1JP4A

Crystal structure of an enzyme displaying both inositol-polyphosphate 1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
302
Chain Sequence
HNVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLKEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNYEYYASRVPESVKSALIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an enzyme displaying both inositol-polyphosphate-1-phosphatase and 3'-phosphoadenosine-5'-phosphate phosphatase activities: a novel target of lithium therapy.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords 3'(2'),5'-bisphosphate nucleotidase
total genus 98
structure length 302
sequence length 304
ec nomenclature ec 3.1.3.7: 3'(2'),5'-bisphosphate nucleotidase.
pdb deposition date 2001-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1jp4A01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1jp4A02
4GX4A 2WEFA 3RPLB 1Q9DA 5EQAA 2QFLA 2QVUA 3QMFA 4GWZA 1LBVA 1RDZA 2WBDA 3A29A 5J16A 1XI6A 1LBYA 2BJIA 1SPIA 5ET8A 3KC0A 4N81A 1EYIA 5A5LA 1DBZA 1INPA 1DK4A 1FPLA 2Y5KA 5FBPA 1K9YA 2QVRA 2HHMA 2CZKA 4GX3A 2FBPA 3FBPA 1FJ9A 2CZIA 1LBXA 1NV1A 1AWBA 1IMAA 1IMEA 2FIXA 1NUZA 4GX6A 2VT5A 4GWYA 5EYHA 5T3JA 3IFAA 1D9QA 2Q8MA 1FPBA 1NUXA 5EQ9A 1KA1A 4FBPA 5EQ8A 2GQ1A 1NV4A 1G0HA 5EYGA 1FBPA 2F3DA 1FPFA 2WBBA 4IR8A 4I3YA 1FJ6A 1FSAA 1FPDA 2PCRA 1FPGA 1NV7A 1YXIA 1LEVA 2R8TA 4GBVA 2OX3A 5ESYA 1NUWA 1QGXA 1FBEA 3B8BA 1FPIA 2Y5LA 1FBCA 1NV6A 4PTKA 5IZ1A 2QVVA 2P3NA 1EYJA 4QXDA 1NV5A 4GWUA 1FRPA 1CNQA 3D1RA 5ET5A 4G61A 3BIHA 1FBFA 5ET6A 4O7IA 1FBHA 3RYDA 3RPLA 3KC1A 3T0JA 1G0IA 1FBGA 1FPKA 1FTAA 4HE1A 5IZ3B 1IMFA 5I3SA 1FPJA 2Q74A 1NV0A 4HE2A 2CZHA 5IZ3A 1FPEA 1KA0A 5ET7A 2FHYA 1IMBA 4KXPA 3ROJA 1NV2A 1DCUA 5F24A 3LUZA 4GBWA 4MJOA 1JP4A 1K9ZA 2DDKA 1NV3A 3KBZA 1YZ0A 4GWXA 1NI9A 4H45A 4H46A 1LBWA 4GWSA 1EYKA 5LDZA 1BK4A 1IMCA 1RDXA 2F3BA 3IFCA 5EQ7A 3LV0A 2P3VA 1IMDA 1RDYA 4GWWA 4HE0A 4AS4A 5DW8A 4I3EA 2JJKA 1FBDA 4I40A 3BIGA 1LBZA 1YYZA 1KZ8A 1NUYA 2FIEA 2FVZA 4HXVA 4AS5A 2OWZA 1VDWA
chains in the Genus database with same CATH superfamily
4NG7A 2XXPA 3AXFA 2YPNA 3EF7A 4R2BA 4KFQA 5K2YA 1MQIA 1YTVA 2DWIA 1A55A 3EQ1A 2A5TB 3DM0A 4KI0E 5IZZA 3R6UA 3VV5A 4GX3A 4F3SA 4U21A 4QRZA 4F22A 1QW0A 3G3GA 2CZIA 1SVXB 2VT5A 4UABA 3FJ7A 4ZZEA 2VPNA 5I7IA 3PUWE 2RKMA 1IUDA 3K2DA 4OERA 2XXIA 4NF8A 5AA1A 3TPAA 5AA4A 4IO3A 3KEIA 2F8DA 4EUOA 1N76A 4F1VA 5AE4A 3M3FA 4OEUA 1DTGA 5KZTA 1NV5A 4N6DA 2ZYNA 5ET5A 4R9FA 3M3KA 3ISPA 1Q35A 3SESA 1D3KA 1B1XA 3RT8A 1Y3NA 3VXBA 2Q74A 1NV0A 2Y7IA 1FPEA 1QUJA 3BBRA 5ET7A 1QVSA 4L17A 2FHYA 1LAGE 2OCUA 4IY5A 2F78A 1UTBB 5LOMA 3EHSA 4OQOA 2I58A 2DQVA 3KBZA 4F29A 3M8UA 2PX1A 4PGNA 4MNCA 2FNCA 4QHQA 2PYYA 3C33A 5DEXA 1URGA 3VVDA 4JWYA 3U72A 3LR1A 4GX4A 4G68A 3RPLB 5BWJA 5ITPA 2DS9A 2QVUA 4R9GA 4RXLA 3PUZE 2I0BA 5H8NB 3H6TA 3MZBA 5FTIA 1WODA 3Q28A 2ZYKA 4G2ZA 3MZ9A 5KCJA 2R6GE 4YB7A 1MQGA 2QMWA 3OOAA 4P11A 4LATA 2E1SA 4NTLA 4X1BA 1P1NA 1B3HA 4M4GA 1NUXA 3U65A 2QMXA 3RPWA 3T9XB 3L6GA 5AA3A 3Q26A 3O28A 1FPDA 3TQWA 4Q8RA 1US5A 1FBEA 3OXNA 4X8RA 4E0WA 3OSRA 3EPEA 2GH9A 4KPTA 4GWOA 5IM2A 3OENA 1M5FA 1IXGA 1GTKA 3HO7A 1SYHA 4NN3A 3GBAA 4HE1A 4MMPA 4O3CA 3TUSA 3EKIA 2GRVA 4WKMA 4QBAA 2VD2A 3FXUA 4YB5A 5TP9B 4KXPA 3ROJA 4BDMA 1II5A 4GBWA 3K6VA 3CR9A 3H3GA 1OLAA 4I1DA 4LONB 4F3PA 4XKPA 1I6BA 2F3BA 3NOHA 2OJTA 4X9TA 2X7PA 4DCXA 1A99A 1FBDA 1IXIA 3EN3A 2FIEA 3TCHA 4HXVA 4MHFA 4U1OA 3FVNA 2XXWA 4EXKA 3TAJA 3TTKA 4HTGA 4MAGA 3TDJA 4PP0A 4PQJA 2QFLA 1JETA 5H8FA 5J16A 1MS7A 5CI5A 2BJIA 1EYIA 4YMBA 4QFNA 1K9YA 2CZKA 4O3BA 5I5PA 2F6PA 3RUMA 3ILUB 4LQ5A 3KZGA 2IA4A 5K2XA 1DOTA 1JW1A 3UK4A 3PMXA 4XKNA 1FPBA 3CI8A 5L9SA 1GGGA 4FBPA 4R6KA 3QYTA 1LFGA 3K02A 5H8FB 2W7YA 3N6UA 5CMCA 4R75A 2F36A 4NF6A 4GBVA 1RYOA 1N04A 1NMUA 3CSBA 4E0XA 2Q2CA 2O7UA 2XWIA 4DI4B 3IOTA 4GL0A 2ZYOA 2P3NA 1TFAA 3BFUA 2DWHA 4OHNA 1CE2A 1USYH 1OMPA 3D4GA 1QULA 1LAFE 1IMFA 2XXVA 5BUUA 3VDFA 5I2KB 4NQ8A 3FD3A 5I58A 4FECA 4GXSB 4U4SA 1B6HA 1YZ0A 3KGCA 3LSXA 2M8CA 4DDDA 2I49A 1T0KA 1BK4A 3MC2A 1JVXA 4YKJA 2F34A 2F5XA 3PGFA 4QFKA 2V3QA 2ZNUA 5B70A 4ZE9A 4H0WA 4ZS9A 2BJJX 3CG3A 2AL4A 2DE4A 4OENA 3PTYA 3A29A 3QSLA 4GFRA 4G77A 1US4A 1H3DA 1MH4A 4I8CA 3USDA 1A8EA 1PEBA 2QS2A 5FTHA 4UACA 5ICQA 4H67A 4U2RA 5CM6A 1IMEA 4NEDA 1B4ZA 3QIMA 4RNSA 2XXYA 3U92A 3K01A 4ZEKA 2Q88A 1N7WA 1AL3A 5HM4B 4F3GA 2GQ1A 5ISUA 3N5LA 2HAUA 4N8GA 3FATA 1FSAA 4KD5A 4DCYA 1TXFA 5I56B 3TMGA 2OWSA 2B65A 3MPKA 1P1OA 3RTFB 3ZKKA 4QXDA 1FRPA 1R9QA 4POXA 3TZAA 1MY4A 3MWBA 5EHMA 4BDNA 1FBGA 3I5OA 2RC8A 2VPOA 1OQGA 4NF0A 1XC1A 2HFBA 4MLVA 1FQCA 1OLCA 3BFTA 2ONKE 4G8HA 3S9LC 4IY6A 2P1SA 3E13X 4OEVA 4YMAA 5ELVA 4BDLA 4NGUA 4JVDA 5KCJB 2B4LA 1LBZA 2XXKA 1KZ8A 1BTJA 4G8NA 3FVKA 1Q9DA 4JVCA 4HCWA 1B5HA 4GL8A 3SEYA 4P1LA 1LBVA 3OO7A 5HBCA 1B5IA 2NWJA 3KC0A 3TTLA 3EHUA 1D4NA 2HAVA 2QPQA 1FTLA 3KFMA 3FASA 4ELRA 4OANA 4QSEA 4AB5A 1AH5A 3HN0A 4HW8A 1IMAA 4IO4A 3IFAA 1B7UA 2VGQA 3A3CA 4FJPA 5EQ8A 4DXCA 1NNFA 4IR8A 4I3YA 3MUQA 2PCRA 3K6WA 3RTWB 5FHNA 5ESYA 1I6QA 3FGSA 3E3KA 4MBPA 2O68A 2PBWA 5ET6A 4C1UA 4X1DA 2Y7KA 4G68C 1FTAA 1SDXA 4N07A 4R2FA 5I3SA 4HE2A 1NFTA 4PFTA 3CHGA 4XKQA 1IEJA 1PB9A 2NOOA 4MJOA 2YJPA 3C32A 1LFHA 5CMKA 2F6GA 1M5DA 4GWSA 4RK9A 1IMCA 4QFOA 1BLFA 4KQPA 5DEXB 1EZPA 3KN7A 3DP6A 3KG2A 3K0VA 5I59B 4AS5A 4ELPA 2OZZA 5CRYA 1MDQA 3MYUA 1AOVA 4IO7A 4TOZA 1MG1A 1Y9UA 1LBYA 3KN8A 2VD3A 3B6TA 4XEQA 1Q1KA 4YKPA 2HQ0A 3C4MA 2Y7PA 2RC9A 1LBCA 4NF6B 3MBPA 4EQBA 4TLLB 2R71A 3T1BA 3OO6A 4O7MA 2THIA 3VLVA 5FHOA 3G3IA 2AIXA 2KLFA 1LFIA 3HHGA 4IB2A 3G7WA 1FPFA 1DPPA 2WBBA 3FJGA 4PFWA 3KOTA 1D9VA 3QUFA 1B1HA 4PTKA 3RNNA 1O63A 4PAFA 1SW1A 3VXCA 4XF5A 4O3AA 2Z23A 4O7IA 3JV9A 4K3FA 5I84A 2XWOA 1MH3A 3L6HA 1FPJA 5IZ3A 4R6YA 1Z7ME 4DXUA 4Z7EA 2I48A 2XWVA 4AQ4A 3LUZA 2I0CA 4GIZA 4KHZE 2OK2A 2XXHA 1F9BA 4RYAA 1ZU0A 2HZLA 1EYKA 4GXAA 4GQOA 1LB8A 1MY2A 4GWWA 4ZDMA 3ZSFA 4I3EA 2JJKA 1BKAA 4EQ9A 4F19A 1RYXA 3QK6A 1Y3PA 3WAFA 1EH3A 2OWZA 3A09A 4OA4A 2RCAA 1Y3QA 4XFEA 4ECFA 1MY3A 3G3HA 4ISUA 2Q8JA 4YAHX 3TQLA 2P0SA 4JWOA 4PDDA 1SPIA 5L8DA 5L9MA 2I4BA 3IJXB 3KJTA 2OWTA 4U1ZA 5I56A 2DYXA 4ELQA 5EYHA 4ZEDA 4KCDA 4GVOA 4MLQA 1MPBA 2UYEA 4WXJA 3B6QA 2L5VA 4G8MA 3TTNA 4F39A 1B46A 1DPEA 4LN5A 3C35A 1AIVA 3K00A 1XVXA 2O1MA 2XX7A 2NVUB 4H65A 1VFEA 2UXAA 1EZOA 4YKKA 5DYHA 4JDFA 4PETA 4R72A 1WVJA 4PAIA 2ONRA 2ZMBA 3GZGA 5KDTB 1B5JA 3UORA 4LZ8A 1AMFA 1B4HA 3HPIA 3KC1A 4UA8A 4F1YA 2REGA 2V25A 2PFYA 1JQFA 4EF2A 4JSOA 4F31B 2XWKA 4PFUA 5I58B 2ABHA 3CIJA 5LTCA 3TKDA 5AA2A 1LSTA 4QF9A 2Z22A 1RKMA 1FTOA 3R26A 1OIBA 4DLDA 4JWXA 4NF8B 3UP9A 2Y84A 3V5AA 4DIGA 1TWYA 4RA1A 4YICA 4JSDA 3LBSA 1UQWA 4R6HA 2O84X 1FW0A 3O29A 3KN3A 3IL1B 2D21A 3SEWA 5CMBA 1VDWA 5DVFA 1NNKA 5AA2B 1FQFA 1PB8A 2OPEA 5I2NA 1FQAA 4N6KA 1UTBA 2HHMA 1Y1MA 1B58A 1S7YA 2RC7A 3ONMA 4NF5B 5F7VA 1PB7A 5T3JA 2LAOA 4XKRA 1B52A 3LSFB 3U94A 5EQ9A 4DXBA 1NV4A 4HCYA 2ZZVA 3PPOA 4H8IA 1JVYA 3Q27A 2Q2AA 2V93A 1FPGA 3QXMA 5L9OA 3U93A 4G68B 2NXOA 2PFZA 1PBQA 1FBCA 2ZNTA 4ONYA 1FTJA 1MPDA 5H8NA 1CNQA 4F1UA 3BIHA 3RYDA 1A54A 2UVJA 1SI1A 3Q25A 1B3FA 3MVXA 1N7XA 2DWAA 1IXHA 4PBHA 1O64A 3U1OA 4GD5A 5H8QB 5JK4A 4HS7A 5I59A 3T9UA 2DDKA 4N6PA 1MQHA 4H45A 3G3KA 4XIGQ 3OSQA 5ITOA 1ATGA 4N4UA 3ZS6A 5TPAA 4OVQA 3TYHA 2H25A 1FTMA 4DZ1A 3CRBA 2FVZA 3PPRA 4PAKA 4NWCA 5EQAA 4U4XA 1O7TA 4GWZA 2VOZA 1IQ7A 3EHTA 4OESA 1FCKA 4H5FA 1FPLA 1LCTA 3PV0E 1N84A 1TT1A 1NH7A 4FATA 4AB6A 2FIXA 3T9HB 4GX6A 4H6DA 1HSEA 1KA1A 2F7CA 3IB2A 4H5GA 1ZBMA 1B05A 4N13A 4PFBA 4XXUA 2R8TA 3MVZA 2Y5LA 1MQDA 2DXRA 3OEKA 3PU5A 5M2VA 1LAHE 3MPLA 5JTYA 4JXIA 3MAMA 1PC3A 1B3EA 3K4UA 4OZ9A 3G3JA 4IO5A 1SW2A 1FBHA 4PC9A 5B7DA 3V8XB 1OVBA 3DELB 4NWDA 2CZHA 3GYYA 1MXXA 1N3XA 1DCUA 2DWJA 3N6TA 4M1VA 1M5CA 1K9ZA 1MXYA 4IO6A 3MW0A 2ZYMA 1JW4A 2XHDA 4PGPA 3FXQA 4ESXA 3MJNA 1RDXA 5JTYB 1Z7NE 1VE4A 2P3VA 2O1LA 2H9BA 1USYE 4I40A 3IORA 1ZLQA 3Q29A 2X7QA 2DP8A 3CFZA 1JEVA 4PCDA 3O6HA 4PFRA 2QL3A 3VLWA 2H99A 3H6WA 3K1NA 4NF4B 4N81A 3MSTA 1UIVA 2WKYA 4ZZAA 4ELOA 4ESWA 4FORA 3OMBA 1HSJA 1LAXA 3SEVA 2FBPA 3H4ZA 3MVWA 1FJ9A 2WYPA 2F97A 1AWBA 3CFLA 2Q8MA 3S4UA 5KDTA 5J1DA 3ECRA 2E0SA 3W9WA 2ALUA 2F3DA 1URSA 1PDAA 2P2AA 3K6XA 1YXIA 1B3GA 2XD3A 2OX3A 3TODA 3B8BA 1FPIA 3KSXA 1IIWA 1FQBA 3PPPA 4WEPA 1MY0A 4C1TA 2DSFA 5H8HA 2YLNA 2VP1A 4MIJA 3CVGA 4MCOA 3T0JA 4LVQA 5FHMA 1GR2A 5IZ3B 4U22A 1ZMGA 1FTKA 3V83A 3VFJA 3T22A 3W15C 1IMBA 2DXYA 2CEYA 3HV1A 4N91A 2XXRA 3SDFA 3TELA 1VSOA 1MXWA 1TFDA 3MP8A 4P1EA 2QRYA 3IJOB 4AS4A 4OWDA 1POY1 2CZLA 4FE8A 3FVOA 1BIYA 3T96B 4LP2B 1QKBA 4ND9A 4PFIA 1FQEA 2WEFA 3QAXA 3IB0A 1Y4TA 1NL5A 4NF5A 4JB7A 3PMWA 1DMBA 4IO2A 1H45A 3GBBA 2IEEA 4ZEBA 1DBZA 1INPA 3JZJA 3E79A 4OYVA 4N17A 4P47A 2DE3A 3B50A 3GXAA 3RT6B 3RGYA 3FBPA 1POTA 1Y1ZA 2XXXA 4N8YA 4PF6A 4NHBA 4R73A 1SBPA 3FVGA 2HXWA 3FIRA 4PBQA 1P99A 4FEBA 4OXVA 1LGBC 2DVCA 3P7IA 2XXTA 4TQUQ 3C9HA 2I3VA 3PD8A 3MVYA 1EYJA 1LLSA 2I6EA 3I6VA 3LC8A 3U8QA 2X26A 3O66A 4LZ7A 5H8QA 2OBGA 3DLNA 4YZZA 3RPLA 4Q30B 2VHAA 1P1UA 1KA0A 1N3WA 3OEMA 5CBRA 1I69A 3S9NC 2QJEA 2DOJA 2FA7A 3BKIB 1S50A 3C31A 4LQ2A 5EHSA 2QS4A 5EQ7A 1PBPA 4H1XA 4P3LA 4BDQA 5F1QA 5DW8A 1URDA 4FEDA 5HPQA 1B40A 1Y20A 3I3VA 1MPCA 3H06B 1BP5A 4ZE8A 1P1WA 3C34A 3UIFA 2WBDA 4IGTA 5I2NB 1M5EA 4KYSA 1XI6A 4MF3A 2B3FA 4XTCQ 2XXUA 1DK4A 2UVGA 2F35A 1SYIA 4ZECA 2ANJA 4Q5TA 4GWYA 1B0LA 2D3IA 1YAEA 5TP9A 4KCCA 1N0TA 2HCAA 2XX8A 1H44A 4BLAA 1H76A 3SETA 3UN6A 3OELA 3CFXA 3UGWA 1MY1A 3H6UA 1NV7A 3IAZA 3V89B 3RLFE 3TTMA 3MP6A 1UTHA 4NX1A 1NV6A 1A40A 4EDPA 4G61A 3FJMA 4RJZA 1DSNA 4OFLA 2OLBA 4PF8A 2H4IA 2O7IA 3PPNA 3N26A 1XVYA 1SD3A 4G4PA 2QS3A 4MNPA 3HHFA 3IOUA 1DTZA 2ZZXA 5IKBA 1JW5A 3PUYE 3S2VA 3LSWA 2HEUA 1B2HA 4U23A 4GWXA 1UTHB 1KWHA 1FQDA 3HCQA 2ZXTA 3SEUA 1A7LA 4OVTA 3KBRA 1IMDA 3B7DA 5H8SA 3O97A 3S9EA 1MM7A 3RN8A 1L5TA 2FYIA 4C0RA 2QSXA 3T9VA 1ANFA 4OFJA 3UA8A 2KQZA 3VE1B 3E4RA 1XS5A 4MH5A 2DVZA 1ZJLA 3T66A 1NUZA 3G3FA 5I2KA 2O51A 1D9QA 3KJ7A 4RK2A 3OD7A 4NAPA 4OFOA 4MX6A 3ODBA 1G0HA 3T93B 1NNPA 2GHAA 1B51A 1EZ9A 4RY1A 2XXQA 5I57B 4OMBA 5AA4B 4P9KA 4OTEA 1B3LA 3PPQA 3FXRA 3H6VA 1Y4CA 3SKPA 3D1RA 1OQHA 2V3UA 2HXRA 1FBFA 3IK6B 3O6GA 3GLBA 2GFEA 1SI0A 4P8BA 3E78A 2UVHA 4POWA 2B4MA 2G29A 5CMMA 2Z8FA 2ESNA 3SERA 5F24A 4F2OA 4QSDA 1YCJA 3M3LA 1B7HA 1IITA 2AYSA 3FUZA 3B6WA 3K6UA 2CMOA 2DE2A 1JNFA 3CG1A 1P1QA 4P0IA 4IGRA 1B32A 1R9LA 1NUYA 4F3BA 1ZTYA 3LSLA 4FIMA 4DI3D 5DTBA 2XX9A 3IO6A 3QUJA 1LCFA 1H43A 3ILTB 1SW4A 2I3WA 5A5LA 1VFDA 1B0HA 3OO9A 3CSGA 2V4CA 2H5YA 4X48A 2UVIA 5A5XB 1LBBA 3FV2A 4RPNA 5IGAA 4EXLA 1YPNA 2A5TA 2PT2A 3W9VA 4ZEIA 2PMSA 1LEVA 5EYFA 2A5SA 1NUWA 1QGXA 2MKZA 3TCGA 1CB6A 4TLMB 2XA5A 1B7ZA 4F2QA 2QVVA 1I6AA 4GWUA 3E9XA 1WDNA 1XOCA 4OVSA 2Z8EA 4PDHA 1EU8A 3SZPA 5A5XA 3TTRA 2CEXA 1IZ1A 1M5BA 3THIA 1MXZA 4NMYA 2REJA 1NKXA 3IB1A 2F7BA 1VR5A 4Z0IA 1JP4A 4EQ7A 3FV1A 4YU0A 1NI9A 4MEVA 2AL5A 2OPDA 5LDZA 1QJMA 3VVFA 1MM6A 3HSTA 3MQ9A 1HSLA 2RCBA 1A8FA 3N94A 3HFUA 3OO8A 4KR5A 1ZKBA 1XT8A 1GVCA 4I62A 3BIGA 1YYZA 5CBSA 4N15A 1NNTA 5AA2D 3SEXA 3DP8A 1R6ZA 5JEIA 1S9TA 3O2AA 1RDZA 5ET8A 3PMVA 1R1NA 2Y5KA 4R74A 5FBPA 1QUIA 3FXBA 1UIUA 5TU0A 1OVTA 1MDP1 1SQYA 1QKAA 2KR0A 1LBXA 3O9PA 3TCFA 1NV1A 2ONSA 3VVEA 4OVPA 2R9JA 3D4CA 2G93A 5TPAB 3TFLA 4KYEA 5EYGA 3R7XA 1IXCA 1ELJA 2RF1A 4ZEFA 4FAJA 2D5WA 2PVUA 3LUYA 2V3TA 4JBZA 4PE5B 1ZIUA 2H98A 1JEUA 3IX1A 2WX9A 3DP4A 2I4CA 4GF8A 4PE3A 3MZ1A 4MNIA 2Q89A 3WAEA 2HPGA 3KOSA 1MXUA 3O6IA 5DT6A 1NV2A 2HZKA 2UYFA 3RY3A 4GOTA 5CC2A 1LBWA 2GHBA 3H7MA 5DVJA 1NH8A 4OVJA 4O94A 3K1PA 3LV0A 4HE0A 2NUVA 4OETA 4F18A 4BDOA 4H8JA 4MFIA 3A3UA 4P0GA 3H03A 1MRPA 1GV8A 3QMFA 2Z8DA 3RQTA 1XHYA 2ZZWA 4PFYA 2QVRA 2F7AA 2V84A 4LA9A 4QFLA 3ZKLA 4OVRA 5ICTA 5I57A 4BDRA 4LUBA 3IR1A 3TEPA 4Q0CA 4NE4A 3IO4A 1SW5A 2XD2A 3PUXE 1FBPA 3IOVA 4YB6A 3VLUA 4GLIA 1FJ6A 2B3BA 3C36A 2RINA 1LB9A 1D9YA 4GRKA 1QUKA 4EF1A 4O8MA 5IZ1A 4THIA 4NF4A 2Q9TA 5DVIA 3F11A 4RPOA 3KSJA 3JYRA 3K1MA 1J1NA 2PT1A 1G0IA 1FPKA 1MQJA 3PUVE 5IAIA 4JVIA 4X04A 2WYKA 3FZVA 4QSCA 4P56A 2O69A 3PD9A 4I9DA 1NV3A 3MP1A 4QFPA 1B9JA 4H46A 4DE8A 1MXVA 2ZNSA 3IFCA 2Y7WA 1RDYA 4WEDA 3S9MC 4YKIA 2QS1A 4LZ5A 4KYDA 2O6AA 3IOWA 5H8HB 2Y7RA
chains in the Genus database with same CATH topology
4GX4A 4NG7A 4PFIA 2WEFA 3RPLB 1Q9DA 4MAGA 4XFEA 4JVCA 5EQAA 4HCWA 2QFLA 4PCDA 4DI3D 2QVUA 3MYUA 3QMFA 2DE4A 4GWZA 1LBVA 3PTYA 4P1LA 4PFRA 1RDZA 2WBDA 3A29A 5J16A 2KQZA 1XI6A 1LBYA 2BJIA 4PDDA 1SPIA 5ET8A 3KC0A 2ZZWA 4N81A 1EYIA 5A5LA 3MSTA 1DBZA 1INPA 1DK4A 1FPLA 3E79A 4N6KA 2Y5KA 4XEQA 4N17A 5FBPA 2QPQA 4P47A 2DE3A 5IZZA 1K9YA 2QVRA 2HHMA 3B50A 2CZKA 2DVZA 3FXBA 4GX3A 2V4CA 2FBPA 4OANA 5I5PA 4OVRA 3FBPA 5CM6A 1FJ9A 2KR0A 2CZIA 1LBXA 2WYPA 4N8YA 1NV1A 4PF6A 1AWBA 1IMAA 1IMEA 2FIXA 1NUZA 4GX6A 2VT5A 4GWYA 5EYHA 5T3JA 4NHBA 4UABA 3T1BA 3IFAA 4O7MA 1D9QA 2Q8MA 2VPNA 4OVPA 5I7IA 5J1DA 1FPBA 1NUXA 2L5VA 4NAPA 5EQ9A 1KA1A 4FBPA 4MX6A 4PBQA 3U65A 5IGAA 5EQ8A 2GQ1A 1NV4A 1G0HA 4HCYA 3W9WA 2ZZVA 5EYGA 1FBPA 2F3DA 4LN5A 3W9VA 1FPFA 2WBBA 4N8GA 4IR8A 4I3YA 1FJ6A 1FSAA 1FPDA 4PFBA 2PCRA 1FPGA 1NV7A 1YXIA 1LEVA 2R8TA 4GBVA 2OX3A 5ESYA 1NUWA 1QGXA 1FBEA 3B8BA 2PFZA 4X8RA 2MKZA 4PETA 1FPIA 2Y5LA 1FBCA 4P9KA 4DI4B 2XWIA 4NX1A 4PAIA 2XA5A 4O8MA 4F1VA 1NV6A 4PTKA 5IZ1A 2QVVA 2P3NA 1EYJA 5IM2A 4QXDA 1NV5A 4GWUA 4N6DA 1FRPA 1CNQA 3D1RA 5ET5A 2Q9TA 4PAFA 4OVSA 4F1UA 2HXRA 4XF5A 4G61A 4MNIA 3BIHA 1FBFA 2WX9A 5ET6A 4O7IA 1FBHA 3ISPA 4PC9A 3RYDA 3RPLA 3KC1A 4MIJA 4PF8A 4PDHA 4YZZA 3SZPA 2XWOA 2CEXA 4PE3A 4MCOA 3T0JA 4NN3A 1G0IA 1FBGA 1FPKA 1FTAA 4HE1A 4MMPA 5IZ3B 1IMFA 5I3SA 4MNPA 2VPOA 1FPJA 2PFYA 3EKIA 4P8BA 2Q74A 1NV0A 3E78A 4HE2A 2CZHA 5IZ3A 2ZZXA 1FPEA 4QBAA 1KA0A 4JVIA 2B4MA 2XWKA 2HPGA 3GYYA 4NF0A 5ET7A 3CHGA 2XWVA 4NQ8A 2FHYA 1IMBA 4X04A 5LTCA 4KXPA 3ROJA 2WYKA 4PBHA 4P56A 1NV2A 1DCUA 2CEYA 2HZKA 5F24A 5JK4A 4M1VA 3LUZA 4GBWA 4MJOA 4N91A 1JP4A 1K9ZA 2DDKA 1NV3A 3KBZA 1YZ0A 4GWXA 1NI9A 4MEVA 4H45A 4PGPA 4H46A 2HZLA 4P3LA 1LBWA 4GWSA 1EYKA 5LDZA 1BK4A 4PGNA 1IMCA 4MNCA 4P1EA 1RDXA 2F3BA 3NOHA 4X9TA 3IFCA 4N4UA 4YICA 2F5XA 4OVTA 5EQ7A 2DE2A 3LV0A 2P3VA 4O94A 1IMDA 1RDYA 4GWWA 4NGUA 4HE0A 4AS4A 3HFUA 4OVQA 5DW8A 2V3QA 4JVDA 4F18A 4I3EA 2JJKA 1FBDA 4I40A 2B4LA 4F19A 3BIGA 1LBZA 2XXKA 1YYZA 1KZ8A 1NUYA 2FIEA 2FVZA 4HXVA 4MHFA 4N15A 4PAKA 4AS5A 2OWZA 4OA4A 1VDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GX4 A;  2WEF A;  3RPL B;  1Q9D A;  5EQA A;  2QFL A;  2QVU A;  3QMF A;  4GWZ A;  1LBV A;  1RDZ A;  2WBD A;  3A29 A;  5J16 A;  1XI6 A;  1LBY A;  2BJI A;  1SPI A;  5ET8 A;  3KC0 A;  4N81 A;  1EYI A;  5A5L A;  1DBZ A;  1INP A;  1DK4 A;  1FPL A;  2Y5K A;  5FBP A;  1K9Y A;  2QVR A;  2HHM A;  2CZK A;  4GX3 A;  2FBP A;  3FBP A;  1FJ9 A;  2CZI A;  1LBX A;  1NV1 A;  1AWB A;  1IMA A;  1IME A;  2FIX A;  1NUZ A;  4GX6 A;  2VT5 A;  4GWY A;  5EYH A;  5T3J A;  3IFA A;  1D9Q A;  2Q8M A;  1FPB A;  1NUX A;  5EQ9 A;  1KA1 A;  4FBP A;  5EQ8 A;  2GQ1 A;  1NV4 A;  1G0H A;  5EYG A;  1FBP A;  2F3D A;  1FPF A;  2WBB A;  4IR8 A;  4I3Y A;  1FJ6 A;  1FSA A;  1FPD A;  2PCR A;  1FPG A;  1NV7 A;  1YXI A;  1LEV A;  2R8T A;  4GBV A;  2OX3 A;  5ESY A;  1NUW A;  1QGX A;  1FBE A;  3B8B A;  1FPI A;  2Y5L A;  1FBC A;  1NV6 A;  4PTK A;  5IZ1 A;  2QVV A;  2P3N A;  1EYJ A;  4QXD A;  1NV5 A;  4GWU A;  1FRP A;  1CNQ A;  3D1R A;  5ET5 A;  4G61 A;  3BIH A;  1FBF A;  5ET6 A;  4O7I A;  1FBH A;  3RYD A;  3RPL A;  3KC1 A;  3T0J A;  1G0I A;  1FBG A;  1FPK A;  1FTA A;  4HE1 A;  5IZ3 B;  1IMF A;  5I3S A;  1FPJ A;  2Q74 A;  1NV0 A;  4HE2 A;  2CZH A;  5IZ3 A;  1FPE A;  1KA0 A;  5ET7 A;  2FHY A;  1IMB A;  4KXP A;  3ROJ A;  1NV2 A;  1DCU A;  5F24 A;  3LUZ A;  4GBW A;  4MJO A;  1JP4 A;  1K9Z A;  2DDK A;  1NV3 A;  3KBZ A;  1YZ0 A;  4GWX A;  1NI9 A;  4H45 A;  4H46 A;  1LBW A;  4GWS A;  1EYK A;  5LDZ A;  1BK4 A;  1IMC A;  1RDX A;  2F3B A;  3IFC A;  5EQ7 A;  3LV0 A;  2P3V A;  1IMD A;  1RDY A;  4GWW A;  4HE0 A;  4AS4 A;  5DW8 A;  4I3E A;  2JJK A;  1FBD A;  4I40 A;  3BIG A;  1LBZ A;  1YYZ A;  1KZ8 A;  1NUY A;  2FIE A;  2FVZ A;  4HXV A;  4AS5 A;  2OWZ A;  1VDW A; 
#chains in the Genus database with same CATH topology
 4NG7 A;  2XXP A;  3AXF A;  2YPN A;  3EF7 A;  4R2B A;  4KFQ A;  5K2Y A;  1MQI A;  1YTV A;  2DWI A;  1A55 A;  3EQ1 A;  2A5T B;  3DM0 A;  4KI0 E;  5IZZ A;  3R6U A;  3VV5 A;  4GX3 A;  4F3S A;  4U21 A;  4QRZ A;  4F22 A;  1QW0 A;  3G3G A;  2CZI A;  1SVX B;  2VT5 A;  4UAB A;  3FJ7 A;  4ZZE A;  2VPN A;  5I7I A;  3PUW E;  2RKM A;  1IUD A;  3K2D A;  4OER A;  2XXI A;  4NF8 A;  5AA1 A;  3TPA A;  5AA4 A;  4IO3 A;  3KEI A;  2F8D A;  4EUO A;  1N76 A;  4F1V A;  5AE4 A;  3M3F A;  4OEU A;  1DTG A;  5KZT A;  1NV5 A;  4N6D A;  2ZYN A;  5ET5 A;  4R9F A;  3M3K A;  3ISP A;  1Q35 A;  3SES A;  1D3K A;  1B1X A;  3RT8 A;  1Y3N A;  3VXB A;  2Q74 A;  1NV0 A;  2Y7I A;  1FPE A;  1QUJ A;  3BBR A;  5ET7 A;  1QVS A;  4L17 A;  2FHY A;  1LAG E;  2OCU A;  4IY5 A;  2F78 A;  1UTB B;  5LOM A;  3EHS A;  4OQO A;  2I58 A;  2DQV A;  3KBZ A;  4F29 A;  3M8U A;  2PX1 A;  4PGN A;  4MNC A;  2FNC A;  4QHQ A;  2PYY A;  3C33 A;  5DEX A;  1URG A;  3VVD A;  4JWY A;  3U72 A;  3LR1 A;  4GX4 A;  4G68 A;  3RPL B;  5BWJ A;  5ITP A;  2DS9 A;  2QVU A;  4R9G A;  4RXL A;  3PUZ E;  2I0B A;  5H8N B;  3H6T A;  3MZB A;  5FTI A;  1WOD A;  3Q28 A;  2ZYK A;  4G2Z A;  3MZ9 A;  5KCJ A;  2R6G E;  4YB7 A;  1MQG A;  2QMW A;  3OOA A;  4P11 A;  4LAT A;  2E1S A;  4NTL A;  4X1B A;  1P1N A;  1B3H A;  4M4G A;  1NUX A;  3U65 A;  2QMX A;  3RPW A;  3T9X B;  3L6G A;  5AA3 A;  3Q26 A;  3O28 A;  1FPD A;  3TQW A;  4Q8R A;  1US5 A;  1FBE A;  3OXN A;  4X8R A;  4E0W A;  3OSR A;  3EPE A;  2GH9 A;  4KPT A;  4GWO A;  5IM2 A;  3OEN A;  1M5F A;  1IXG A;  1GTK A;  3HO7 A;  1SYH A;  4NN3 A;  3GBA A;  4HE1 A;  4MMP A;  4O3C A;  3TUS A;  3EKI A;  2GRV A;  4WKM A;  4QBA A;  2VD2 A;  3FXU A;  4YB5 A;  5TP9 B;  4KXP A;  3ROJ A;  4BDM A;  1II5 A;  4GBW A;  3K6V A;  3CR9 A;  3H3G A;  1OLA A;  4I1D A;  4LON B;  4F3P A;  4XKP A;  1I6B A;  2F3B A;  3NOH A;  2OJT A;  4X9T A;  2X7P A;  4DCX A;  1A99 A;  1FBD A;  1IXI A;  3EN3 A;  2FIE A;  3TCH A;  4HXV A;  4MHF A;  4U1O A;  3FVN A;  2XXW A;  4EXK A;  3TAJ A;  3TTK A;  4HTG A;  4MAG A;  3TDJ A;  4PP0 A;  4PQJ A;  2QFL A;  1JET A;  5H8F A;  5J16 A;  1MS7 A;  5CI5 A;  2BJI A;  1EYI A;  4YMB A;  4QFN A;  1K9Y A;  2CZK A;  4O3B A;  5I5P A;  2F6P A;  3RUM A;  3ILU B;  4LQ5 A;  3KZG A;  2IA4 A;  5K2X A;  1DOT A;  1JW1 A;  3UK4 A;  3PMX A;  4XKN A;  1FPB A;  3CI8 A;  5L9S A;  1GGG A;  4FBP A;  4R6K A;  3QYT A;  1LFG A;  3K02 A;  5H8F B;  2W7Y A;  3N6U A;  5CMC A;  4R75 A;  2F36 A;  4NF6 A;  4GBV A;  1RYO A;  1N04 A;  1NMU A;  3CSB A;  4E0X A;  2Q2C A;  2O7U A;  2XWI A;  4DI4 B;  3IOT A;  4GL0 A;  2ZYO A;  2P3N A;  1TFA A;  3BFU A;  2DWH A;  4OHN A;  1CE2 A;  1USY H;  1OMP A;  3D4G A;  1QUL A;  1LAF E;  1IMF A;  2XXV A;  5BUU A;  3VDF A;  5I2K B;  4NQ8 A;  3FD3 A;  5I58 A;  4FEC A;  4GXS B;  4U4S A;  1B6H A;  1YZ0 A;  3KGC A;  3LSX A;  2M8C A;  4DDD A;  2I49 A;  1T0K A;  1BK4 A;  3MC2 A;  1JVX A;  4YKJ A;  2F34 A;  2F5X A;  3PGF A;  4QFK A;  2V3Q A;  2ZNU A;  5B70 A;  4ZE9 A;  4H0W A;  4ZS9 A;  2BJJ X;  3CG3 A;  2AL4 A;  2DE4 A;  4OEN A;  3PTY A;  3A29 A;  3QSL A;  4GFR A;  4G77 A;  1US4 A;  1H3D A;  1MH4 A;  4I8C A;  3USD A;  1A8E A;  1PEB A;  2QS2 A;  5FTH A;  4UAC A;  5ICQ A;  4H67 A;  4U2R A;  5CM6 A;  1IME A;  4NED A;  1B4Z A;  3QIM A;  4RNS A;  2XXY A;  3U92 A;  3K01 A;  4ZEK A;  2Q88 A;  1N7W A;  1AL3 A;  5HM4 B;  4F3G A;  2GQ1 A;  5ISU A;  3N5L A;  2HAU A;  4N8G A;  3FAT A;  1FSA A;  4KD5 A;  4DCY A;  1TXF A;  5I56 B;  3TMG A;  2OWS A;  2B65 A;  3MPK A;  1P1O A;  3RTF B;  3ZKK A;  4QXD A;  1FRP A;  1R9Q A;  4POX A;  3TZA A;  1MY4 A;  3MWB A;  5EHM A;  4BDN A;  1FBG A;  3I5O A;  2RC8 A;  2VPO A;  1OQG A;  4NF0 A;  1XC1 A;  2HFB A;  4MLV A;  1FQC A;  1OLC A;  3BFT A;  2ONK E;  4G8H A;  3S9L C;  4IY6 A;  2P1S A;  3E13 X;  4OEV A;  4YMA A;  5ELV A;  4BDL A;  4NGU A;  4JVD A;  5KCJ B;  2B4L A;  1LBZ A;  2XXK A;  1KZ8 A;  1BTJ A;  4G8N A;  3FVK A;  1Q9D A;  4JVC A;  4HCW A;  1B5H A;  4GL8 A;  3SEY A;  4P1L A;  1LBV A;  3OO7 A;  5HBC A;  1B5I A;  2NWJ A;  3KC0 A;  3TTL A;  3EHU A;  1D4N A;  2HAV A;  2QPQ A;  1FTL A;  3KFM A;  3FAS A;  4ELR A;  4OAN A;  4QSE A;  4AB5 A;  1AH5 A;  3HN0 A;  4HW8 A;  1IMA A;  4IO4 A;  3IFA A;  1B7U A;  2VGQ A;  3A3C A;  4FJP A;  5EQ8 A;  4DXC A;  1NNF A;  4IR8 A;  4I3Y A;  3MUQ A;  2PCR A;  3K6W A;  3RTW B;  5FHN A;  5ESY A;  1I6Q A;  3FGS A;  3E3K A;  4MBP A;  2O68 A;  2PBW A;  5ET6 A;  4C1U A;  4X1D A;  2Y7K A;  4G68 C;  1FTA A;  1SDX A;  4N07 A;  4R2F A;  5I3S A;  4HE2 A;  1NFT A;  4PFT A;  3CHG A;  4XKQ A;  1IEJ A;  1PB9 A;  2NOO A;  4MJO A;  2YJP A;  3C32 A;  1LFH A;  5CMK A;  2F6G A;  1M5D A;  4GWS A;  4RK9 A;  1IMC A;  4QFO A;  1BLF A;  4KQP A;  5DEX B;  1EZP A;  3KN7 A;  3DP6 A;  3KG2 A;  3K0V A;  5I59 B;  4AS5 A;  4ELP A;  2OZZ A;  5CRY A;  1MDQ A;  3MYU A;  1AOV A;  4IO7 A;  4TOZ A;  1MG1 A;  1Y9U A;  1LBY A;  3KN8 A;  2VD3 A;  3B6T A;  4XEQ A;  1Q1K A;  4YKP A;  2HQ0 A;  3C4M A;  2Y7P A;  2RC9 A;  1LBC A;  4NF6 B;  3MBP A;  4EQB A;  4TLL B;  2R71 A;  3T1B A;  3OO6 A;  4O7M A;  2THI A;  3VLV A;  5FHO A;  3G3I A;  2AIX A;  2KLF A;  1LFI A;  3HHG A;  4IB2 A;  3G7W A;  1FPF A;  1DPP A;  2WBB A;  3FJG A;  4PFW A;  3KOT A;  1D9V A;  3QUF A;  1B1H A;  4PTK A;  3RNN A;  1O63 A;  4PAF A;  1SW1 A;  3VXC A;  4XF5 A;  4O3A A;  2Z23 A;  4O7I A;  3JV9 A;  4K3F A;  5I84 A;  2XWO A;  1MH3 A;  3L6H A;  1FPJ A;  5IZ3 A;  4R6Y A;  1Z7M E;  4DXU A;  4Z7E A;  2I48 A;  2XWV A;  4AQ4 A;  3LUZ A;  2I0C A;  4GIZ A;  4KHZ E;  2OK2 A;  2XXH A;  1F9B A;  4RYA A;  1ZU0 A;  2HZL A;  1EYK A;  4GXA A;  4GQO A;  1LB8 A;  1MY2 A;  4GWW A;  4ZDM A;  3ZSF A;  4I3E A;  2JJK A;  1BKA A;  4EQ9 A;  4F19 A;  1RYX A;  3QK6 A;  1Y3P A;  3WAF A;  1EH3 A;  2OWZ A;  3A09 A;  4OA4 A;  2RCA A;  1Y3Q A;  4XFE A;  4ECF A;  1MY3 A;  3G3H A;  4ISU A;  2Q8J A;  4YAH X;  3TQL A;  2P0S A;  4JWO A;  4PDD A;  1SPI A;  5L8D A;  5L9M A;  2I4B A;  3IJX B;  3KJT A;  2OWT A;  4U1Z A;  5I56 A;  2DYX A;  4ELQ A;  5EYH A;  4ZED A;  4KCD A;  4GVO A;  4MLQ A;  1MPB A;  2UYE A;  4WXJ A;  3B6Q A;  2L5V A;  4G8M A;  3TTN A;  4F39 A;  1B46 A;  1DPE A;  4LN5 A;  3C35 A;  1AIV A;  3K00 A;  1XVX A;  2O1M A;  2XX7 A;  2NVU B;  4H65 A;  1VFE A;  2UXA A;  1EZO A;  4YKK A;  5DYH A;  4JDF A;  4PET A;  4R72 A;  1WVJ A;  4PAI A;  2ONR A;  2ZMB A;  3GZG A;  5KDT B;  1B5J A;  3UOR A;  4LZ8 A;  1AMF A;  1B4H A;  3HPI A;  3KC1 A;  4UA8 A;  4F1Y A;  2REG A;  2V25 A;  2PFY A;  1JQF A;  4EF2 A;  4JSO A;  4F31 B;  2XWK A;  4PFU A;  5I58 B;  2ABH A;  3CIJ A;  5LTC A;  3TKD A;  5AA2 A;  1LST A;  4QF9 A;  2Z22 A;  1RKM A;  1FTO A;  3R26 A;  1OIB A;  4DLD A;  4JWX A;  4NF8 B;  3UP9 A;  2Y84 A;  3V5A A;  4DIG A;  1TWY A;  4RA1 A;  4YIC A;  4JSD A;  3LBS A;  1UQW A;  4R6H A;  2O84 X;  1FW0 A;  3O29 A;  3KN3 A;  3IL1 B;  2D21 A;  3SEW A;  5CMB A;  1VDW A;  5DVF A;  1NNK A;  5AA2 B;  1FQF A;  1PB8 A;  2OPE A;  5I2N A;  1FQA A;  4N6K A;  1UTB A;  2HHM A;  1Y1M A;  1B58 A;  1S7Y A;  2RC7 A;  3ONM A;  4NF5 B;  5F7V A;  1PB7 A;  5T3J A;  2LAO A;  4XKR A;  1B52 A;  3LSF B;  3U94 A;  5EQ9 A;  4DXB A;  1NV4 A;  4HCY A;  2ZZV A;  3PPO A;  4H8I A;  1JVY A;  3Q27 A;  2Q2A A;  2V93 A;  1FPG A;  3QXM A;  5L9O A;  3U93 A;  4G68 B;  2NXO A;  2PFZ A;  1PBQ A;  1FBC A;  2ZNT A;  4ONY A;  1FTJ A;  1MPD A;  5H8N A;  1CNQ A;  4F1U A;  3BIH A;  3RYD A;  1A54 A;  2UVJ A;  1SI1 A;  3Q25 A;  1B3F A;  3MVX A;  1N7X A;  2DWA A;  1IXH A;  4PBH A;  1O64 A;  3U1O A;  4GD5 A;  5H8Q B;  5JK4 A;  4HS7 A;  5I59 A;  3T9U A;  2DDK A;  4N6P A;  1MQH A;  4H45 A;  3G3K A;  4XIG Q;  3OSQ A;  5ITO A;  1ATG A;  4N4U A;  3ZS6 A;  5TPA A;  4OVQ A;  3TYH A;  2H25 A;  1FTM A;  4DZ1 A;  3CRB A;  2FVZ A;  3PPR A;  4PAK A;  4NWC A;  5EQA A;  4U4X A;  1O7T A;  4GWZ A;  2VOZ A;  1IQ7 A;  3EHT A;  4OES A;  1FCK A;  4H5F A;  1FPL A;  1LCT A;  3PV0 E;  1N84 A;  1TT1 A;  1NH7 A;  4FAT A;  4AB6 A;  2FIX A;  3T9H B;  4GX6 A;  4H6D A;  1HSE A;  1KA1 A;  2F7C A;  3IB2 A;  4H5G A;  1ZBM A;  1B05 A;  4N13 A;  4PFB A;  4XXU A;  2R8T A;  3MVZ A;  2Y5L A;  1MQD A;  2DXR A;  3OEK A;  3PU5 A;  5M2V A;  1LAH E;  3MPL A;  5JTY A;  4JXI A;  3MAM A;  1PC3 A;  1B3E A;  3K4U A;  4OZ9 A;  3G3J A;  4IO5 A;  1SW2 A;  1FBH A;  4PC9 A;  5B7D A;  3V8X B;  1OVB A;  3DEL B;  4NWD A;  2CZH A;  3GYY A;  1MXX A;  1N3X A;  1DCU A;  2DWJ A;  3N6T A;  4M1V A;  1M5C A;  1K9Z A;  1MXY A;  4IO6 A;  3MW0 A;  2ZYM A;  1JW4 A;  2XHD A;  4PGP A;  3FXQ A;  4ESX A;  3MJN A;  1RDX A;  5JTY B;  1Z7N E;  1VE4 A;  2P3V A;  2O1L A;  2H9B A;  1USY E;  4I40 A;  3IOR A;  1ZLQ A;  3Q29 A;  2X7Q A;  2DP8 A;  3CFZ A;  1JEV A;  4PCD A;  3O6H A;  4PFR A;  2QL3 A;  3VLW A;  2H99 A;  3H6W A;  3K1N A;  4NF4 B;  4N81 A;  3MST A;  1UIV A;  2WKY A;  4ZZA A;  4ELO A;  4ESW A;  4FOR A;  3OMB A;  1HSJ A;  1LAX A;  3SEV A;  2FBP A;  3H4Z A;  3MVW A;  1FJ9 A;  2WYP A;  2F97 A;  1AWB A;  3CFL A;  2Q8M A;  3S4U A;  5KDT A;  5J1D A;  3ECR A;  2E0S A;  3W9W A;  2ALU A;  2F3D A;  1URS A;  1PDA A;  2P2A A;  3K6X A;  1YXI A;  1B3G A;  2XD3 A;  2OX3 A;  3TOD A;  3B8B A;  1FPI A;  3KSX A;  1IIW A;  1FQB A;  3PPP A;  4WEP A;  1MY0 A;  4C1T A;  2DSF A;  5H8H A;  2YLN A;  2VP1 A;  4MIJ A;  3CVG A;  4MCO A;  3T0J A;  4LVQ A;  5FHM A;  1GR2 A;  5IZ3 B;  4U22 A;  1ZMG A;  1FTK A;  3V83 A;  3VFJ A;  3T22 A;  3W15 C;  1IMB A;  2DXY A;  2CEY A;  3HV1 A;  4N91 A;  2XXR A;  3SDF A;  3TEL A;  1VSO A;  1MXW A;  1TFD A;  3MP8 A;  4P1E A;  2QRY A;  3IJO B;  4AS4 A;  4OWD A;  1POY 1;  2CZL A;  4FE8 A;  3FVO A;  1BIY A;  3T96 B;  4LP2 B;  1QKB A;  4ND9 A;  4PFI A;  1FQE A;  2WEF A;  3QAX A;  3IB0 A;  1Y4T A;  1NL5 A;  4NF5 A;  4JB7 A;  3PMW A;  1DMB A;  4IO2 A;  1H45 A;  3GBB A;  2IEE A;  4ZEB A;  1DBZ A;  1INP A;  3JZJ A;  3E79 A;  4OYV A;  4N17 A;  4P47 A;  2DE3 A;  3B50 A;  3GXA A;  3RT6 B;  3RGY A;  3FBP A;  1POT A;  1Y1Z A;  2XXX A;  4N8Y A;  4PF6 A;  4NHB A;  4R73 A;  1SBP A;  3FVG A;  2HXW A;  3FIR A;  4PBQ A;  1P99 A;  4FEB A;  4OXV A;  1LGB C;  2DVC A;  3P7I A;  2XXT A;  4TQU Q;  3C9H A;  2I3V A;  3PD8 A;  3MVY A;  1EYJ A;  1LLS A;  2I6E A;  3I6V A;  3LC8 A;  3U8Q A;  2X26 A;  3O66 A;  4LZ7 A;  5H8Q A;  2OBG A;  3DLN A;  4YZZ A;  3RPL A;  4Q30 B;  2VHA A;  1P1U A;  1KA0 A;  1N3W A;  3OEM A;  5CBR A;  1I69 A;  3S9N C;  2QJE A;  2DOJ A;  2FA7 A;  3BKI B;  1S50 A;  3C31 A;  4LQ2 A;  5EHS A;  2QS4 A;  5EQ7 A;  1PBP A;  4H1X A;  4P3L A;  4BDQ A;  5F1Q A;  5DW8 A;  1URD A;  4FED A;  5HPQ A;  1B40 A;  1Y20 A;  3I3V A;  1MPC A;  3H06 B;  1BP5 A;  4ZE8 A;  1P1W A;  3C34 A;  3UIF A;  2WBD A;  4IGT A;  5I2N B;  1M5E A;  4KYS A;  1XI6 A;  4MF3 A;  2B3F A;  4XTC Q;  2XXU A;  1DK4 A;  2UVG A;  2F35 A;  1SYI A;  4ZEC A;  2ANJ A;  4Q5T A;  4GWY A;  1B0L A;  2D3I A;  1YAE A;  5TP9 A;  4KCC A;  1N0T A;  2HCA A;  2XX8 A;  1H44 A;  4BLA A;  1H76 A;  3SET A;  3UN6 A;  3OEL A;  3CFX A;  3UGW A;  1MY1 A;  3H6U A;  1NV7 A;  3IAZ A;  3V89 B;  3RLF E;  3TTM A;  3MP6 A;  1UTH A;  4NX1 A;  1NV6 A;  1A40 A;  4EDP A;  4G61 A;  3FJM A;  4RJZ A;  1DSN A;  4OFL A;  2OLB A;  4PF8 A;  2H4I A;  2O7I A;  3PPN A;  3N26 A;  1XVY A;  1SD3 A;  4G4P A;  2QS3 A;  4MNP A;  3HHF A;  3IOU A;  1DTZ A;  2ZZX A;  5IKB A;  1JW5 A;  3PUY E;  3S2V A;  3LSW A;  2HEU A;  1B2H A;  4U23 A;  4GWX A;  1UTH B;  1KWH A;  1FQD A;  3HCQ A;  2ZXT A;  3SEU A;  1A7L A;  4OVT A;  3KBR A;  1IMD A;  3B7D A;  5H8S A;  3O97 A;  3S9E A;  1MM7 A;  3RN8 A;  1L5T A;  2FYI A;  4C0R A;  2QSX A;  3T9V A;  1ANF A;  4OFJ A;  3UA8 A;  2KQZ A;  3VE1 B;  3E4R A;  1XS5 A;  4MH5 A;  2DVZ A;  1ZJL A;  3T66 A;  1NUZ A;  3G3F A;  5I2K A;  2O51 A;  1D9Q A;  3KJ7 A;  4RK2 A;  3OD7 A;  4NAP A;  4OFO A;  4MX6 A;  3ODB A;  1G0H A;  3T93 B;  1NNP A;  2GHA A;  1B51 A;  1EZ9 A;  4RY1 A;  2XXQ A;  5I57 B;  4OMB A;  5AA4 B;  4P9K A;  4OTE A;  1B3L A;  3PPQ A;  3FXR A;  3H6V A;  1Y4C A;  3SKP A;  3D1R A;  1OQH A;  2V3U A;  2HXR A;  1FBF A;  3IK6 B;  3O6G A;  3GLB A;  2GFE A;  1SI0 A;  4P8B A;  3E78 A;  2UVH A;  4POW A;  2B4M A;  2G29 A;  5CMM A;  2Z8F A;  2ESN A;  3SER A;  5F24 A;  4F2O A;  4QSD A;  1YCJ A;  3M3L A;  1B7H A;  1IIT A;  2AYS A;  3FUZ A;  3B6W A;  3K6U A;  2CMO A;  2DE2 A;  1JNF A;  3CG1 A;  1P1Q A;  4P0I A;  4IGR A;  1B32 A;  1R9L A;  1NUY A;  4F3B A;  1ZTY A;  3LSL A;  4FIM A;  4DI3 D;  5DTB A;  2XX9 A;  3IO6 A;  3QUJ A;  1LCF A;  1H43 A;  3ILT B;  1SW4 A;  2I3W A;  5A5L A;  1VFD A;  1B0H A;  3OO9 A;  3CSG A;  2V4C A;  2H5Y A;  4X48 A;  2UVI A;  5A5X B;  1LBB A;  3FV2 A;  4RPN A;  5IGA A;  4EXL A;  1YPN A;  2A5T A;  2PT2 A;  3W9V A;  4ZEI A;  2PMS A;  1LEV A;  5EYF A;  2A5S A;  1NUW A;  1QGX A;  2MKZ A;  3TCG A;  1CB6 A;  4TLM B;  2XA5 A;  1B7Z A;  4F2Q A;  2QVV A;  1I6A A;  4GWU A;  3E9X A;  1WDN A;  1XOC A;  4OVS A;  2Z8E A;  4PDH A;  1EU8 A;  3SZP A;  5A5X A;  3TTR A;  2CEX A;  1IZ1 A;  1M5B A;  3THI A;  1MXZ A;  4NMY A;  2REJ A;  1NKX A;  3IB1 A;  2F7B A;  1VR5 A;  4Z0I A;  1JP4 A;  4EQ7 A;  3FV1 A;  4YU0 A;  1NI9 A;  4MEV A;  2AL5 A;  2OPD A;  5LDZ A;  1QJM A;  3VVF A;  1MM6 A;  3HST A;  3MQ9 A;  1HSL A;  2RCB A;  1A8F A;  3N94 A;  3HFU A;  3OO8 A;  4KR5 A;  1ZKB A;  1XT8 A;  1GVC A;  4I62 A;  3BIG A;  1YYZ A;  5CBS A;  4N15 A;  1NNT A;  5AA2 D;  3SEX A;  3DP8 A;  1R6Z A;  5JEI A;  1S9T A;  3O2A A;  1RDZ A;  5ET8 A;  3PMV A;  1R1N A;  2Y5K A;  4R74 A;  5FBP A;  1QUI A;  3FXB A;  1UIU A;  5TU0 A;  1OVT A;  1MDP 1;  1SQY A;  1QKA A;  2KR0 A;  1LBX A;  3O9P A;  3TCF A;  1NV1 A;  2ONS A;  3VVE A;  4OVP A;  2R9J A;  3D4C A;  2G93 A;  5TPA B;  3TFL A;  4KYE A;  5EYG A;  3R7X A;  1IXC A;  1ELJ A;  2RF1 A;  4ZEF A;  4FAJ A;  2D5W A;  2PVU A;  3LUY A;  2V3T A;  4JBZ A;  4PE5 B;  1ZIU A;  2H98 A;  1JEU A;  3IX1 A;  2WX9 A;  3DP4 A;  2I4C A;  4GF8 A;  4PE3 A;  3MZ1 A;  4MNI A;  2Q89 A;  3WAE A;  2HPG A;  3KOS A;  1MXU A;  3O6I A;  5DT6 A;  1NV2 A;  2HZK A;  2UYF A;  3RY3 A;  4GOT A;  5CC2 A;  1LBW A;  2GHB A;  3H7M A;  5DVJ A;  1NH8 A;  4OVJ A;  4O94 A;  3K1P A;  3LV0 A;  4HE0 A;  2NUV A;  4OET A;  4F18 A;  4BDO A;  4H8J A;  4MFI A;  3A3U A;  4P0G A;  3H03 A;  1MRP A;  1GV8 A;  3QMF A;  2Z8D A;  3RQT A;  1XHY A;  2ZZW A;  4PFY A;  2QVR A;  2F7A A;  2V84 A;  4LA9 A;  4QFL A;  3ZKL A;  4OVR A;  5ICT A;  5I57 A;  4BDR A;  4LUB A;  3IR1 A;  3TEP A;  4Q0C A;  4NE4 A;  3IO4 A;  1SW5 A;  2XD2 A;  3PUX E;  1FBP A;  3IOV A;  4YB6 A;  3VLU A;  4GLI A;  1FJ6 A;  2B3B A;  3C36 A;  2RIN A;  1LB9 A;  1D9Y A;  4GRK A;  1QUK A;  4EF1 A;  4O8M A;  5IZ1 A;  4THI A;  4NF4 A;  2Q9T A;  5DVI A;  3F11 A;  4RPO A;  3KSJ A;  3JYR A;  3K1M A;  1J1N A;  2PT1 A;  1G0I A;  1FPK A;  1MQJ A;  3PUV E;  5IAI A;  4JVI A;  4X04 A;  2WYK A;  3FZV A;  4QSC A;  4P56 A;  2O69 A;  3PD9 A;  4I9D A;  1NV3 A;  3MP1 A;  4QFP A;  1B9J A;  4H46 A;  4DE8 A;  1MXV A;  2ZNS A;  3IFC A;  2Y7W A;  1RDY A;  4WED A;  3S9M C;  4YKI A;  2QS1 A;  4LZ5 A;  4KYD A;  2O6A A;  3IOW A;  5H8H B;  2Y7R A; 
#chains in the Genus database with same CATH homology
 4GX4 A;  4NG7 A;  4PFI A;  2WEF A;  3RPL B;  1Q9D A;  4MAG A;  4XFE A;  4JVC A;  5EQA A;  4HCW A;  2QFL A;  4PCD A;  4DI3 D;  2QVU A;  3MYU A;  3QMF A;  2DE4 A;  4GWZ A;  1LBV A;  3PTY A;  4P1L A;  4PFR A;  1RDZ A;  2WBD A;  3A29 A;  5J16 A;  2KQZ A;  1XI6 A;  1LBY A;  2BJI A;  4PDD A;  1SPI A;  5ET8 A;  3KC0 A;  2ZZW A;  4N81 A;  1EYI A;  5A5L A;  3MST A;  1DBZ A;  1INP A;  1DK4 A;  1FPL A;  3E79 A;  4N6K A;  2Y5K A;  4XEQ A;  4N17 A;  5FBP A;  2QPQ A;  4P47 A;  2DE3 A;  5IZZ A;  1K9Y A;  2QVR A;  2HHM A;  3B50 A;  2CZK A;  2DVZ A;  3FXB A;  4GX3 A;  2V4C A;  2FBP A;  4OAN A;  5I5P A;  4OVR A;  3FBP A;  5CM6 A;  1FJ9 A;  2KR0 A;  2CZI A;  1LBX A;  2WYP A;  4N8Y A;  1NV1 A;  4PF6 A;  1AWB A;  1IMA A;  1IME A;  2FIX A;  1NUZ A;  4GX6 A;  2VT5 A;  4GWY A;  5EYH A;  5T3J A;  4NHB A;  4UAB A;  3T1B A;  3IFA A;  4O7M A;  1D9Q A;  2Q8M A;  2VPN A;  4OVP A;  5I7I A;  5J1D A;  1FPB A;  1NUX A;  2L5V A;  4NAP A;  5EQ9 A;  1KA1 A;  4FBP A;  4MX6 A;  4PBQ A;  3U65 A;  5IGA A;  5EQ8 A;  2GQ1 A;  1NV4 A;  1G0H A;  4HCY A;  3W9W A;  2ZZV A;  5EYG A;  1FBP A;  2F3D A;  4LN5 A;  3W9V A;  1FPF A;  2WBB A;  4N8G A;  4IR8 A;  4I3Y A;  1FJ6 A;  1FSA A;  1FPD A;  4PFB A;  2PCR A;  1FPG A;  1NV7 A;  1YXI A;  1LEV A;  2R8T A;  4GBV A;  2OX3 A;  5ESY A;  1NUW A;  1QGX A;  1FBE A;  3B8B A;  2PFZ A;  4X8R A;  2MKZ A;  4PET A;  1FPI A;  2Y5L A;  1FBC A;  4P9K A;  4DI4 B;  2XWI A;  4NX1 A;  4PAI A;  2XA5 A;  4O8M A;  4F1V A;  1NV6 A;  4PTK A;  5IZ1 A;  2QVV A;  2P3N A;  1EYJ A;  5IM2 A;  4QXD A;  1NV5 A;  4GWU A;  4N6D A;  1FRP A;  1CNQ A;  3D1R A;  5ET5 A;  2Q9T A;  4PAF A;  4OVS A;  4F1U A;  2HXR A;  4XF5 A;  4G61 A;  4MNI A;  3BIH A;  1FBF A;  2WX9 A;  5ET6 A;  4O7I A;  1FBH A;  3ISP A;  4PC9 A;  3RYD A;  3RPL A;  3KC1 A;  4MIJ A;  4PF8 A;  4PDH A;  4YZZ A;  3SZP A;  2XWO A;  2CEX A;  4PE3 A;  4MCO A;  3T0J A;  4NN3 A;  1G0I A;  1FBG A;  1FPK A;  1FTA A;  4HE1 A;  4MMP A;  5IZ3 B;  1IMF A;  5I3S A;  4MNP A;  2VPO A;  1FPJ A;  2PFY A;  3EKI A;  4P8B A;  2Q74 A;  1NV0 A;  3E78 A;  4HE2 A;  2CZH A;  5IZ3 A;  2ZZX A;  1FPE A;  4QBA A;  1KA0 A;  4JVI A;  2B4M A;  2XWK A;  2HPG A;  3GYY A;  4NF0 A;  5ET7 A;  3CHG A;  2XWV A;  4NQ8 A;  2FHY A;  1IMB A;  4X04 A;  5LTC A;  4KXP A;  3ROJ A;  2WYK A;  4PBH A;  4P56 A;  1NV2 A;  1DCU A;  2CEY A;  2HZK A;  5F24 A;  5JK4 A;  4M1V A;  3LUZ A;  4GBW A;  4MJO A;  4N91 A;  1JP4 A;  1K9Z A;  2DDK A;  1NV3 A;  3KBZ A;  1YZ0 A;  4GWX A;  1NI9 A;  4MEV A;  4H45 A;  4PGP A;  4H46 A;  2HZL A;  4P3L A;  1LBW A;  4GWS A;  1EYK A;  5LDZ A;  1BK4 A;  4PGN A;  1IMC A;  4MNC A;  4P1E A;  1RDX A;  2F3B A;  3NOH A;  4X9T A;  3IFC A;  4N4U A;  4YIC A;  2F5X A;  4OVT A;  5EQ7 A;  2DE2 A;  3LV0 A;  2P3V A;  4O94 A;  1IMD A;  1RDY A;  4GWW A;  4NGU A;  4HE0 A;  4AS4 A;  3HFU A;  4OVQ A;  5DW8 A;  2V3Q A;  4JVD A;  4F18 A;  4I3E A;  2JJK A;  1FBD A;  4I40 A;  2B4L A;  4F19 A;  3BIG A;  1LBZ A;  2XXK A;  1YYZ A;  1KZ8 A;  1NUY A;  2FIE A;  2FVZ A;  4HXV A;  4MHF A;  4N15 A;  4PAK A;  4AS5 A;  2OWZ A;  4OA4 A;  1VDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...