA 3N26A 2PMSA 3CFLA 1B9JA 2MKZA 1B52A 5F1QA 2E0SA 2V93A 3KN3A 2P2AA 3A29A 4FJPA 2GH9A 1RDYA 1MPDA 1LBVA 3P7IA 4PCDA 4I1DA 3T22A 2CEXA 3EKIA 1WVJA 3K1NA 5IZ3B 2UYEA 4OFOA 1UTBB 3IFCA 3FXRA 4PFBA 1IMCA 4EUOA 5I56A 4H8JA 3RPLB 5EYHA 1I69A 5DT6A 3B8BA 2B3FA 4H67A 3O29A 1TFAA 5ELVA 1B1HA 1MQHA 4RYAA 2VHAA 2GHBA 4PTKA 3KFMA 4DXUA 1CNQA 4F2QA 4X48A 4XKQA 4H1XA 4AB6A 1SD3A 1INPA 2I3WA 3IOUA 3IB0A 1Q1KA 3FV2A 2DVZA 4PF8A 5I57B 1WODA 4MNIA 4NF0A 5CBSA 5I2NA 4YICA 1DOTA 4F3GA 1B3EA 2HFBA 4I9DA 4Q30B 1O7TA 4I62A 5CMMA 2ZZVA 2GQ1A 4LZ8A 4P56A 4ZEKA 4BDNA 4NF5B 2D3IA 1IXHA 3VVEA 5L9OA 3C35A 3CFZA 4LN5A 3QK6A 3UP9A 1SW1A 1HSEA 1N04A 3FJGA 3H3GA 1A7LA 3A09A 4G68A 4R9FA 2ZNUA 1MXVA 5DTBA 4HCYA 4JVIA 4F3BA 2O69A 3TCGA 3D1RA 2ALUA 4ESXA 2LAOA 2ZNSA 4P47A 3R6UA 5M2VA 3ZKLA 4N15A 2DE2A 2NXOA 2QMXA 2DSFA 1LGBC 4GF8A 4DI4B 3PMWA 5ITOA 4C1UA 3K00A 5KDTA 3ZSFA 1FTOA 4N81A 4PBHA 4PP0A 4IGRA 4YZZA 3B6TA 4O3AA 3K6XA 4OVSA 2X7QA 1JQFA 1MRPA 1MXZA 1RYXA 3M8UA 3OELA 3TPAA 3S9EA 3U94A 2QS1A 2FYIA 4MLQA 3TKDA 3KSXA 5KCJA 1QUIA 4JWOA 3RGYA 1NNFA 3EN3A 2HAVA 1B32A 3KC1A 3FZVA 3C32A 5ICQA 4H46A 4Z7EA 1B40A 1ZBMA 1FPBA 2GHAA 3MAMA 2V3UA 5EQAA 3DP8A 1R1NA 3V83A 4HTGA 1MY1A 4GRKA 3LC8A 1FRPA 1Y4TA 2ANJA 4YKPA 3Q28A 4DE8A 3FVKA 2JJKA 2RC8A 1MQIA 4LP2B 3CSGA 3F11A 4R6KA 2DWJA 5AA2D 4DCYA 3IJXB 1XT8A 2XXHA 3IB1A 1XVXA 3MBPA 4I3YA 4X1BA 3MPLA 4QSDA 4PE3A 1FQDA 2VD3A 1M5CA 2OJTA 3C36A 1Y3NA 1JETA 2H25A 5IZ1A 4EQ9A 3RLFE 4OESA 1XC1A 4G68C 3Q29A 1G0HA 1LAGE 3K1MA 4EQBA 2AL4A 5IZ3A 3U1OA 3K4UA 1UTBA 4P8BA 4MNCA 1B05A 4ELPA 1RYOA 2HCAA 3RPLA 5K2XA 3CR9A 3S4UA 3H6UA 5CI5A 3OSRA 2Z22A 5FTIA 1FQFA 1LB9A 4N6DA 4FEDA 4R6YA 1Y9UA 5I59B 3TMGA 4GX4A 1MQGA 3KSJA 4F19A 4XFEA 1FPFA 4OVTA 3O2AA 2Y7KA 4BDMA 2XWVA 1SYHA 5EHSA 4OANA 5I57A 2CZHA 5H8SA 3JV9A 2G29A 2F5XA 3MC2A 1LAFE 1LB8A 1B4ZA 5IAIA 3DM0A 5ET7A 4KI0E 4NF5A 2UVHA 1B7HA 2DOJA 3W9WA 5EQ8A 1PEBA 1OLAA 1FPKA 1TFDA 1P99A 5FHMA 2RC7A 2ONRA 3KOTA 3VFJA 3BIHA 1Y1ZA 4F22A 4TOZA 3DP4A 4R72A 4KPTA 4OEUA 4QBAA 1I6QA 1KZ8A 4N07A 2XXUA 4U22A 4MHFA 1JW4A 1A40A 3IORA 5LDZA 4MEVA 3KBZA 1B5JA 2YJPA 4RPOA 3CHGA 4P1LA 3T1BA 2QRYA 5DYHA 1A55A 4OFLA 3TQLA 3T9HB 2WBBA 4H5FA 2DE4A 1US4A 4PFYA 3PUYE 2RCAA 5IM2A 3DLNA 3MZ1A 4YKIA 1FPJA 1YTVA 4NTLA 2V3TA 3VXCA 2REJA 1O63A 4O8MA 1DSNA 1IMEA 4PE5B 2ZYOA 2D5WA 2RCBA 2KR0A 4F1YA 4RK9A 1AL3A 3GXAA 4G61A 4NX1A 1FW0A 1LCFA 3EHUA 1EZPA 1B3LA 2F36A 2FVZA 3OEKA 2X26A 4E0WA 4RA1A 2UVGA 2XX8A 3KG2A 1D9VA 1TWYA 2UVIA 2R71A 3IOWA 4GXSB 1IMDA 1LLSA 3TQWA 4DLDA 3E4RA 3EHSA 4RJZA 2QVRA 3E79A 1MXUA 3N94A 2I0CA 1UIVA 1XOCA 3MVZA 1R9QA 1B1XA 1Q35A 3UA8A 3B50A 3ILTB 1NUXA 1POY1 3E78A 1NNPA 4FECA 4U1ZA 4JDFA 2XXWA 1R6ZA 2IA4A 1OMPA 3H6WA 4GD5A 3THIA 4QHQA 4PC9A 1A8EA 5JTYB 3MVWA 2B4MA 4QF9A 4QFNA 2O7UA 3TAJA 2XD3A 1A54A 1MY3A 1USYH 5IZZA 5I59A 2ZYMA 3IO6A 1SI0A 2XXYA 3TCFA 4GWWA 3PUWE 1O64A 2F7CA 3HPIA 4YMBA 2XHDA 4QFPA 1NV7A 4ZE9A 2DQVA 4I8CA 1OIBA 4GQOA 4QFKA 3DELB 2NWJA 2QFLA 4GWUA 1GR2A 3SEUA 4AS4A 3KN7A 3O9PA 1MPCA 2FIXA 2ZMBA 2RINA 2XXKA 5ISUA 3ILUB 2Q8MA 1JVXA 4EXKA 5JEIA 3O6GA 4ZDMA 3K6UA 3FXQA 2B3BA 1FBPA 3G7WA 2I4CA 4JXIA 1FQBA 3M3FA 4GBWA 3SEWA 1Y3PA 3CIJA 3N6UA 3PV0E 4X1DA 3VDFA 2Q74A 3SEVA 2V4CA 3FXBA 3PUZE 4IR8A 3LSWA 1LFIA 5T3JA 1MDP1 4G8MA 4R75A 4YAHX 1FPLA 1NUZA 4OVRA 4PGPA 4GBVA 1YPNA 5A5LA 2QS2A 2I6EA 1FTMA 3RN8A 2Y5KA 4U4XA 1PDAA 1LBCA 1I6AA 1BK4A 4P9KA 4XKRA 1NV5A 1ZLQA 2F6GA 1K9YA 4GIZA 1G0IA 4MLVA 1VE4A 4DDDA 3FJ7A 1FBEA 1QW0A 4O3CA 4PDDA 4BDRA 3KEIA 1VDWA 4IO3A 3FIRA 2PX1A 4IY5A 1I6BA 4OMBA 3T96B 3I5OA 1KA1A 1URGA 2ZYNA 3T93B 4N8GA 1IQ7A 4ND9A 1XHYA 5AA3A 2XWKA 4ESWA 2HAUA 1FPDA 1VR5A 4U2RA 4PAIA 2QL3A 3S9LC 1JW5A 4MBPA 5H8FB 3QYTA 1D4NA 4LUBA 1FBCA 3OSQA 3QUJA 3MVYA 1DPEA 1LFHA 4KCCA 1IEJA 5F24A 2Y7WA 4F3PA 5LTCA 2R9JA 1NV4A 4MIJA 4F1VA 1FBGA 3CSBA 3K02A 3S2VA 5CM6A 1UIUA 1FTJA 4F3SA 4PBQA 4KYSA 3K6VA 1MS7A 3PPRA 4QSCA 1FPGA 4N6PA 1QVSA 3PPNA 4GLIA 4KQPA 1ANFA 4ECFA 1URSA 3U8QA 4U4SA 1MH3A 3PU5A 5JTYA 4DIGA 2UYFA 2ZZXA 4XF5A 3M3KA 5FHNA 4N6KA 3RYDA 1FBHA 3IO4A 2P0SA 3MQ9A 1EYJA 1TXFA 4O7MA 4P1EA 4KR5A 3S9NC 4G4PA 4P11A 2XWOA 3UGWA 4ELQA 3GYYA 2F3BA 3OD7A 4THIA 1B0HA 5DW8A 1JNFA 4YKJA 3IFAA 3R26A 2FHYA 4OXVA 3K2DA 1BP5A 2PFZA 4GXAA 4HE1A 1PB8A 2I4BA 3ZS6A 3TTNA 2V25A 4NWDA 4WXJA 1Y3QA 3CRBA 4ZZEA 2Q2CA 1H43A 4N8YA 4PFRA 2H9BA 2Q9TA 2XXXA 1GTKA 3B6WA 3PD9A 3FBPA 4MJOA 1FBDA 2P3NA 1LCTA 3HHFA 3USDA 5LOMA 4MX6A 2F3DA 4KYEA 1N0TA 2ONKE 2DWIA 2YLNA 3ISPA 4N4UA 3S9MC 4R74A 4AQ4A 4NHBA 3W9VA 1QKAA 2Q8JA 1DMBA 3L6HA 3KJ7A 4XKNA 1VFEA 2QVVA 4KFQA 2XWIA 3FD3A 1H3DA 1NNTA 1EU8A 2UXAA 1YCJA 5CC2A 2ZYKA 5TU0A 1NV1A 5ESYA 5I58B 5ICTA 4ZE8A 4WEDA 3ROJA 2KLFA 3EPEA 5CMBA 3T66A 3T9VA 3WAEA 1FPIA 4H65A 5H8HB 1URDA 3M3LA 3BFTA 4M1VA 2QS4A 3HO7A 4G8HA 3G3GA 3N5LA 1AIVA 4TLMB 2ONSA 4GWSA 3HSTA 5CRYA 1SW2A 4XIGQ 5H8FA 3VLWA 5FHOA 1P1QA 4C0RA 1PB7A 3RY3A 1A8FA 2HZLA 5CMKA 2CZLA 3IJOB 4E0XA 3MWBA 3CG3A 4MH5A 4PFIA 3B7DA 2R8TA 2B4LA 3IB2A 4U21A 5DVFA 5ET8A 2OZZA 3UN6A 1UTHB 5I2KB 1XVYA 2VPNA 3IK6B 4BLAA 2VOZA 5HM4B 1B51A 2H5YA 3W15C 3HV1A 2QMWA 2H98A 3C33A 3TEPA 1MXYA 1JW1A 1MH4A 2WYPA 2QS3A 3HFUA 1NV0A 2DXRA 1MG1A 4FATA 2PVUA 1NMUA 1LEVA 4R6HA 2I49A 1N3WA 2ZZWA 2Q88A 1VSOA 4ELOA 4IGTA 1H45A 4GWYA 4YB6A 1EYIA 4BDOA 3TTRA 4O3BA 4R9GA 1USYE 3GBBA 3OMBA 4GVOA 3EHTA 4FORA 2CMOA 2Q89A 4ISUA 5K2YA 1YYZA 4ZZAA 1SDXA 3RNNA 1ATGA 1MQDA 2PT1A 2YPNA 4YU0A 1QULA 1AH5A 3AXFA 4P3LA 3G3JA 5CMCA 1GV8A 3TELA 1SVXB 2OWSA 4LA9A 2OWZA 3IOTA 4P0GA 3LUZA 5I5PA 4GOTA 2F34A 1OQHA 1OVBA 2PFYA 4GX3A 3FXUA 2OK2A 1NFTA 1F9BA 1FTLA 5EYGA 3IOVA 2ZNTA 4H45A 1LBYA 2HQ0A 4IY6A 4TLLB 3CVGA 4PFTA 3H7MA 3V5AA 1B3GA 2XXQA 4POXA 5I7IA 1FJ9A 3L6GA 1B3HA 3U65A 1AMFA 1JVYA 1Y20A 2BJJX 3G3KA 1MPBA 5AA4B 1Y4CA 2AIXA 3VE1B 3PD8A 3H6VA 2W7YA 4F18A 1IMAA 1IIWA 3LSLA 1QUJA 1Y1MA 2Z8DA 1WDNA 5CBRA 5I58A 2PYYA 2O6AA 1EZ9A 3BBRA 2RKMA 5H8HA 2M8CA 1IXIA 2CZIA 2FA7A 3C4MA 1IXGA 1D9QA 2DDKA 4MAGA 2ABHA 4NN3A 1LBBA 1B2HA 3VVFA 4NAPA 3TODA 1P1OA 4ZEFA 1DBZA 4XXUA 3UORA 4JSDA 4KYDA 2WEFA 3TTLA 1B46A 1FQEA 3G3HA 4R2BA 3TDJA 2BJIA 1LAHE 4YB7A 3FVOA 4POWA 1BIYA 1OLCA 2H99A 4X9TA 4P0IA 3MZBA 1MXXA 4NGUA 1NNKA 1SQYA 1UTHA 5I2KA 4LQ5A 3O6IA 2O51A 1IMFA 3FVNA 4WEPA 3VLVA 3BIGA 2RF1A 1NV6A 3I6VA 3MW0A 4I3EA 3NOHA 2F78A 4LZ5A 1ELJA 1ZKBA 4Q5TA 4GFRA 1XS5A 4QSEA 1HSLA 4PDHA 4F29A 1DPPA 1N7XA 4OTEA 2DP8A 2G93A 4M4GA 3RPWA 3UIFA 4NE4A 3T9XB 3PGFA 1SW5A 4JWYA 3LUYA 1AOVA 3RT8A 4LQ2A 1Z7NE 4YKKA 3SETA 1YXIA 1B4HA 1B5IA 3FUZA 2O84X 4PAKA 2OPEA 4U23A 4UACA 4NWCA 1P1UA 4WKMA 5TPAB 1POTA 4NMYA 4UA8A 3KC0A 1IZ1A 1ZJLA 4NQ8A 2O1LA 3PUXE 3T0JA 1QGXA 5A5XB 3DP6A 4EXLA 1EH3A 4ZEDA 4ONYA 4JSOA 1QJMA 3JZJA 4FIMA 1N7WA 1TT1A 1H76A 3SESA 4OFJA 5EHMA 3GZGA 2OCUA 5L8DA 1SW4A 4GL0A 2D21A 4G8NA 4YB5A 4NF6B 3G3FA 4PGNA 1DTGA 3VXBA 3U93A 1Q9DA 1XI6A 2VP1A 2Y7PA 1B58A 4EDPA 3PPPA 5AA2B 3IR1A 3LBSA 4OVQA 2AL5A 4FEBA 2PT2A 2I0BA 4BDLA 4IB2A 3GLBA 4IO7A 4QFLA 4N91A 4OEVA 4Z0IA 1ZMGA 5F7VA 4KHZE 2OBGA 4OETA 3PPOA 2FNCA 1S9TA 5BWJA 3H6TA 4F1UA 3K1PA 5ITPA 5AE4A 1SYIA 3LR1A 5L9MA 5AA4A 3QUFA 3ODBA 1JP4A 3BKIB 4JWXA 5I3SA 1ZIUA 1SPIA 2I3VA 2NOOA 5ET6A 2XXIA 3E9XA 2OX3A 3FGSA 1II5A 5HBCA 3LV0A 5TP9B 2REGA 1NUYA 2HZKA 1RKMA 2OWTA 4L17A 2Z23A 4OZ9A 1PB9A 4PFWA 2WBDA 4LZ7A 3U92A 5DVJA 2QPQA 4OENA 3MYUA 4RXLA 4MNPA 1FTAA 5B70A 1JEVA 1NH8A 1YZ0A 1CB6A 4XKPA 2I48A 2VD2A 2XX9A 4DXBA 3TTMA 3QSLA 4N17A 2KQZA 3V8XB 5AA1A 1FJ6A 1US5A 3JYRA 2HHMA 1IITA 3HCQA 3G3IA 4QXDA 3VVDA 3OXNA 3BFUA 3D4GA 3FJMA 4YMAA 5JK4A 4HE0A 4K3FA 2ZXTA 4FE8A 4BDQA 1CE2A 4O7IA 3Q25A 1FBFA 1DCUA 3UK4A 2V84A 2XXTA 1PBQA 4DI3D 4OERA 1IMBA 1LSTA 3E13X 2NVUB 2F7AA 2PBWA 1LFGA 3QIMA 3VV5A 1BKAA 2DVCA 2O1MA 3OOAA 4GWOA 1B6HA 3SKPA 1FQCA 1B7ZA 3TUSA 4N13A 1SBPA 2XD2A 2Y7RA 3RUMA 3ZKKA 2HEUA 1A99A 5IGAA
chains in the Genus database with same CATH topology
1LEVA 5IZZA 2ZZWA 2WX9A 1NI9A 4PTKA 1CNQA 4GWWA 4GWYA 5J16A 4UABA 1EYIA 4HCWA 1INPA 1NV7A 2DVZA 4PF8A 4MNIA 4NF0A 5ET5A 4YICA 2QFLA 4OVPA 2DE3A 2PCRA 4GWUA 1YYZA 1NV2A 4AS4A 2ZZVA 2GQ1A 4P56A 4P3LA 2FIXA 2OWZA 4LN5A 2XXKA 2Q8MA 3LUZA 5I5PA 1KA0A 4GWXA 5EQ7A 4XEQA 2PFYA 4GX3A 4HCYA 2FBPA 4JVIA 5FBPA 1FBPA 2Y5LA 2L5VA 3D1RA 4GBWA 1LBWA 4NG7A 5EYGA 4P47A 4N15A 2DE2A 4H45A 1LBYA 4GX6A 2Q74A 4DI4B 2V4CA 3FXBA 5J1DA 4IR8A 5I7IA 1FJ9A 5T3JA 3U65A 4KXPA 4N81A 2QVUA 4PBHA 1FPLA 1NUZA 1LBXA 4OVRA 4PGPA 4GBVA 4YZZA 4OVSA 5A5LA 4F18A 2Y5KA 1IMAA 1BK4A 4P9KA 1NV5A 1K9YA 1G0IA 4PDDA 1FBEA 1VDWA 4X8RA 5EQ9A 4PETA 3KC1A 2CZIA 3SZPA 4H46A 1KA1A 1FPBA 1D9QA 2DDKA 4MAGA 5EQAA 4NN3A 4OA4A 4N8GA 2CEYA 4O94A 1FRPA 2FIEA 2XWKA 4NAPA 1FPDA 2HPGA 2JJKA 4PAIA 1DBZA 2WEFA 1FBCA 4MMPA 5F24A 4I3YA 1FPEA 5LTCA 1NV4A 4MIJA 2BJIA 4F1VA 4PE3A 4JVCA 1FBGA 5CM6A 1FSAA 4X9TA 4PBQA 4NGUA 5IZ1A 4I40A 1G0HA 1IMFA 1FPGA 1EYKA 5IZ3A 3BIGA 4P8BA 1RDZA 4MNCA 1NV6A 4I3EA 3RPLA 3NOHA 2ZZXA 4XF5A 4N6KA 3RYDA 1FBHA 4PDHA 2P3VA 4N6DA 2CZKA 1EYJA 4MCOA 4O7MA 4PF6A 4X04A 4P1EA 2V3QA 4GX4A 2HXRA 2XWOA 3GYYA 2F3BA 4XFEA 4F19A 1YXIA 1FPFA 4OVTA 4PAKA 2XWVA 5DW8A 1NV3A 3IFAA 1K9ZA 2FHYA 4OANA 3KC0A 2PFZA 2CZHA 4NQ8A 4HE1A 2F5XA 3T0JA 1QGXA 1RDXA 5ET7A 3W9WA 4N8YA 4PFRA 5EQ8A 1FPKA 2Q9TA 1NUWA 3BIHA 1LBZA 4PGNA 4AS5A 3FBPA 3MSTA 4PAFA 4MJOA 1FBDA 2P3NA 1Q9DA 4QBAA 1KZ8A 1XI6A 4MHFA 4OVQA 2VPOA 5LDZA 4MX6A 2F3DA 4MEVA 3KBZA 4N91A 3ISPA 4N4UA 4HXVA 3CHGA 4P1LA 4NHBA 3W9VA 3T1BA 4HE2A 2QVVA 4GWZA 2XWIA 4F1UA 2WBBA 1AWBA 1JP4A 4JVDA 5I3SA 2DE4A 1SPIA 5ET6A 5IM2A 2OX3A 3QMFA 3LV0A 1FPJA 1NUYA 2HZKA 2VT5A 1NV1A 5ESYA 3PTYA 4O8MA 3ROJA 2WBDA 1IMEA 1FPIA 2QPQA 3MYUA 4MNPA 2KR0A 1FTAA 1DK4A 1YZ0A 4M1VA 2WYKA 4G61A 4NX1A 2XA5A 4N17A 4GWSA 2KQZA 2FVZA 1FJ6A 4FBPA 2HHMA 4QXDA 5JK4A 2HZLA 1IMDA 4HE0A 2QVRA 3E79A 4O7IA 1FBFA 4PFIA 1DCUA 2R8TA 2B4LA 2MKZA 4DI3D 5ET8A 1IMBA 3B50A 3A29A 1RDYA 1NUXA 1LBVA 4PCDA 2VPNA 3E78A 2CEXA 3EKIA 5IZ3B 3IFCA 4PFBA 1IMCA 3RPLB 5EYHA 4PC9A 3B8BA 2B4MA 2WYPA 3HFUA 5IGAA 1NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPI A;  2CZK A;  1EYJ A;  5ET6 A;  1LEV A;  1IMA A;  1BK4 A;  2OX3 A;  2P3V A;  3QMF A;  3LV0 A;  1FPJ A;  1NV5 A;  1K9Y A;  1NI9 A;  4GX4 A;  1G0I A;  4PTK A;  1NUY A;  1CNQ A;  1FBE A;  4GWW A;  4GWY A;  2VT5 A;  1VDW A;  2F3B A;  5J16 A;  1NV1 A;  5EQ9 A;  5ESY A;  1YXI A;  1FPF A;  1EYI A;  3ROJ A;  2WBD A;  5DW8 A;  1NV3 A;  1IME A;  1INP A;  3IFA A;  1FPI A;  1K9Z A;  2FHY A;  3KC1 A;  2CZI A;  1NV7 A;  1FTA A;  3KC0 A;  4H46 A;  1DK4 A;  2CZH A;  1KA1 A;  1FPB A;  1YZ0 A;  4HE1 A;  1D9Q A;  2DDK A;  3T0J A;  4G61 A;  5EQA A;  5ET5 A;  1QGX A;  1RDX A;  2QFL A;  4GWS A;  2PCR A;  4GWU A;  1YYZ A;  2FVZ A;  1FRP A;  2FIE A;  1NV2 A;  1FJ6 A;  1FPD A;  4AS4 A;  2JJK A;  5ET7 A;  4FBP A;  2GQ1 A;  2HHM A;  4QXD A;  2FIX A;  1DBZ A;  5EQ8 A;  1FPK A;  2WEF A;  1FBC A;  1NUW A;  2OWZ A;  3BIH A;  2Q8M A;  1IMD A;  1LBZ A;  4HE0 A;  3LUZ A;  5F24 A;  4AS5 A;  3FBP A;  4I3Y A;  2QVR A;  1FPE A;  4O7I A;  1NV4 A;  1FBD A;  2P3N A;  1FBF A;  1Q9D A;  2BJI A;  1DCU A;  1KA0 A;  4GWX A;  4MJO A;  5EQ7 A;  1KZ8 A;  1XI6 A;  4GX3 A;  2FBP A;  1FBG A;  2R8T A;  5FBP A;  1FBP A;  2Y5L A;  1FSA A;  3D1R A;  4GBW A;  5ET8 A;  1IMB A;  1LBW A;  5LDZ A;  5EYG A;  5IZ1 A;  2F3D A;  3A29 A;  4I40 A;  4H45 A;  1LBY A;  3KBZ A;  1RDY A;  4GX6 A;  3RYD A;  1NUX A;  1G0H A;  2Q74 A;  4HXV A;  1LBV A;  1IMF A;  1FPG A;  1EYK A;  4IR8 A;  5IZ3 A;  3BIG A;  5IZ3 B;  1FJ9 A;  1RDZ A;  5T3J A;  1NV6 A;  4HE2 A;  3IFC A;  4I3E A;  1IMC A;  2QVV A;  4GWZ A;  4KXP A;  4N81 A;  3RPL A;  2QVU A;  3RPL B;  5EYH A;  1FPL A;  1NUZ A;  1LBX A;  3B8B A;  2WBB A;  1AWB A;  4GBV A;  1JP4 A;  5A5L A;  5I3S A;  1FBH A;  2Y5K A;  1NV0 A; 
#chains in the Genus database with same CATH topology
 4F39 A;  1DTZ A;  4LVQ A;  1MY0 A;  1N76 A;  2WX9 A;  3TZA A;  1L5T A;  4FAJ A;  1NI9 A;  1OQG A;  2GRV A;  2H4I A;  4JB7 A;  4NF4 B;  4EF1 A;  5J16 A;  4UAB A;  4HCW A;  4GL8 A;  3IAZ A;  5TPA A;  2A5T B;  3OO9 A;  1MY4 A;  2Z8E A;  4IO4 A;  3K01 A;  1YAE A;  5A5X A;  5ET5 A;  5IKB A;  3FVG A;  4OVP A;  2DE3 A;  2PCR A;  2XXP A;  1NV2 A;  2DYX A;  2DXY A;  2AYS A;  5DEX B;  4H8I A;  2WKY A;  1MY2 A;  2E1S A;  1B5H A;  4NF6 A;  3R7X A;  1EZO A;  3MP6 A;  1D9Y A;  1KA0 A;  4GWX A;  5EQ7 A;  2XXV A;  4XEQ A;  2DWA A;  5I84 A;  2FBP A;  3D4C A;  1GVC A;  5AA2 A;  5FBP A;  2Y5L A;  2L5V A;  3FV1 A;  4Q8R A;  1LBW A;  4NG7 A;  3KBR A;  4NF8 B;  4GX6 A;  1D3K A;  4OHN A;  3FAS A;  3MP8 A;  3B6Q A;  3CG1 A;  5J1D A;  3KOS A;  3O28 A;  4KXP A;  3SDF A;  2QVU A;  2F97 A;  1PBP A;  3K6W A;  4QRZ A;  3RT6 B;  1LBX A;  3VLU A;  3EQ1 A;  3HN0 A;  1UQW A;  3TCH A;  5L9S A;  4ZEB A;  1SI1 A;  5TP9 A;  5B7D A;  3O66 A;  1PC3 A;  3H06 B;  1S7Y A;  3FAT A;  4X8R A;  2Y84 A;  1T0K A;  5EQ9 A;  1HSJ A;  4H5G A;  4DCX A;  4PET A;  1S50 A;  3SZP A;  4RY1 A;  3C31 A;  5KZT A;  2F8D A;  2NUV A;  2XX7 A;  4OA4 A;  3IX1 A;  5H8N B;  2CEY A;  3HHG A;  4F31 B;  4F2O A;  3I3V A;  3KJT A;  4EQ7 A;  4O94 A;  2FIE A;  4JBZ A;  2Z8F A;  2HPG A;  1NH7 A;  2THI A;  3H4Z A;  2I58 A;  1FQA A;  4HS7 A;  1R9L A;  3K0V A;  4ZS9 A;  3Q27 A;  4MMP A;  1M5E A;  2F35 A;  3TTK A;  1FPE A;  3SEY A;  1QKB A;  1N84 A;  4AB5 A;  4HW8 A;  4JVC A;  3TYH A;  5H8Q B;  4KCD A;  1FSA A;  1B7U A;  1NL5 A;  1GGG A;  1Z7M E;  4I40 A;  3OO6 A;  1M5B A;  3C34 A;  4LAT A;  1M5F A;  1EYK A;  2B65 A;  1RDZ A;  3RTW B;  4MFI A;  5I56 B;  2R6G E;  2X7P A;  3C9H A;  2F7B A;  2F6P A;  2A5S A;  1J1N A;  2P3V A;  1MM7 A;  5DVI A;  2CZK A;  3WAF A;  4MCO A;  1MXW A;  4PF6 A;  3RQT A;  3OO7 A;  4X04 A;  4ELR A;  2V3Q A;  2HXR A;  3SER A;  4NF4 A;  3H03 A;  1ZTY A;  2QSX A;  3QXM A;  3N6T A;  3IL1 B;  3ECR A;  4G77 A;  4H6D A;  4MF3 A;  3V89 B;  1NV3 A;  2A5T A;  1P1N A;  1K9Z A;  2OLB A;  3MP1 A;  4R73 A;  2P1S A;  3LSF B;  2IEE A;  3PPQ A;  3CI8 A;  2Q2A A;  1NKX A;  3OO8 A;  1QUK A;  1RDX A;  3KN8 A;  5I2N B;  2DS9 A;  4RNS A;  5DEX A;  1MM6 A;  5BUU A;  3O6H A;  3GBA A;  1NUW A;  4XTC Q;  1LBZ A;  4ZEI A;  4AS5 A;  2HXW A;  3MST A;  4DXC A;  4PAF A;  3LSX A;  4G68 B;  2O7I A;  3PUV E;  4R2F A;  4OWD A;  2VPO A;  1FTK A;  4NF8 A;  4NED A;  4TQU Q;  4EF2 A;  4IO5 A;  4HXV A;  1LAX A;  4OVJ A;  3Q26 A;  1JEU A;  3A3C A;  2QJE A;  4HE2 A;  2Y7I A;  4GWZ A;  5KDT B;  1M5D A;  4RPN A;  1H44 A;  3CFX A;  5HPQ A;  1N3X A;  2RC9 A;  3KGC A;  3MPK A;  1AWB A;  2VGQ A;  3ONM A;  3A3U A;  3E3K A;  1P1W A;  4JVD A;  4PFU A;  1BLF A;  4DZ1 A;  3MUQ A;  1ZU0 A;  4U1O A;  5EYF A;  3QMF A;  4LON B;  2DWH A;  3MZ9 A;  3QAX A;  4RK2 A;  2VT5 A;  4QFO A;  5KCJ B;  4KD5 A;  4OYV A;  3PTY A;  1MDQ A;  1BTJ A;  3SEX A;  2XXR A;  2O68 A;  4H0W A;  1B0L A;  2OPD A;  1DK4 A;  3OEN A;  3MJN A;  3MVX A;  2WYK A;  4Q0C A;  4G2Z A;  5H8N A;  3RTF B;  2XA5 A;  3OEM A;  4PQJ A;  3PMV A;  2UVJ A;  1FCK A;  1IXC A;  4C1T A;  1OVT A;  3PMX A;  3EF7 A;  4FBP A;  3O97 A;  2ESN A;  3T9U A;  2GFE A;  3KZG A;  1MQJ A;  4OQO A;  4ZEC A;  3U72 A;  1IUD A;  4IO2 A;  4IO6 A;  5FTH A;  3TFL A;  1B3F A;  1KWH A;  1VFD A;  5H8Q A;  3N26 A;  2PMS A;  3CFL A;  1B9J A;  2MKZ A;  1B52 A;  5F1Q A;  2E0S A;  2V93 A;  3KN3 A;  2P2A A;  3A29 A;  4FJP A;  2GH9 A;  1RDY A;  1MPD A;  1LBV A;  3P7I A;  4PCD A;  4I1D A;  3T22 A;  2CEX A;  3EKI A;  1WVJ A;  3K1N A;  5IZ3 B;  2UYE A;  4OFO A;  1UTB B;  3IFC A;  3FXR A;  4PFB A;  1IMC A;  4EUO A;  5I56 A;  4H8J A;  3RPL B;  5EYH A;  1I69 A;  5DT6 A;  3B8B A;  2B3F A;  4H67 A;  3O29 A;  1TFA A;  5ELV A;  1B1H A;  1MQH A;  4RYA A;  2VHA A;  2GHB A;  4PTK A;  3KFM A;  4DXU A;  1CNQ A;  4F2Q A;  4X48 A;  4XKQ A;  4H1X A;  4AB6 A;  1SD3 A;  1INP A;  2I3W A;  3IOU A;  3IB0 A;  1Q1K A;  3FV2 A;  2DVZ A;  4PF8 A;  5I57 B;  1WOD A;  4MNI A;  4NF0 A;  5CBS A;  5I2N A;  4YIC A;  1DOT A;  4F3G A;  1B3E A;  2HFB A;  4I9D A;  4Q30 B;  1O7T A;  4I62 A;  5CMM A;  2ZZV A;  2GQ1 A;  4LZ8 A;  4P56 A;  4ZEK A;  4BDN A;  4NF5 B;  2D3I A;  1IXH A;  3VVE A;  5L9O A;  3C35 A;  3CFZ A;  4LN5 A;  3QK6 A;  3UP9 A;  1SW1 A;  1HSE A;  1N04 A;  3FJG A;  3H3G A;  1A7L A;  3A09 A;  4G68 A;  4R9F A;  2ZNU A;  1MXV A;  5DTB A;  4HCY A;  4JVI A;  4F3B A;  2O69 A;  3TCG A;  3D1R A;  2ALU A;  4ESX A;  2LAO A;  2ZNS A;  4P47 A;  3R6U A;  5M2V A;  3ZKL A;  4N15 A;  2DE2 A;  2NXO A;  2QMX A;  2DSF A;  1LGB C;  4GF8 A;  4DI4 B;  3PMW A;  5ITO A;  4C1U A;  3K00 A;  5KDT A;  3ZSF A;  1FTO A;  4N81 A;  4PBH A;  4PP0 A;  4IGR A;  4YZZ A;  3B6T A;  4O3A A;  3K6X A;  4OVS A;  2X7Q A;  1JQF A;  1MRP A;  1MXZ A;  1RYX A;  3M8U A;  3OEL A;  3TPA A;  3S9E A;  3U94 A;  2QS1 A;  2FYI A;  4MLQ A;  3TKD A;  3KSX A;  5KCJ A;  1QUI A;  4JWO A;  3RGY A;  1NNF A;  3EN3 A;  2HAV A;  1B32 A;  3KC1 A;  3FZV A;  3C32 A;  5ICQ A;  4H46 A;  4Z7E A;  1B40 A;  1ZBM A;  1FPB A;  2GHA A;  3MAM A;  2V3U A;  5EQA A;  3DP8 A;  1R1N A;  3V83 A;  4HTG A;  1MY1 A;  4GRK A;  3LC8 A;  1FRP A;  1Y4T A;  2ANJ A;  4YKP A;  3Q28 A;  4DE8 A;  3FVK A;  2JJK A;  2RC8 A;  1MQI A;  4LP2 B;  3CSG A;  3F11 A;  4R6K A;  2DWJ A;  5AA2 D;  4DCY A;  3IJX B;  1XT8 A;  2XXH A;  3IB1 A;  1XVX A;  3MBP A;  4I3Y A;  4X1B A;  3MPL A;  4QSD A;  4PE3 A;  1FQD A;  2VD3 A;  1M5C A;  2OJT A;  3C36 A;  1Y3N A;  1JET A;  2H25 A;  5IZ1 A;  4EQ9 A;  3RLF E;  4OES A;  1XC1 A;  4G68 C;  3Q29 A;  1G0H A;  1LAG E;  3K1M A;  4EQB A;  2AL4 A;  5IZ3 A;  3U1O A;  3K4U A;  1UTB A;  4P8B A;  4MNC A;  1B05 A;  4ELP A;  1RYO A;  2HCA A;  3RPL A;  5K2X A;  3CR9 A;  3S4U A;  3H6U A;  5CI5 A;  3OSR A;  2Z22 A;  5FTI A;  1FQF A;  1LB9 A;  4N6D A;  4FED A;  4R6Y A;  1Y9U A;  5I59 B;  3TMG A;  4GX4 A;  1MQG A;  3KSJ A;  4F19 A;  4XFE A;  1FPF A;  4OVT A;  3O2A A;  2Y7K A;  4BDM A;  2XWV A;  1SYH A;  5EHS A;  4OAN A;  5I57 A;  2CZH A;  5H8S A;  3JV9 A;  2G29 A;  2F5X A;  3MC2 A;  1LAF E;  1LB8 A;  1B4Z A;  5IAI A;  3DM0 A;  5ET7 A;  4KI0 E;  4NF5 A;  2UVH A;  1B7H A;  2DOJ A;  3W9W A;  5EQ8 A;  1PEB A;  1OLA A;  1FPK A;  1TFD A;  1P99 A;  5FHM A;  2RC7 A;  2ONR A;  3KOT A;  3VFJ A;  3BIH A;  1Y1Z A;  4F22 A;  4TOZ A;  3DP4 A;  4R72 A;  4KPT A;  4OEU A;  4QBA A;  1I6Q A;  1KZ8 A;  4N07 A;  2XXU A;  4U22 A;  4MHF A;  1JW4 A;  1A40 A;  3IOR A;  5LDZ A;  4MEV A;  3KBZ A;  1B5J A;  2YJP A;  4RPO A;  3CHG A;  4P1L A;  3T1B A;  2QRY A;  5DYH A;  1A55 A;  4OFL A;  3TQL A;  3T9H B;  2WBB A;  4H5F A;  2DE4 A;  1US4 A;  4PFY A;  3PUY E;  2RCA A;  5IM2 A;  3DLN A;  3MZ1 A;  4YKI A;  1FPJ A;  1YTV A;  4NTL A;  2V3T A;  3VXC A;  2REJ A;  1O63 A;  4O8M A;  1DSN A;  1IME A;  4PE5 B;  2ZYO A;  2D5W A;  2RCB A;  2KR0 A;  4F1Y A;  4RK9 A;  1AL3 A;  3GXA A;  4G61 A;  4NX1 A;  1FW0 A;  1LCF A;  3EHU A;  1EZP A;  1B3L A;  2F36 A;  2FVZ A;  3OEK A;  2X26 A;  4E0W A;  4RA1 A;  2UVG A;  2XX8 A;  3KG2 A;  1D9V A;  1TWY A;  2UVI A;  2R71 A;  3IOW A;  4GXS B;  1IMD A;  1LLS A;  3TQW A;  4DLD A;  3E4R A;  3EHS A;  4RJZ A;  2QVR A;  3E79 A;  1MXU A;  3N94 A;  2I0C A;  1UIV A;  1XOC A;  3MVZ A;  1R9Q A;  1B1X A;  1Q35 A;  3UA8 A;  3B50 A;  3ILT B;  1NUX A;  1POY 1;  3E78 A;  1NNP A;  4FEC A;  4U1Z A;  4JDF A;  2XXW A;  1R6Z A;  2IA4 A;  1OMP A;  3H6W A;  4GD5 A;  3THI A;  4QHQ A;  4PC9 A;  1A8E A;  5JTY B;  3MVW A;  2B4M A;  4QF9 A;  4QFN A;  2O7U A;  3TAJ A;  2XD3 A;  1A54 A;  1MY3 A;  1USY H;  5IZZ A;  5I59 A;  2ZYM A;  3IO6 A;  1SI0 A;  2XXY A;  3TCF A;  4GWW A;  3PUW E;  1O64 A;  2F7C A;  3HPI A;  4YMB A;  2XHD A;  4QFP A;  1NV7 A;  4ZE9 A;  2DQV A;  4I8C A;  1OIB A;  4GQO A;  4QFK A;  3DEL B;  2NWJ A;  2QFL A;  4GWU A;  1GR2 A;  3SEU A;  4AS4 A;  3KN7 A;  3O9P A;  1MPC A;  2FIX A;  2ZMB A;  2RIN A;  2XXK A;  5ISU A;  3ILU B;  2Q8M A;  1JVX A;  4EXK A;  5JEI A;  3O6G A;  4ZDM A;  3K6U A;  3FXQ A;  2B3B A;  1FBP A;  3G7W A;  2I4C A;  4JXI A;  1FQB A;  3M3F A;  4GBW A;  3SEW A;  1Y3P A;  3CIJ A;  3N6U A;  3PV0 E;  4X1D A;  3VDF A;  2Q74 A;  3SEV A;  2V4C A;  3FXB A;  3PUZ E;  4IR8 A;  3LSW A;  1LFI A;  5T3J A;  1MDP 1;  4G8M A;  4R75 A;  4YAH X;  1FPL A;  1NUZ A;  4OVR A;  4PGP A;  4GBV A;  1YPN A;  5A5L A;  2QS2 A;  2I6E A;  1FTM A;  3RN8 A;  2Y5K A;  4U4X A;  1PDA A;  1LBC A;  1I6A A;  1BK4 A;  4P9K A;  4XKR A;  1NV5 A;  1ZLQ A;  2F6G A;  1K9Y A;  4GIZ A;  1G0I A;  4MLV A;  1VE4 A;  4DDD A;  3FJ7 A;  1FBE A;  1QW0 A;  4O3C A;  4PDD A;  4BDR A;  3KEI A;  1VDW A;  4IO3 A;  3FIR A;  2PX1 A;  4IY5 A;  1I6B A;  4OMB A;  3T96 B;  3I5O A;  1KA1 A;  1URG A;  2ZYN A;  3T93 B;  4N8G A;  1IQ7 A;  4ND9 A;  1XHY A;  5AA3 A;  2XWK A;  4ESW A;  2HAU A;  1FPD A;  1VR5 A;  4U2R A;  4PAI A;  2QL3 A;  3S9L C;  1JW5 A;  4MBP A;  5H8F B;  3QYT A;  1D4N A;  4LUB A;  1FBC A;  3OSQ A;  3QUJ A;  3MVY A;  1DPE A;  1LFH A;  4KCC A;  1IEJ A;  5F24 A;  2Y7W A;  4F3P A;  5LTC A;  2R9J A;  1NV4 A;  4MIJ A;  4F1V A;  1FBG A;  3CSB A;  3K02 A;  3S2V A;  5CM6 A;  1UIU A;  1FTJ A;  4F3S A;  4PBQ A;  4KYS A;  3K6V A;  1MS7 A;  3PPR A;  4QSC A;  1FPG A;  4N6P A;  1QVS A;  3PPN A;  4GLI A;  4KQP A;  1ANF A;  4ECF A;  1URS A;  3U8Q A;  4U4S A;  1MH3 A;  3PU5 A;  5JTY A;  4DIG A;  2UYF A;  2ZZX A;  4XF5 A;  3M3K A;  5FHN A;  4N6K A;  3RYD A;  1FBH A;  3IO4 A;  2P0S A;  3MQ9 A;  1EYJ A;  1TXF A;  4O7M A;  4P1E A;  4KR5 A;  3S9N C;  4G4P A;  4P11 A;  2XWO A;  3UGW A;  4ELQ A;  3GYY A;  2F3B A;  3OD7 A;  4THI A;  1B0H A;  5DW8 A;  1JNF A;  4YKJ A;  3IFA A;  3R26 A;  2FHY A;  4OXV A;  3K2D A;  1BP5 A;  2PFZ A;  4GXA A;  4HE1 A;  1PB8 A;  2I4B A;  3ZS6 A;  3TTN A;  2V25 A;  4NWD A;  4WXJ A;  1Y3Q A;  3CRB A;  4ZZE A;  2Q2C A;  1H43 A;  4N8Y A;  4PFR A;  2H9B A;  2Q9T A;  2XXX A;  1GTK A;  3B6W A;  3PD9 A;  3FBP A;  4MJO A;  1FBD A;  2P3N A;  1LCT A;  3HHF A;  3USD A;  5LOM A;  4MX6 A;  2F3D A;  4KYE A;  1N0T A;  2ONK E;  2DWI A;  2YLN A;  3ISP A;  4N4U A;  3S9M C;  4R74 A;  4AQ4 A;  4NHB A;  3W9V A;  1QKA A;  2Q8J A;  1DMB A;  3L6H A;  3KJ7 A;  4XKN A;  1VFE A;  2QVV A;  4KFQ A;  2XWI A;  3FD3 A;  1H3D A;  1NNT A;  1EU8 A;  2UXA A;  1YCJ A;  5CC2 A;  2ZYK A;  5TU0 A;  1NV1 A;  5ESY A;  5I58 B;  5ICT A;  4ZE8 A;  4WED A;  3ROJ A;  2KLF A;  3EPE A;  5CMB A;  3T66 A;  3T9V A;  3WAE A;  1FPI A;  4H65 A;  5H8H B;  1URD A;  3M3L A;  3BFT A;  4M1V A;  2QS4 A;  3HO7 A;  4G8H A;  3G3G A;  3N5L A;  1AIV A;  4TLM B;  2ONS A;  4GWS A;  3HST A;  5CRY A;  1SW2 A;  4XIG Q;  5H8F A;  3VLW A;  5FHO A;  1P1Q A;  4C0R A;  1PB7 A;  3RY3 A;  1A8F A;  2HZL A;  5CMK A;  2CZL A;  3IJO B;  4E0X A;  3MWB A;  3CG3 A;  4MH5 A;  4PFI A;  3B7D A;  2R8T A;  2B4L A;  3IB2 A;  4U21 A;  5DVF A;  5ET8 A;  2OZZ A;  3UN6 A;  1UTH B;  5I2K B;  1XVY A;  2VPN A;  3IK6 B;  4BLA A;  2VOZ A;  5HM4 B;  1B51 A;  2H5Y A;  3W15 C;  3HV1 A;  2QMW A;  2H98 A;  3C33 A;  3TEP A;  1MXY A;  1JW1 A;  1MH4 A;  2WYP A;  2QS3 A;  3HFU A;  1NV0 A;  2DXR A;  1MG1 A;  4FAT A;  2PVU A;  1NMU A;  1LEV A;  4R6H A;  2I49 A;  1N3W A;  2ZZW A;  2Q88 A;  1VSO A;  4ELO A;  4IGT A;  1H45 A;  4GWY A;  4YB6 A;  1EYI A;  4BDO A;  3TTR A;  4O3B A;  4R9G A;  1USY E;  3GBB A;  3OMB A;  4GVO A;  3EHT A;  4FOR A;  2CMO A;  2Q89 A;  4ISU A;  5K2Y A;  1YYZ A;  4ZZA A;  1SDX A;  3RNN A;  1ATG A;  1MQD A;  2PT1 A;  2YPN A;  4YU0 A;  1QUL A;  1AH5 A;  3AXF A;  4P3L A;  3G3J A;  5CMC A;  1GV8 A;  3TEL A;  1SVX B;  2OWS A;  4LA9 A;  2OWZ A;  3IOT A;  4P0G A;  3LUZ A;  5I5P A;  4GOT A;  2F34 A;  1OQH A;  1OVB A;  2PFY A;  4GX3 A;  3FXU A;  2OK2 A;  1NFT A;  1F9B A;  1FTL A;  5EYG A;  3IOV A;  2ZNT A;  4H45 A;  1LBY A;  2HQ0 A;  4IY6 A;  4TLL B;  3CVG A;  4PFT A;  3H7M A;  3V5A A;  1B3G A;  2XXQ A;  4POX A;  5I7I A;  1FJ9 A;  3L6G A;  1B3H A;  3U65 A;  1AMF A;  1JVY A;  1Y20 A;  2BJJ X;  3G3K A;  1MPB A;  5AA4 B;  1Y4C A;  2AIX A;  3VE1 B;  3PD8 A;  3H6V A;  2W7Y A;  4F18 A;  1IMA A;  1IIW A;  3LSL A;  1QUJ A;  1Y1M A;  2Z8D A;  1WDN A;  5CBR A;  5I58 A;  2PYY A;  2O6A A;  1EZ9 A;  3BBR A;  2RKM A;  5H8H A;  2M8C A;  1IXI A;  2CZI A;  2FA7 A;  3C4M A;  1IXG A;  1D9Q A;  2DDK A;  4MAG A;  2ABH A;  4NN3 A;  1LBB A;  1B2H A;  3VVF A;  4NAP A;  3TOD A;  1P1O A;  4ZEF A;  1DBZ A;  4XXU A;  3UOR A;  4JSD A;  4KYD A;  2WEF A;  3TTL A;  1B46 A;  1FQE A;  3G3H A;  4R2B A;  3TDJ A;  2BJI A;  1LAH E;  4YB7 A;  3FVO A;  4POW A;  1BIY A;  1OLC A;  2H99 A;  4X9T A;  4P0I A;  3MZB A;  1MXX A;  4NGU A;  1NNK A;  1SQY A;  1UTH A;  5I2K A;  4LQ5 A;  3O6I A;  2O51 A;  1IMF A;  3FVN A;  4WEP A;  3VLV A;  3BIG A;  2RF1 A;  1NV6 A;  3I6V A;  3MW0 A;  4I3E A;  3NOH A;  2F78 A;  4LZ5 A;  1ELJ A;  1ZKB A;  4Q5T A;  4GFR A;  1XS5 A;  4QSE A;  1HSL A;  4PDH A;  4F29 A;  1DPP A;  1N7X A;  4OTE A;  2DP8 A;  2G93 A;  4M4G A;  3RPW A;  3UIF A;  4NE4 A;  3T9X B;  3PGF A;  1SW5 A;  4JWY A;  3LUY A;  1AOV A;  3RT8 A;  4LQ2 A;  1Z7N E;  4YKK A;  3SET A;  1YXI A;  1B4H A;  1B5I A;  3FUZ A;  2O84 X;  4PAK A;  2OPE A;  4U23 A;  4UAC A;  4NWC A;  1P1U A;  4WKM A;  5TPA B;  1POT A;  4NMY A;  4UA8 A;  3KC0 A;  1IZ1 A;  1ZJL A;  4NQ8 A;  2O1L A;  3PUX E;  3T0J A;  1QGX A;  5A5X B;  3DP6 A;  4EXL A;  1EH3 A;  4ZED A;  4ONY A;  4JSO A;  1QJM A;  3JZJ A;  4FIM A;  1N7W A;  1TT1 A;  1H76 A;  3SES A;  4OFJ A;  5EHM A;  3GZG A;  2OCU A;  5L8D A;  1SW4 A;  4GL0 A;  2D21 A;  4G8N A;  4YB5 A;  4NF6 B;  3G3F A;  4PGN A;  1DTG A;  3VXB A;  3U93 A;  1Q9D A;  1XI6 A;  2VP1 A;  2Y7P A;  1B58 A;  4EDP A;  3PPP A;  5AA2 B;  3IR1 A;  3LBS A;  4OVQ A;  2AL5 A;  4FEB A;  2PT2 A;  2I0B A;  4BDL A;  4IB2 A;  3GLB A;  4IO7 A;  4QFL A;  4N91 A;  4OEV A;  4Z0I A;  1ZMG A;  5F7V A;  4KHZ E;  2OBG A;  4OET A;  3PPO A;  2FNC A;  1S9T A;  5BWJ A;  3H6T A;  4F1U A;  3K1P A;  5ITP A;  5AE4 A;  1SYI A;  3LR1 A;  5L9M A;  5AA4 A;  3QUF A;  3ODB A;  1JP4 A;  3BKI B;  4JWX A;  5I3S A;  1ZIU A;  1SPI A;  2I3V A;  2NOO A;  5ET6 A;  2XXI A;  3E9X A;  2OX3 A;  3FGS A;  1II5 A;  5HBC A;  3LV0 A;  5TP9 B;  2REG A;  1NUY A;  2HZK A;  1RKM A;  2OWT A;  4L17 A;  2Z23 A;  4OZ9 A;  1PB9 A;  4PFW A;  2WBD A;  4LZ7 A;  3U92 A;  5DVJ A;  2QPQ A;  4OEN A;  3MYU A;  4RXL A;  4MNP A;  1FTA A;  5B70 A;  1JEV A;  1NH8 A;  1YZ0 A;  1CB6 A;  4XKP A;  2I48 A;  2VD2 A;  2XX9 A;  4DXB A;  3TTM A;  3QSL A;  4N17 A;  2KQZ A;  3V8X B;  5AA1 A;  1FJ6 A;  1US5 A;  3JYR A;  2HHM A;  1IIT A;  3HCQ A;  3G3I A;  4QXD A;  3VVD A;  3OXN A;  3BFU A;  3D4G A;  3FJM A;  4YMA A;  5JK4 A;  4HE0 A;  4K3F A;  2ZXT A;  4FE8 A;  4BDQ A;  1CE2 A;  4O7I A;  3Q25 A;  1FBF A;  1DCU A;  3UK4 A;  2V84 A;  2XXT A;  1PBQ A;  4DI3 D;  4OER A;  1IMB A;  1LST A;  3E13 X;  2NVU B;  2F7A A;  2PBW A;  1LFG A;  3QIM A;  3VV5 A;  1BKA A;  2DVC A;  2O1M A;  3OOA A;  4GWO A;  1B6H A;  3SKP A;  1FQC A;  1B7Z A;  3TUS A;  4N13 A;  1SBP A;  2XD2 A;  2Y7R A;  3RUM A;  3ZKK A;  2HEU A;  1A99 A;  5IGA A; 
#chains in the Genus database with same CATH homology
 1LEV A;  5IZZ A;  2ZZW A;  2WX9 A;  1NI9 A;  4PTK A;  1CNQ A;  4GWW A;  4GWY A;  5J16 A;  4UAB A;  1EYI A;  4HCW A;  1INP A;  1NV7 A;  2DVZ A;  4PF8 A;  4MNI A;  4NF0 A;  5ET5 A;  4YIC A;  2QFL A;  4OVP A;  2DE3 A;  2PCR A;  4GWU A;  1YYZ A;  1NV2 A;  4AS4 A;  2ZZV A;  2GQ1 A;  4P56 A;  4P3L A;  2FIX A;  2OWZ A;  4LN5 A;  2XXK A;  2Q8M A;  3LUZ A;  5I5P A;  1KA0 A;  4GWX A;  5EQ7 A;  4XEQ A;  2PFY A;  4GX3 A;  4HCY A;  2FBP A;  4JVI A;  5FBP A;  1FBP A;  2Y5L A;  2L5V A;  3D1R A;  4GBW A;  1LBW A;  4NG7 A;  5EYG A;  4P47 A;  4N15 A;  2DE2 A;  4H45 A;  1LBY A;  4GX6 A;  2Q74 A;  4DI4 B;  2V4C A;  3FXB A;  5J1D A;  4IR8 A;  5I7I A;  1FJ9 A;  5T3J A;  3U65 A;  4KXP A;  4N81 A;  2QVU A;  4PBH A;  1FPL A;  1NUZ A;  1LBX A;  4OVR A;  4PGP A;  4GBV A;  4YZZ A;  4OVS A;  5A5L A;  4F18 A;  2Y5K A;  1IMA A;  1BK4 A;  4P9K A;  1NV5 A;  1K9Y A;  1G0I A;  4PDD A;  1FBE A;  1VDW A;  4X8R A;  5EQ9 A;  4PET A;  3KC1 A;  2CZI A;  3SZP A;  4H46 A;  1KA1 A;  1FPB A;  1D9Q A;  2DDK A;  4MAG A;  5EQA A;  4NN3 A;  4OA4 A;  4N8G A;  2CEY A;  4O94 A;  1FRP A;  2FIE A;  2XWK A;  4NAP A;  1FPD A;  2HPG A;  2JJK A;  4PAI A;  1DBZ A;  2WEF A;  1FBC A;  4MMP A;  5F24 A;  4I3Y A;  1FPE A;  5LTC A;  1NV4 A;  4MIJ A;  2BJI A;  4F1V A;  4PE3 A;  4JVC A;  1FBG A;  5CM6 A;  1FSA A;  4X9T A;  4PBQ A;  4NGU A;  5IZ1 A;  4I40 A;  1G0H A;  1IMF A;  1FPG A;  1EYK A;  5IZ3 A;  3BIG A;  4P8B A;  1RDZ A;  4MNC A;  1NV6 A;  4I3E A;  3RPL A;  3NOH A;  2ZZX A;  4XF5 A;  4N6K A;  3RYD A;  1FBH A;  4PDH A;  2P3V A;  4N6D A;  2CZK A;  1EYJ A;  4MCO A;  4O7M A;  4PF6 A;  4X04 A;  4P1E A;  2V3Q A;  4GX4 A;  2HXR A;  2XWO A;  3GYY A;  2F3B A;  4XFE A;  4F19 A;  1YXI A;  1FPF A;  4OVT A;  4PAK A;  2XWV A;  5DW8 A;  1NV3 A;  3IFA A;  1K9Z A;  2FHY A;  4OAN A;  3KC0 A;  2PFZ A;  2CZH A;  4NQ8 A;  4HE1 A;  2F5X A;  3T0J A;  1QGX A;  1RDX A;  5ET7 A;  3W9W A;  4N8Y A;  4PFR A;  5EQ8 A;  1FPK A;  2Q9T A;  1NUW A;  3BIH A;  1LBZ A;  4PGN A;  4AS5 A;  3FBP A;  3MST A;  4PAF A;  4MJO A;  1FBD A;  2P3N A;  1Q9D A;  4QBA A;  1KZ8 A;  1XI6 A;  4MHF A;  4OVQ A;  2VPO A;  5LDZ A;  4MX6 A;  2F3D A;  4MEV A;  3KBZ A;  4N91 A;  3ISP A;  4N4U A;  4HXV A;  3CHG A;  4P1L A;  4NHB A;  3W9V A;  3T1B A;  4HE2 A;  2QVV A;  4GWZ A;  2XWI A;  4F1U A;  2WBB A;  1AWB A;  1JP4 A;  4JVD A;  5I3S A;  2DE4 A;  1SPI A;  5ET6 A;  5IM2 A;  2OX3 A;  3QMF A;  3LV0 A;  1FPJ A;  1NUY A;  2HZK A;  2VT5 A;  1NV1 A;  5ESY A;  3PTY A;  4O8M A;  3ROJ A;  2WBD A;  1IME A;  1FPI A;  2QPQ A;  3MYU A;  4MNP A;  2KR0 A;  1FTA A;  1DK4 A;  1YZ0 A;  4M1V A;  2WYK A;  4G61 A;  4NX1 A;  2XA5 A;  4N17 A;  4GWS A;  2KQZ A;  2FVZ A;  1FJ6 A;  4FBP A;  2HHM A;  4QXD A;  5JK4 A;  2HZL A;  1IMD A;  4HE0 A;  2QVR A;  3E79 A;  4O7I A;  1FBF A;  4PFI A;  1DCU A;  2R8T A;  2B4L A;  2MKZ A;  4DI3 D;  5ET8 A;  1IMB A;  3B50 A;  3A29 A;  1RDY A;  1NUX A;  1LBV A;  4PCD A;  2VPN A;  3E78 A;  2CEX A;  3EKI A;  5IZ3 B;  3IFC A;  4PFB A;  1IMC A;  3RPL B;  5EYH A;  4PC9 A;  3B8B A;  2B4M A;  2WYP A;  3HFU A;  5IGA A;  1NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...